4G9NA

Crystal structure of the rhizoctonia solani agglutinin in complex with n'-acetyl-galactosamine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
APISLPAGTYTLKNVSTGTVLDLWRGEAAEGTAIQGYKSHGGDNQKWRLKWTGKGNQVTLQNVKSGTYVGTASNIQNSVNVVGSTTAVPLDIVAADKGFAIEAADHRLFVLDLKESNPANETPVIYYNNNATDNQKWKFIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Rhizoctonia solani agglutinin reveals a domain-swapping dimeric assembly.
pubmed doi rcsb
molecule keywords agglutinin
molecule tags Sugar binding protein
total genus 40
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4g9nA00
3FJBA 5D63A 1F31A 2MLLB 5DUYA 1RZOB 1FV2A 1XG6A 1BFCA 5FNWA 4ZLBB 4OEEA 2P23A 4GP3A 4DCKC 3UD8A 4ZKTB 3O4AA 3RTIB 2VLCA 4I2SA 4X37A 1A8DA 4XFTA 3FUQA 3O4OA 2QN4A 5EG6C 2KLLA 5GAQA 1V6UA 21BIA 3RMXA 3CA4A 3VEQA 4QBCA 9ILBA 1Q03A 2R9KB 2D43A 4LO7B 5F8YA 1JLYA 1G9DA 2X2TA 4IYBA 5DZUA 4HA2A 1DZCA 4AN7B 3FJCA 3CA3A 1FWUA 3P6JA 3WINA 4WBCA 1YF8B 1ISYA 2D20A 3OGGA 2K43A 4XKIA 5JLVA 4LO2A 4I1EA 1K5UA 4I3NA 4ZBVB 1V6VA 3PG0A 4QD2C 5BQUA 1IJTA 1EV2A 4Q9PA 4HJJA 3AJ6A 3V0AB 5BOWA 2KKIA 1PWAA 3C9ZA 1HKNA 3OBTA 1I1EA 4IHZA 3BAOA 2Z48A 4X38A 1FGAA 3CQAA 3D7WB 4QKSA 1WD4A 2XOAA 2HWMA 2AAIB 4XFSA 6I1BA 7I1BA 1WD3A 4JPZA 8I1BA 3IAGC 1ISZA 5I1BA 4G6JA 4I4PA 4FVVA 2ZR1B 5F8SA 1XZZA 1RG8A 2FDBM 3BA7A 4XFUA 3P53A 2NTDA 3H6QA 3UD7A 4USOA 4I4UA 4P0KA 4X3AA 1II4A 1JT3A 3BA5A 2ZQNA 3UD9A 4G9MA 3EF2A 2F2FA 3AH4A 3V0AA 1FMZA 3AZWA 4IZEA 4D0ZA 4OWLA 3ZC9A 4Z9WB 4KEKA 5F90A 3VT2A 4TLPA 2GO2A 4I4SA 1Z0HA 2WBCA 2X2SA 4ZGRB 3N7MA 4OUJA 3CRHA 3T8SA 4JP0A 2K4AB 2J3PA 2E4MA 1BFGA 1IHKA 1S0BA 4I4QA 1BLAA 1R8NA 3AKIA 3A07A 5D62A 4ZFUB 1AVWB 3I2XA 3UJ0A 1BFFA 4GAFA 2DS0A 3WMVA 2MC2A 2FGFA 2HWAA 4IONA 3BTAA 1IILA 1W3AA 3O4CA 4IZXA 4L4HA 1IRAX 4QALA 2ERMA 4ENDA 2ZQOA 1YBIA 1YTOA 4I0YA 4R6UB 3FUOA 1Z2VA 1MC9A 2Q3NB 3FJFA 1TTUA 41BIA 1W3GA 4G9NA 4OWJA 31BIA 1JT4A 3N7LA 3H6RB 4JAWA 2IWTB 4YOLA 4QKRA 3VT1A 4EFPA 1E0OA 1ITBA 1G9CA 1SR4A 3WA1A 1DQOA 1DZDA 2Q9XA 4CJMA 2BEBA 2QYIB 1NUNA 5BXPA 3Q7YA 1VCLA 2HZ9A 5F8WA 3O4BA 1Q1UA 3IM7A 1HWMB 3FJJA 4JQ0A 4I1BA 3BB2A 5BP5A 3AKHA 1YYNA 3HMYA 1EVTA 1G9BA 2ET2A 1TOOA 3CU1B 2WRYA 4GOVA 2GZBA 3WINC 3BX1C 3ILAA 3CA6A 3LTQA 1I1BA 1G82A 2D22A 4FGFA 4F34A 1DJSB 4QBVA 3OJVA 1UPSA 2VUAA 4LO1C 3ZXDA 4OEGA 1KNMA 4EFQA 2FFVA 2KH2A 5EHAA 3N7KA 3AKFA 4Q91A 2DRZA 3BA4A 1RMLA 1HCEA 3H6RA 4I8MA 2NYYA 3FJIA 4D0TA 3CA0A 1PUMB 3P6IA 4G1RA 5D61A 1DFCA 3HOMA 1K5VA 2FFUA 3VT0A 3E8LC 3BAUA 1QXMA 3O44A 1FN0A 4A7YA 1EYLA 4JRAA 4OWKA 1J0SA 1MD6A 1AVUA 3HALA 3AH1A 3MPPG 4LO0C 3BAHA 3FJAA 4ZOTA 1DLLA 5DSSB 1ILR1 4A7ZA 2D24A 2VU9A 5FNXA 1BASA 3BRGC 3VSZA 3QR5A 4JKXB 4LO3A 3CA5A 4EFRA 1HCDA 4J2SA 4G6MA 2KI6B 1FMMS 1G9AA 3ZXGA 3VUOA 3N7JA 3FJ8A 4Q9GA 2D7RA 4USPA 2VXTI 3WO3A 1FQ9A 1JY0A 2UUSA 2Z49A 4L4IA 3Q7XA 1AXMA 2AQZA 3WMUA 4P0JA 5FZZA 4H04A 4I7IA 3AH2A 4IY8A 2AFGA 1IOBA 2I1BA 4DENA 1HWOB 1ISWA 1ISVA 3RSJA 3UJ4A 3AKGA 4I4RA 4ZA3B 1XYFA 5FZUA 1IRPA 4QC4A 3V79C 1DFQA 1JT5A 4KEJA 5E24E 1Q04A 4I4OA 2E4MC 4A7KA 3Q7WA 3BAVA 3N0KA 2DRYA 2RQ9A 1S0FA 1JLXA 3NBNA 3NBDA 3VSFA 2NP0A 2D44A 1TP0A 4GP0A 4II0A 3JRRA 3HBWA 1NZKA 3RTJB 2LIQA 2L5XA 1TFMB 5BVPI 2M49A 2VXRA 2D1ZA 3FJDA 4Z8SB 3PMEA 4IQPA 4QD2B 3IM5A 5JMCA 1S0DA 3O4DA 3SNVA 1BARA 3R4SA 3AJ5A 1V6XA 3MALA 4H9WA 1TWEA 2K8RA 3IM6A 3H6SE 4QO3A 1SR4C 1FV3A 1JTCA 1TIEA 4J2XA 4D8HA 4I37A 2RSTA 3A23A 2ESUA 3KMVA 4PC4A 5B2HA 1S0CA 3F62B 3RMYA 1P63A 5BP5C 4ISRA 2D23A 3ZX7A 3V0BB 1S0GA 4LO2C 4J2KA 4I6IA 2NZ9A 4JKQA 1HWPB 1OQLB 5BXRA 5BQUC 1WBAA 3FJKA 1AF9A 1SZ6B 4ZFYB 3HSMA 3PHZA 3K1XA 4KEIA 3OJ2A 2VSEA 5EC5A 3TC2A 3S8KA 4LO1A 1AVXB 4I4XA 2F8XC 5FZYA 2BFHA 4ZFWB 1V6WA 3BADA 3VWCA 3WO4A 5BXTA 1JT7A 3B9UA 1DQGA 3OBRA 4EKXB 1QQLA 3FJEA 2HW9A 3O49A 1DIWA 2LIEA 2Y9GA 3A21A 5HPZA 1CE7B 3POKA 3LLPA 4J23B 1HWNB 2MIBA 2Y9XE 3O3QA 4LO7C 2D7IA 4I96A 4AN6A 1PZZA 3WO2A 1HIBA 5DVHA 3OGFA 3UDAA 1R8OA 2IHOA 3O5WB 2P39A 1T9FA 1PC8B 3S8JA 4LO0A 4KBBA 4F83A 3OJMA 3FGMA 1XHBA 1CVSA 4GOYA 3V0BA 4LO3C 1WBCA 3NBCA 1W3FA 3QYDA 1M16A 3FJHA 1EPWA 3NBEA 1BLDA 3CA1A 3BAGA 3W9TA 1T4QA 1ONKB 2F2FC 1ABRB 1BA7A 3HN1A 3A22A 2FO1A 4KC3A 1YXWA 4I4VA 5G00A 4EEEB 3BRFA 4P0LA 3IIRA 4DEPA 3F1RA 1RY7A 2KI4A 4IY9A 3FJ9A 1JQZA 3PUBA 3BAQA 3CRGA 4HR6C 4ISQA 4EB2B 1BFBA 1GGPB 3CRIA 2VSAA 3I29B 3JUTA 2NM1A 2DREA 1FWVA 3ZC8A 1L2HA 1QQKA 3I2AA 4GAIA 3NJ5A 1N4KA 2NVHA 4OW4A 2Y9FA 4LO8B 4OEFA 1AVAC 1D0HA 2RG9B 4I4YA 1IT0A 3BRDA 4X39A 1PUUB 1S0LA 2AXMA 3R4UA 4P6AA 3CAHA 2YUGA 1S0EA 1M2TB 1TWMA 5BXSA 3FFZA 2BEAA 1ISXA 3AZVA 4J2YA 1AFCA 1Z4SA 2Y9WC
chains in the Genus database with same CATH superfamily
3FJBA 5D63A 1F31A 2MLLB 5DUYA 1RZOB 1FV2A 1XG6A 1BFCA 5FNWA 4ZLBB 4MZHA 4OEEA 2P23A 4GP3A 4DCKC 3UD8A 4ZKTB 3O4AA 3RTIB 2VLCA 4I2SA 4X37A 1A8DA 4XFTA 3FUQA 3O4OA 2QN4A 5EG6C 2KLLA 5GAQA 1V6UA 21BIA 3RMXA 3CA4A 3VEQA 4QBCA 9ILBA 1Q03A 4H75A 2R9KB 2D43A 4LO7B 5F8YA 1JLYA 1G9DA 2X2TA 4IYBA 5DZUA 4HA2A 1DZCA 4AN7B 3FJCA 3CA3A 1FWUA 3P6JA 3WINA 4WBCA 1YF8B 1ISYA 2D20A 3OGGA 2K43A 4XKIA 5JLVA 4LO2A 4I1EA 1K5UA 4I3NA 4ZBVB 1V6VA 3PG0A 4QD2C 5BQUA 1IJTA 1EV2A 4Q9PA 4HJJA 3AJ6A 3V0AB 5BOWA 2KKIA 1PWAA 3C9ZA 1HKNA 3OBTA 1I1EA 4IHZA 3BAOA 2Z48A 4X38A 1FGAA 3CQAA 3D7WB 4UY4A 2NS2A 4QKSA 1WD4A 2XOAA 2HWMA 2AAIB 4XFSA 6I1BA 7I1BA 1WD3A 4JPZA 8I1BA 3IAGC 1ISZA 5I1BA 4G6JA 4I4PA 4FVVA 2ZR1B 5F8SA 1XZZA 1RG8A 2FDBM 3BA7A 4XFUA 3P53A 2NTDA 3H6QA 3UD7A 4USOA 4I4UA 4P0KA 4X3AA 1II4A 1JT3A 3BA5A 2ZQNA 3UD9A 4G9MA 3EF2A 2F2FA 3AH4A 3V0AA 1FMZA 3AZWA 4IZEA 4D0ZA 4OWLA 3ZC9A 4Z9WB 4KEKA 5F90A 3VT2A 4TLPA 2GO2A 4I4SA 1Z0HA 2WBCA 2X2SA 4ZGRB 3N7MA 4OUJA 3CRHA 4MZFB 3T8SA 4JP0A 2K4AB 2J3PA 2E4MA 1BFGA 1IHKA 1S0BA 4I4QA 1BLAA 1R8NA 3AKIA 3A07A 5D62A 4ZFUB 1AVWB 3I2XA 3UJ0A 1BFFA 4GAFA 2DS0A 3WMVA 2MC2A 2FGFA 2HWAA 4IONA 3BTAA 1IILA 1W3AA 3O4CA 4IZXA 4L4HA 1IRAX 4QALA 2ERMA 4ENDA 2ZQOA 1YBIA 1YTOA 4I0YA 4R6UB 3FUOA 1Z2VA 1MC9A 2Q3NB 3FJFA 1TTUA 41BIA 1W3GA 4G9NA 4OWJA 31BIA 1JT4A 3N7LA 3H6RB 4JAWA 2IWTB 4YOLA 4QKRA 3VT1A 4EFPA 1E0OA 1ITBA 1G9CA 1SR4A 3WA1A 1DQOA 1DZDA 2Q9XA 4CJMA 2BEBA 2QYIB 1NUNA 4MZGB 5BXPA 3Q7YA 1VCLA 2HZ9A 5F8WA 3O4BA 1Q1UA 3IM7A 1HWMB 3FJJA 4JQ0A 4I1BA 3BB2A 5BP5A 3AKHA 1YYNA 3HMYA 1EVTA 1G9BA 2ET2A 1TOOA 3CU1B 2WRYA 4GOVA 2GZBA 3WINC 3BX1C 3ILAA 3CA6A 3LTQA 1I1BA 1G82A 2D22A 4FGFA 4F34A 1DJSB 4QBVA 3OJVA 1UPSA 2VUAA 4LO1C 3ZXDA 4OEGA 1KNMA 4EFQA 2FFVA 2KH2A 5EHAA 3N7KA 3AKFA 4Q91A 2DRZA 3BA4A 1RMLA 1HCEA 3H6RA 4I8MA 2NYYA 3FJIA 4D0TA 3CA0A 1PUMB 3P6IA 4G1RA 5D61A 1DFCA 3HOMA 1K5VA 2FFUA 3VT0A 3E8LC 3BAUA 1QXMA 3O44A 1FN0A 4A7YA 1EYLA 4JRAA 4OWKA 1J0SA 1MD6A 1AVUA 3HALA 3AH1A 3MPPG 4LO0C 3BAHA 3FJAA 4ZOTA 1DLLA 5DSSB 1ILR1 4A7ZA 2D24A 2VU9A 5FNXA 1BASA 3BRGC 3VSZA 3QR5A 4JKXB 4LO3A 3CA5A 4EFRA 1HCDA 4J2SA 4G6MA 2KI6B 1FMMS 1G9AA 3ZXGA 3VUOA 3N7JA 3FJ8A 4Q9GA 2D7RA 4USPA 2VXTI 3WO3A 1FQ9A 1JY0A 2UUSA 2Z49A 4L4IA 3Q7XA 1AXMA 2AQZA 3WMUA 4P0JA 5FZZA 4H04A 4I7IA 3AH2A 4IY8A 2AFGA 1IOBA 2I1BA 4DENA 1HWOB 1ISWA 1ISVA 3RSJA 3UJ4A 3AKGA 4I4RA 4ZA3B 1XYFA 5FZUA 1IRPA 4QC4A 3V79C 1DFQA 1JT5A 4KEJA 5E24E 1Q04A 4I4OA 2E4MC 4A7KA 3Q7WA 3BAVA 3N0KA 2DRYA 2RQ9A 1S0FA 1JLXA 3NBNA 3NBDA 3VSFA 2NP0A 2D44A 1TP0A 4GP0A 4II0A 3JRRA 3HBWA 1NZKA 3RTJB 2LIQA 2L5XA 1TFMB 5BVPI 2M49A 2VXRA 2D1ZA 3FJDA 4Z8SB 3PMEA 4IQPA 4QD2B 3IM5A 5JMCA 1S0DA 3O4DA 3SNVA 1BARA 3R4SA 3AJ5A 1V6XA 3MALA 4H9WA 1TWEA 2K8RA 3IM6A 3H6SE 4QO3A 1SR4C 1FV3A 1JTCA 1TIEA 4J2XA 4D8HA 4I37A 2RSTA 3A23A 2ESUA 3KMVA 4PC4A 5B2HA 1S0CA 3F62B 3RMYA 1P63A 5BP5C 4ISRA 2D23A 3ZX7A 3V0BB 1S0GA 4LO2C 4J2KA 4I6IA 2NZ9A 4JKQA 1HWPB 1OQLB 5BXRA 5BQUC 1WBAA 3FJKA 1AF9A 1SZ6B 4ZFYB 3HSMA 3PHZA 3K1XA 4KEIA 3OJ2A 2VSEA 5EC5A 3TC2A 3S8KA 4LO1A 1AVXB 4I4XA 2F8XC 5FZYA 2BFHA 4ZFWB 1V6WA 3BADA 3VWCA 3WO4A 5BXTA 1JT7A 3B9UA 1DQGA 3OBRA 4EKXB 1QQLA 3FJEA 2HW9A 3O49A 1DIWA 2LIEA 2Y9GA 3A21A 5HPZA 1CE7B 3POKA 3LLPA 4J23B 1HWNB 2MIBA 2Y9XE 3O3QA 4LO7C 2D7IA 4I96A 4AN6A 1PZZA 3WO2A 1HIBA 5DVHA 3OGFA 3UDAA 1R8OA 2IHOA 3O5WB 2P39A 1T9FA 1PC8B 3S8JA 4LO0A 4KBBA 4F83A 3OJMA 3FGMA 1XHBA 1CVSA 4GOYA 3V0BA 4LO3C 1WBCA 3NBCA 1W3FA 3QYDA 1M16A 3FJHA 1EPWA 3NBEA 1BLDA 3CA1A 3BAGA 3W9TA 1T4QA 1ONKB 2F2FC 1ABRB 1BA7A 3HN1A 3A22A 2FO1A 4KC3A 1YXWA 4I4VA 5G00A 4EEEB 3BRFA 4P0LA 3IIRA 4DEPA 3F1RA 1RY7A 2KI4A 4IY9A 3FJ9A 1JQZA 3PUBA 3BAQA 3CRGA 4HR6C 4ISQA 4EB2B 1BFBA 1GGPB 3CRIA 2VSAA 3I29B 3JUTA 2NM1A 2DREA 1FWVA 3ZC8A 1L2HA 1QQKA 3I2AA 4GAIA 3NJ5A 1N4KA 2NVHA 4OW4A 2Y9FA 4LO8B 4OEFA 1AVAC 1D0HA 2RG9B 4I4YA 1IT0A 3BRDA 4X39A 1PUUB 1S0LA 2AXMA 3R4UA 4P6AA 3CAHA 2YUGA 1S0EA 1M2TB 1TWMA 5BXSA 3FFZA 2BEAA 1ISXA 3AZVA 4J2YA 1AFCA 1Z4SA 2Y9WC
chains in the Genus database with same CATH topology
3FJBA 5D63A 1F31A 2MLLB 5DUYA 1RZOB 1FV2A 1XG6A 1BFCA 5FNWA 4ZLBB 4MZHA 4OEEA 2P23A 4GP3A 4DCKC 3UD8A 4ZKTB 3O4AA 3RTIB 2VLCA 4I2SA 4X37A 1A8DA 4XFTA 3FUQA 3O4OA 2QN4A 5EG6C 2KLLA 5GAQA 1V6UA 21BIA 3RMXA 3CA4A 3VEQA 4QBCA 9ILBA 1Q03A 4H75A 2R9KB 2D43A 4LO7B 5F8YA 1JLYA 1G9DA 2X2TA 4IYBA 5DZUA 4HA2A 1DZCA 4AN7B 3FJCA 3CA3A 1FWUA 3P6JA 3WINA 4WBCA 1YF8B 1ISYA 2D20A 3OGGA 2K43A 4XKIA 5JLVA 4LO2A 4I1EA 1K5UA 4I3NA 4ZBVB 1V6VA 3PG0A 4QD2C 5BQUA 1IJTA 1EV2A 4Q9PA 4HJJA 3AJ6A 3V0AB 5BOWA 2KKIA 1PWAA 3C9ZA 1HKNA 3OBTA 1I1EA 4IHZA 3BAOA 2Z48A 4X38A 1FGAA 3CQAA 3D7WB 4UY4A 2NS2A 4QKSA 1WD4A 2XOAA 2HWMA 2AAIB 4XFSA 6I1BA 7I1BA 1WD3A 4JPZA 8I1BA 3IAGC 1ISZA 5I1BA 4G6JA 4I4PA 4FVVA 2ZR1B 5F8SA 1XZZA 1RG8A 2FDBM 3BA7A 4XFUA 3P53A 2NTDA 3H6QA 3UD7A 4USOA 4I4UA 4P0KA 4X3AA 1II4A 1JT3A 3BA5A 2ZQNA 3UD9A 4G9MA 3EF2A 2F2FA 3AH4A 3V0AA 1FMZA 3AZWA 4IZEA 4D0ZA 4OWLA 3ZC9A 4Z9WB 4KEKA 5F90A 3VT2A 4TLPA 2GO2A 4I4SA 1Z0HA 2WBCA 2X2SA 4ZGRB 3N7MA 4OUJA 3CRHA 4MZFB 3T8SA 4JP0A 2K4AB 2J3PA 2E4MA 1BFGA 1IHKA 1S0BA 4I4QA 1BLAA 1R8NA 3AKIA 3A07A 5D62A 4ZFUB 1AVWB 3I2XA 3UJ0A 1BFFA 4GAFA 2DS0A 3WMVA 2MC2A 2FGFA 2HWAA 4IONA 3BTAA 1IILA 1W3AA 3O4CA 4IZXA 4L4HA 1IRAX 4QALA 2ERMA 4ENDA 2ZQOA 1YBIA 1YTOA 4I0YA 4R6UB 3FUOA 1Z2VA 1MC9A 2Q3NB 3FJFA 1TTUA 41BIA 1W3GA 4G9NA 4OWJA 31BIA 1JT4A 3N7LA 3H6RB 4JAWA 2IWTB 4YOLA 4QKRA 3VT1A 4EFPA 1E0OA 1ITBA 1G9CA 1SR4A 3WA1A 1DQOA 1DZDA 2Q9XA 4CJMA 2BEBA 2QYIB 1NUNA 4MZGB 5BXPA 3Q7YA 1VCLA 2HZ9A 5F8WA 3O4BA 1Q1UA 3IM7A 1HWMB 3FJJA 4JQ0A 4I1BA 3BB2A 5BP5A 3AKHA 1YYNA 3HMYA 1EVTA 1G9BA 2ET2A 1TOOA 3CU1B 2WRYA 4GOVA 2GZBA 3WINC 3BX1C 3ILAA 3CA6A 3LTQA 1I1BA 1G82A 2D22A 4FGFA 4F34A 1DJSB 4QBVA 3OJVA 1UPSA 2VUAA 4LO1C 3ZXDA 4OEGA 1KNMA 4EFQA 2FFVA 2KH2A 5EHAA 3N7KA 3AKFA 4Q91A 2DRZA 3BA4A 1RMLA 1HCEA 3H6RA 4I8MA 2NYYA 3FJIA 4D0TA 3CA0A 1PUMB 3P6IA 4G1RA 5D61A 1DFCA 3HOMA 1K5VA 2FFUA 3VT0A 3E8LC 3BAUA 1QXMA 3O44A 1FN0A 4A7YA 1EYLA 4JRAA 4OWKA 1J0SA 1MD6A 1AVUA 3HALA 3AH1A 3MPPG 4LO0C 3BAHA 3FJAA 4ZOTA 1DLLA 5DSSB 1ILR1 4A7ZA 2D24A 2VU9A 5FNXA 1BASA 3BRGC 3VSZA 3QR5A 4JKXB 4LO3A 3CA5A 4EFRA 1HCDA 4J2SA 4G6MA 2KI6B 1FMMS 1G9AA 3ZXGA 3VUOA 3N7JA 3FJ8A 4Q9GA 2D7RA 4USPA 2VXTI 3WO3A 1FQ9A 1JY0A 2UUSA 2Z49A 4L4IA 3Q7XA 1AXMA 2AQZA 3WMUA 4P0JA 5FZZA 4H04A 4I7IA 3AH2A 4IY8A 2AFGA 1IOBA 2I1BA 4DENA 1HWOB 1ISWA 1ISVA 3RSJA 3UJ4A 3AKGA 4I4RA 4ZA3B 1XYFA 5FZUA 1IRPA 4QC4A 3V79C 1DFQA 1JT5A 4KEJA 5E24E 1Q04A 4I4OA 2E4MC 4A7KA 3Q7WA 3BAVA 3N0KA 2DRYA 2RQ9A 1S0FA 1JLXA 3NBNA 3NBDA 3VSFA 2NP0A 2D44A 1TP0A 4GP0A 4II0A 3JRRA 3HBWA 1NZKA 3RTJB 2LIQA 2L5XA 1TFMB 5BVPI 2M49A 2VXRA 2D1ZA 3FJDA 4Z8SB 3PMEA 4IQPA 4QD2B 3IM5A 5JMCA 1S0DA 3O4DA 3SNVA 1BARA 3R4SA 3AJ5A 1V6XA 3MALA 4H9WA 1TWEA 2K8RA 3IM6A 3H6SE 4QO3A 1SR4C 1FV3A 1JTCA 1TIEA 4J2XA 4D8HA 4I37A 2RSTA 3A23A 2ESUA 3KMVA 4PC4A 5B2HA 1S0CA 3F62B 3RMYA 1P63A 5BP5C 4ISRA 2D23A 3ZX7A 3V0BB 1S0GA 4LO2C 4J2KA 4I6IA 2NZ9A 4JKQA 1HWPB 1OQLB 5BXRA 5BQUC 1WBAA 3FJKA 1AF9A 1SZ6B 4ZFYB 3HSMA 3PHZA 3K1XA 4KEIA 3OJ2A 2VSEA 5EC5A 3TC2A 3S8KA 4LO1A 1AVXB 4I4XA 2F8XC 5FZYA 2BFHA 4ZFWB 1V6WA 3BADA 3VWCA 3WO4A 5BXTA 1JT7A 3B9UA 1DQGA 3OBRA 4EKXB 1QQLA 3FJEA 2HW9A 3O49A 1DIWA 2LIEA 2Y9GA 3A21A 5HPZA 1CE7B 3POKA 3LLPA 4J23B 1HWNB 2MIBA 2Y9XE 3O3QA 4LO7C 2D7IA 4I96A 4AN6A 1PZZA 3WO2A 1HIBA 5DVHA 3OGFA 3UDAA 1R8OA 2IHOA 3O5WB 2P39A 1T9FA 1PC8B 3S8JA 4LO0A 4KBBA 4F83A 3OJMA 3FGMA 1XHBA 1CVSA 4GOYA 3V0BA 4LO3C 1WBCA 3NBCA 1W3FA 3QYDA 1M16A 3FJHA 1EPWA 3NBEA 1BLDA 3CA1A 3BAGA 3W9TA 1T4QA 1ONKB 2F2FC 1ABRB 1BA7A 3HN1A 3A22A 2FO1A 4KC3A 1YXWA 4I4VA 5G00A 4EEEB 3BRFA 4P0LA 3IIRA 4DEPA 3F1RA 1RY7A 2KI4A 4IY9A 3FJ9A 1JQZA 3PUBA 3BAQA 3CRGA 4HR6C 4ISQA 4EB2B 1BFBA 1GGPB 3CRIA 2VSAA 3I29B 3JUTA 2NM1A 2DREA 1FWVA 3ZC8A 1L2HA 1QQKA 3I2AA 4GAIA 3NJ5A 1N4KA 2NVHA 4OW4A 2Y9FA 4LO8B 4OEFA 1AVAC 1D0HA 2RG9B 4I4YA 1IT0A 3BRDA 4X39A 1PUUB 1S0LA 2AXMA 3R4UA 4P6AA 3CAHA 2YUGA 1S0EA 1M2TB 1TWMA 5BXSA 3FFZA 2BEAA 1ISXA 3AZVA 4J2YA 1AFCA 1Z4SA 2Y9WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJB A;  5D63 A;  1F31 A;  2MLL B;  5DUY A;  1RZO B;  1FV2 A;  1XG6 A;  1BFC A;  5FNW A;  4ZLB B;  4OEE A;  2P23 A;  4GP3 A;  4DCK C;  3UD8 A;  4ZKT B;  3O4A A;  3RTI B;  2VLC A;  4I2S A;  4X37 A;  1A8D A;  4XFT A;  3FUQ A;  3O4O A;  2QN4 A;  5EG6 C;  2KLL A;  5GAQ A;  1V6U A;  21BI A;  3RMX A;  3CA4 A;  3VEQ A;  4QBC A;  9ILB A;  1Q03 A;  2R9K B;  2D43 A;  4LO7 B;  5F8Y A;  1JLY A;  1G9D A;  2X2T A;  4IYB A;  5DZU A;  4HA2 A;  1DZC A;  4AN7 B;  3FJC A;  3CA3 A;  1FWU A;  3P6J A;  3WIN A;  4WBC A;  1YF8 B;  1ISY A;  2D20 A;  3OGG A;  2K43 A;  4XKI A;  5JLV A;  4LO2 A;  4I1E A;  1K5U A;  4I3N A;  4ZBV B;  1V6V A;  3PG0 A;  4QD2 C;  5BQU A;  1IJT A;  1EV2 A;  4Q9P A;  4HJJ A;  3AJ6 A;  3V0A B;  5BOW A;  2KKI A;  1PWA A;  3C9Z A;  1HKN A;  3OBT A;  1I1E A;  4IHZ A;  3BAO A;  2Z48 A;  4X38 A;  1FGA A;  3CQA A;  3D7W B;  4QKS A;  1WD4 A;  2XOA A;  2HWM A;  2AAI B;  4XFS A;  6I1B A;  7I1B A;  1WD3 A;  4JPZ A;  8I1B A;  3IAG C;  1ISZ A;  5I1B A;  4G6J A;  4I4P A;  4FVV A;  2ZR1 B;  5F8S A;  1XZZ A;  1RG8 A;  2FDB M;  3BA7 A;  4XFU A;  3P53 A;  2NTD A;  3H6Q A;  3UD7 A;  4USO A;  4I4U A;  4P0K A;  4X3A A;  1II4 A;  1JT3 A;  3BA5 A;  2ZQN A;  3UD9 A;  4G9M A;  3EF2 A;  2F2F A;  3AH4 A;  3V0A A;  1FMZ A;  3AZW A;  4IZE A;  4D0Z A;  4OWL A;  3ZC9 A;  4Z9W B;  4KEK A;  5F90 A;  3VT2 A;  4TLP A;  2GO2 A;  4I4S A;  1Z0H A;  2WBC A;  2X2S A;  4ZGR B;  3N7M A;  4OUJ A;  3CRH A;  3T8S A;  4JP0 A;  2K4A B;  2J3P A;  2E4M A;  1BFG A;  1IHK A;  1S0B A;  4I4Q A;  1BLA A;  1R8N A;  3AKI A;  3A07 A;  5D62 A;  4ZFU B;  1AVW B;  3I2X A;  3UJ0 A;  1BFF A;  4GAF A;  2DS0 A;  3WMV A;  2MC2 A;  2FGF A;  2HWA A;  4ION A;  3BTA A;  1IIL A;  1W3A A;  3O4C A;  4IZX A;  4L4H A;  1IRA X;  4QAL A;  2ERM A;  4END A;  2ZQO A;  1YBI A;  1YTO A;  4I0Y A;  4R6U B;  3FUO A;  1Z2V A;  1MC9 A;  2Q3N B;  3FJF A;  1TTU A;  41BI A;  1W3G A;  4G9N A;  4OWJ A;  31BI A;  1JT4 A;  3N7L A;  3H6R B;  4JAW A;  2IWT B;  4YOL A;  4QKR A;  3VT1 A;  4EFP A;  1E0O A;  1ITB A;  1G9C A;  1SR4 A;  3WA1 A;  1DQO A;  1DZD A;  2Q9X A;  4CJM A;  2BEB A;  2QYI B;  1NUN A;  5BXP A;  3Q7Y A;  1VCL A;  2HZ9 A;  5F8W A;  3O4B A;  1Q1U A;  3IM7 A;  1HWM B;  3FJJ A;  4JQ0 A;  4I1B A;  3BB2 A;  5BP5 A;  3AKH A;  1YYN A;  3HMY A;  1EVT A;  1G9B A;  2ET2 A;  1TOO A;  3CU1 B;  2WRY A;  4GOV A;  2GZB A;  3WIN C;  3BX1 C;  3ILA A;  3CA6 A;  3LTQ A;  1I1B A;  1G82 A;  2D22 A;  4FGF A;  4F34 A;  1DJS B;  4QBV A;  3OJV A;  1UPS A;  2VUA A;  4LO1 C;  3ZXD A;  4OEG A;  1KNM A;  4EFQ A;  2FFV A;  2KH2 A;  5EHA A;  3N7K A;  3AKF A;  4Q91 A;  2DRZ A;  3BA4 A;  1RML A;  1HCE A;  3H6R A;  4I8M A;  2NYY A;  3FJI A;  4D0T A;  3CA0 A;  1PUM B;  3P6I A;  4G1R A;  5D61 A;  1DFC A;  3HOM A;  1K5V A;  2FFU A;  3VT0 A;  3E8L C;  3BAU A;  1QXM A;  3O44 A;  1FN0 A;  4A7Y A;  1EYL A;  4JRA A;  4OWK A;  1J0S A;  1MD6 A;  1AVU A;  3HAL A;  3AH1 A;  3MPP G;  4LO0 C;  3BAH A;  3FJA A;  4ZOT A;  1DLL A;  5DSS B;  1ILR 1;  4A7Z A;  2D24 A;  2VU9 A;  5FNX A;  1BAS A;  3BRG C;  3VSZ A;  3QR5 A;  4JKX B;  4LO3 A;  3CA5 A;  4EFR A;  1HCD A;  4J2S A;  4G6M A;  2KI6 B;  1FMM S;  1G9A A;  3ZXG A;  3VUO A;  3N7J A;  3FJ8 A;  4Q9G A;  2D7R A;  4USP A;  2VXT I;  3WO3 A;  1FQ9 A;  1JY0 A;  2UUS A;  2Z49 A;  4L4I A;  3Q7X A;  1AXM A;  2AQZ A;  3WMU A;  4P0J A;  5FZZ A;  4H04 A;  4I7I A;  3AH2 A;  4IY8 A;  2AFG A;  1IOB A;  2I1B A;  4DEN A;  1HWO B;  1ISW A;  1ISV A;  3RSJ A;  3UJ4 A;  3AKG A;  4I4R A;  4ZA3 B;  1XYF A;  5FZU A;  1IRP A;  4QC4 A;  3V79 C;  1DFQ A;  1JT5 A;  4KEJ A;  5E24 E;  1Q04 A;  4I4O A;  2E4M C;  4A7K A;  3Q7W A;  3BAV A;  3N0K A;  2DRY A;  2RQ9 A;  1S0F A;  1JLX A;  3NBN A;  3NBD A;  3VSF A;  2NP0 A;  2D44 A;  1TP0 A;  4GP0 A;  4II0 A;  3JRR A;  3HBW A;  1NZK A;  3RTJ B;  2LIQ A;  2L5X A;  1TFM B;  5BVP I;  2M49 A;  2VXR A;  2D1Z A;  3FJD A;  4Z8S B;  3PME A;  4IQP A;  4QD2 B;  3IM5 A;  5JMC A;  1S0D A;  3O4D A;  3SNV A;  1BAR A;  3R4S A;  3AJ5 A;  1V6X A;  3MAL A;  4H9W A;  1TWE A;  2K8R A;  3IM6 A;  3H6S E;  4QO3 A;  1SR4 C;  1FV3 A;  1JTC A;  1TIE A;  4J2X A;  4D8H A;  4I37 A;  2RST A;  3A23 A;  2ESU A;  3KMV A;  4PC4 A;  5B2H A;  1S0C A;  3F62 B;  3RMY A;  1P63 A;  5BP5 C;  4ISR A;  2D23 A;  3ZX7 A;  3V0B B;  1S0G A;  4LO2 C;  4J2K A;  4I6I A;  2NZ9 A;  4JKQ A;  1HWP B;  1OQL B;  5BXR A;  5BQU C;  1WBA A;  3FJK A;  1AF9 A;  1SZ6 B;  4ZFY B;  3HSM A;  3PHZ A;  3K1X A;  4KEI A;  3OJ2 A;  2VSE A;  5EC5 A;  3TC2 A;  3S8K A;  4LO1 A;  1AVX B;  4I4X A;  2F8X C;  5FZY A;  2BFH A;  4ZFW B;  1V6W A;  3BAD A;  3VWC A;  3WO4 A;  5BXT A;  1JT7 A;  3B9U A;  1DQG A;  3OBR A;  4EKX B;  1QQL A;  3FJE A;  2HW9 A;  3O49 A;  1DIW A;  2LIE A;  2Y9G A;  3A21 A;  5HPZ A;  1CE7 B;  3POK A;  3LLP A;  4J23 B;  1HWN B;  2MIB A;  2Y9X E;  3O3Q A;  4LO7 C;  2D7I A;  4I96 A;  4AN6 A;  1PZZ A;  3WO2 A;  1HIB A;  5DVH A;  3OGF A;  3UDA A;  1R8O A;  2IHO A;  3O5W B;  2P39 A;  1T9F A;  1PC8 B;  3S8J A;  4LO0 A;  4KBB A;  4F83 A;  3OJM A;  3FGM A;  1XHB A;  1CVS A;  4GOY A;  3V0B A;  4LO3 C;  1WBC A;  3NBC A;  1W3F A;  3QYD A;  1M16 A;  3FJH A;  1EPW A;  3NBE A;  1BLD A;  3CA1 A;  3BAG A;  3W9T A;  1T4Q A;  1ONK B;  2F2F C;  1ABR B;  1BA7 A;  3HN1 A;  3A22 A;  2FO1 A;  4KC3 A;  1YXW A;  4I4V A;  5G00 A;  4EEE B;  3BRF A;  4P0L A;  3IIR A;  4DEP A;  3F1R A;  1RY7 A;  2KI4 A;  4IY9 A;  3FJ9 A;  1JQZ A;  3PUB A;  3BAQ A;  3CRG A;  4HR6 C;  4ISQ A;  4EB2 B;  1BFB A;  1GGP B;  3CRI A;  2VSA A;  3I29 B;  3JUT A;  2NM1 A;  2DRE A;  1FWV A;  3ZC8 A;  1L2H A;  1QQK A;  3I2A A;  4GAI A;  3NJ5 A;  1N4K A;  2NVH A;  4OW4 A;  2Y9F A;  4LO8 B;  4OEF A;  1AVA C;  1D0H A;  2RG9 B;  4I4Y A;  1IT0 A;  3BRD A;  4X39 A;  1PUU B;  1S0L A;  2AXM A;  3R4U A;  4P6A A;  3CAH A;  2YUG A;  1S0E A;  1M2T B;  1TWM A;  5BXS A;  3FFZ A;  2BEA A;  1ISX A;  3AZV A;  4J2Y A;  1AFC A;  1Z4S A;  2Y9W C; 
#chains in the Genus database with same CATH topology
 3FJB A;  5D63 A;  1F31 A;  2MLL B;  5DUY A;  1RZO B;  1FV2 A;  1XG6 A;  1BFC A;  5FNW A;  4ZLB B;  4MZH A;  4OEE A;  2P23 A;  4GP3 A;  4DCK C;  3UD8 A;  4ZKT B;  3O4A A;  3RTI B;  2VLC A;  4I2S A;  4X37 A;  1A8D A;  4XFT A;  3FUQ A;  3O4O A;  2QN4 A;  5EG6 C;  2KLL A;  5GAQ A;  1V6U A;  21BI A;  3RMX A;  3CA4 A;  3VEQ A;  4QBC A;  9ILB A;  1Q03 A;  4H75 A;  2R9K B;  2D43 A;  4LO7 B;  5F8Y A;  1JLY A;  1G9D A;  2X2T A;  4IYB A;  5DZU A;  4HA2 A;  1DZC A;  4AN7 B;  3FJC A;  3CA3 A;  1FWU A;  3P6J A;  3WIN A;  4WBC A;  1YF8 B;  1ISY A;  2D20 A;  3OGG A;  2K43 A;  4XKI A;  5JLV A;  4LO2 A;  4I1E A;  1K5U A;  4I3N A;  4ZBV B;  1V6V A;  3PG0 A;  4QD2 C;  5BQU A;  1IJT A;  1EV2 A;  4Q9P A;  4HJJ A;  3AJ6 A;  3V0A B;  5BOW A;  2KKI A;  1PWA A;  3C9Z A;  1HKN A;  3OBT A;  1I1E A;  4IHZ A;  3BAO A;  2Z48 A;  4X38 A;  1FGA A;  3CQA A;  3D7W B;  4UY4 A;  2NS2 A;  4QKS A;  1WD4 A;  2XOA A;  2HWM A;  2AAI B;  4XFS A;  6I1B A;  7I1B A;  1WD3 A;  4JPZ A;  8I1B A;  3IAG C;  1ISZ A;  5I1B A;  4G6J A;  4I4P A;  4FVV A;  2ZR1 B;  5F8S A;  1XZZ A;  1RG8 A;  2FDB M;  3BA7 A;  4XFU A;  3P53 A;  2NTD A;  3H6Q A;  3UD7 A;  4USO A;  4I4U A;  4P0K A;  4X3A A;  1II4 A;  1JT3 A;  3BA5 A;  2ZQN A;  3UD9 A;  4G9M A;  3EF2 A;  2F2F A;  3AH4 A;  3V0A A;  1FMZ A;  3AZW A;  4IZE A;  4D0Z A;  4OWL A;  3ZC9 A;  4Z9W B;  4KEK A;  5F90 A;  3VT2 A;  4TLP A;  2GO2 A;  4I4S A;  1Z0H A;  2WBC A;  2X2S A;  4ZGR B;  3N7M A;  4OUJ A;  3CRH A;  4MZF B;  3T8S A;  4JP0 A;  2K4A B;  2J3P A;  2E4M A;  1BFG A;  1IHK A;  1S0B A;  4I4Q A;  1BLA A;  1R8N A;  3AKI A;  3A07 A;  5D62 A;  4ZFU B;  1AVW B;  3I2X A;  3UJ0 A;  1BFF A;  4GAF A;  2DS0 A;  3WMV A;  2MC2 A;  2FGF A;  2HWA A;  4ION A;  3BTA A;  1IIL A;  1W3A A;  3O4C A;  4IZX A;  4L4H A;  1IRA X;  4QAL A;  2ERM A;  4END A;  2ZQO A;  1YBI A;  1YTO A;  4I0Y A;  4R6U B;  3FUO A;  1Z2V A;  1MC9 A;  2Q3N B;  3FJF A;  1TTU A;  41BI A;  1W3G A;  4G9N A;  4OWJ A;  31BI A;  1JT4 A;  3N7L A;  3H6R B;  4JAW A;  2IWT B;  4YOL A;  4QKR A;  3VT1 A;  4EFP A;  1E0O A;  1ITB A;  1G9C A;  1SR4 A;  3WA1 A;  1DQO A;  1DZD A;  2Q9X A;  4CJM A;  2BEB A;  2QYI B;  1NUN A;  4MZG B;  5BXP A;  3Q7Y A;  1VCL A;  2HZ9 A;  5F8W A;  3O4B A;  1Q1U A;  3IM7 A;  1HWM B;  3FJJ A;  4JQ0 A;  4I1B A;  3BB2 A;  5BP5 A;  3AKH A;  1YYN A;  3HMY A;  1EVT A;  1G9B A;  2ET2 A;  1TOO A;  3CU1 B;  2WRY A;  4GOV A;  2GZB A;  3WIN C;  3BX1 C;  3ILA A;  3CA6 A;  3LTQ A;  1I1B A;  1G82 A;  2D22 A;  4FGF A;  4F34 A;  1DJS B;  4QBV A;  3OJV A;  1UPS A;  2VUA A;  4LO1 C;  3ZXD A;  4OEG A;  1KNM A;  4EFQ A;  2FFV A;  2KH2 A;  5EHA A;  3N7K A;  3AKF A;  4Q91 A;  2DRZ A;  3BA4 A;  1RML A;  1HCE A;  3H6R A;  4I8M A;  2NYY A;  3FJI A;  4D0T A;  3CA0 A;  1PUM B;  3P6I A;  4G1R A;  5D61 A;  1DFC A;  3HOM A;  1K5V A;  2FFU A;  3VT0 A;  3E8L C;  3BAU A;  1QXM A;  3O44 A;  1FN0 A;  4A7Y A;  1EYL A;  4JRA A;  4OWK A;  1J0S A;  1MD6 A;  1AVU A;  3HAL A;  3AH1 A;  3MPP G;  4LO0 C;  3BAH A;  3FJA A;  4ZOT A;  1DLL A;  5DSS B;  1ILR 1;  4A7Z A;  2D24 A;  2VU9 A;  5FNX A;  1BAS A;  3BRG C;  3VSZ A;  3QR5 A;  4JKX B;  4LO3 A;  3CA5 A;  4EFR A;  1HCD A;  4J2S A;  4G6M A;  2KI6 B;  1FMM S;  1G9A A;  3ZXG A;  3VUO A;  3N7J A;  3FJ8 A;  4Q9G A;  2D7R A;  4USP A;  2VXT I;  3WO3 A;  1FQ9 A;  1JY0 A;  2UUS A;  2Z49 A;  4L4I A;  3Q7X A;  1AXM A;  2AQZ A;  3WMU A;  4P0J A;  5FZZ A;  4H04 A;  4I7I A;  3AH2 A;  4IY8 A;  2AFG A;  1IOB A;  2I1B A;  4DEN A;  1HWO B;  1ISW A;  1ISV A;  3RSJ A;  3UJ4 A;  3AKG A;  4I4R A;  4ZA3 B;  1XYF A;  5FZU A;  1IRP A;  4QC4 A;  3V79 C;  1DFQ A;  1JT5 A;  4KEJ A;  5E24 E;  1Q04 A;  4I4O A;  2E4M C;  4A7K A;  3Q7W A;  3BAV A;  3N0K A;  2DRY A;  2RQ9 A;  1S0F A;  1JLX A;  3NBN A;  3NBD A;  3VSF A;  2NP0 A;  2D44 A;  1TP0 A;  4GP0 A;  4II0 A;  3JRR A;  3HBW A;  1NZK A;  3RTJ B;  2LIQ A;  2L5X A;  1TFM B;  5BVP I;  2M49 A;  2VXR A;  2D1Z A;  3FJD A;  4Z8S B;  3PME A;  4IQP A;  4QD2 B;  3IM5 A;  5JMC A;  1S0D A;  3O4D A;  3SNV A;  1BAR A;  3R4S A;  3AJ5 A;  1V6X A;  3MAL A;  4H9W A;  1TWE A;  2K8R A;  3IM6 A;  3H6S E;  4QO3 A;  1SR4 C;  1FV3 A;  1JTC A;  1TIE A;  4J2X A;  4D8H A;  4I37 A;  2RST A;  3A23 A;  2ESU A;  3KMV A;  4PC4 A;  5B2H A;  1S0C A;  3F62 B;  3RMY A;  1P63 A;  5BP5 C;  4ISR A;  2D23 A;  3ZX7 A;  3V0B B;  1S0G A;  4LO2 C;  4J2K A;  4I6I A;  2NZ9 A;  4JKQ A;  1HWP B;  1OQL B;  5BXR A;  5BQU C;  1WBA A;  3FJK A;  1AF9 A;  1SZ6 B;  4ZFY B;  3HSM A;  3PHZ A;  3K1X A;  4KEI A;  3OJ2 A;  2VSE A;  5EC5 A;  3TC2 A;  3S8K A;  4LO1 A;  1AVX B;  4I4X A;  2F8X C;  5FZY A;  2BFH A;  4ZFW B;  1V6W A;  3BAD A;  3VWC A;  3WO4 A;  5BXT A;  1JT7 A;  3B9U A;  1DQG A;  3OBR A;  4EKX B;  1QQL A;  3FJE A;  2HW9 A;  3O49 A;  1DIW A;  2LIE A;  2Y9G A;  3A21 A;  5HPZ A;  1CE7 B;  3POK A;  3LLP A;  4J23 B;  1HWN B;  2MIB A;  2Y9X E;  3O3Q A;  4LO7 C;  2D7I A;  4I96 A;  4AN6 A;  1PZZ A;  3WO2 A;  1HIB A;  5DVH A;  3OGF A;  3UDA A;  1R8O A;  2IHO A;  3O5W B;  2P39 A;  1T9F A;  1PC8 B;  3S8J A;  4LO0 A;  4KBB A;  4F83 A;  3OJM A;  3FGM A;  1XHB A;  1CVS A;  4GOY A;  3V0B A;  4LO3 C;  1WBC A;  3NBC A;  1W3F A;  3QYD A;  1M16 A;  3FJH A;  1EPW A;  3NBE A;  1BLD A;  3CA1 A;  3BAG A;  3W9T A;  1T4Q A;  1ONK B;  2F2F C;  1ABR B;  1BA7 A;  3HN1 A;  3A22 A;  2FO1 A;  4KC3 A;  1YXW A;  4I4V A;  5G00 A;  4EEE B;  3BRF A;  4P0L A;  3IIR A;  4DEP A;  3F1R A;  1RY7 A;  2KI4 A;  4IY9 A;  3FJ9 A;  1JQZ A;  3PUB A;  3BAQ A;  3CRG A;  4HR6 C;  4ISQ A;  4EB2 B;  1BFB A;  1GGP B;  3CRI A;  2VSA A;  3I29 B;  3JUT A;  2NM1 A;  2DRE A;  1FWV A;  3ZC8 A;  1L2H A;  1QQK A;  3I2A A;  4GAI A;  3NJ5 A;  1N4K A;  2NVH A;  4OW4 A;  2Y9F A;  4LO8 B;  4OEF A;  1AVA C;  1D0H A;  2RG9 B;  4I4Y A;  1IT0 A;  3BRD A;  4X39 A;  1PUU B;  1S0L A;  2AXM A;  3R4U A;  4P6A A;  3CAH A;  2YUG A;  1S0E A;  1M2T B;  1TWM A;  5BXS A;  3FFZ A;  2BEA A;  1ISX A;  3AZV A;  4J2Y A;  1AFC A;  1Z4S A;  2Y9W C; 
#chains in the Genus database with same CATH homology
 3FJB A;  5D63 A;  1F31 A;  2MLL B;  5DUY A;  1RZO B;  1FV2 A;  1XG6 A;  1BFC A;  5FNW A;  4ZLB B;  4MZH A;  4OEE A;  2P23 A;  4GP3 A;  4DCK C;  3UD8 A;  4ZKT B;  3O4A A;  3RTI B;  2VLC A;  4I2S A;  4X37 A;  1A8D A;  4XFT A;  3FUQ A;  3O4O A;  2QN4 A;  5EG6 C;  2KLL A;  5GAQ A;  1V6U A;  21BI A;  3RMX A;  3CA4 A;  3VEQ A;  4QBC A;  9ILB A;  1Q03 A;  4H75 A;  2R9K B;  2D43 A;  4LO7 B;  5F8Y A;  1JLY A;  1G9D A;  2X2T A;  4IYB A;  5DZU A;  4HA2 A;  1DZC A;  4AN7 B;  3FJC A;  3CA3 A;  1FWU A;  3P6J A;  3WIN A;  4WBC A;  1YF8 B;  1ISY A;  2D20 A;  3OGG A;  2K43 A;  4XKI A;  5JLV A;  4LO2 A;  4I1E A;  1K5U A;  4I3N A;  4ZBV B;  1V6V A;  3PG0 A;  4QD2 C;  5BQU A;  1IJT A;  1EV2 A;  4Q9P A;  4HJJ A;  3AJ6 A;  3V0A B;  5BOW A;  2KKI A;  1PWA A;  3C9Z A;  1HKN A;  3OBT A;  1I1E A;  4IHZ A;  3BAO A;  2Z48 A;  4X38 A;  1FGA A;  3CQA A;  3D7W B;  4UY4 A;  2NS2 A;  4QKS A;  1WD4 A;  2XOA A;  2HWM A;  2AAI B;  4XFS A;  6I1B A;  7I1B A;  1WD3 A;  4JPZ A;  8I1B A;  3IAG C;  1ISZ A;  5I1B A;  4G6J A;  4I4P A;  4FVV A;  2ZR1 B;  5F8S A;  1XZZ A;  1RG8 A;  2FDB M;  3BA7 A;  4XFU A;  3P53 A;  2NTD A;  3H6Q A;  3UD7 A;  4USO A;  4I4U A;  4P0K A;  4X3A A;  1II4 A;  1JT3 A;  3BA5 A;  2ZQN A;  3UD9 A;  4G9M A;  3EF2 A;  2F2F A;  3AH4 A;  3V0A A;  1FMZ A;  3AZW A;  4IZE A;  4D0Z A;  4OWL A;  3ZC9 A;  4Z9W B;  4KEK A;  5F90 A;  3VT2 A;  4TLP A;  2GO2 A;  4I4S A;  1Z0H A;  2WBC A;  2X2S A;  4ZGR B;  3N7M A;  4OUJ A;  3CRH A;  4MZF B;  3T8S A;  4JP0 A;  2K4A B;  2J3P A;  2E4M A;  1BFG A;  1IHK A;  1S0B A;  4I4Q A;  1BLA A;  1R8N A;  3AKI A;  3A07 A;  5D62 A;  4ZFU B;  1AVW B;  3I2X A;  3UJ0 A;  1BFF A;  4GAF A;  2DS0 A;  3WMV A;  2MC2 A;  2FGF A;  2HWA A;  4ION A;  3BTA A;  1IIL A;  1W3A A;  3O4C A;  4IZX A;  4L4H A;  1IRA X;  4QAL A;  2ERM A;  4END A;  2ZQO A;  1YBI A;  1YTO A;  4I0Y A;  4R6U B;  3FUO A;  1Z2V A;  1MC9 A;  2Q3N B;  3FJF A;  1TTU A;  41BI A;  1W3G A;  4G9N A;  4OWJ A;  31BI A;  1JT4 A;  3N7L A;  3H6R B;  4JAW A;  2IWT B;  4YOL A;  4QKR A;  3VT1 A;  4EFP A;  1E0O A;  1ITB A;  1G9C A;  1SR4 A;  3WA1 A;  1DQO A;  1DZD A;  2Q9X A;  4CJM A;  2BEB A;  2QYI B;  1NUN A;  4MZG B;  5BXP A;  3Q7Y A;  1VCL A;  2HZ9 A;  5F8W A;  3O4B A;  1Q1U A;  3IM7 A;  1HWM B;  3FJJ A;  4JQ0 A;  4I1B A;  3BB2 A;  5BP5 A;  3AKH A;  1YYN A;  3HMY A;  1EVT A;  1G9B A;  2ET2 A;  1TOO A;  3CU1 B;  2WRY A;  4GOV A;  2GZB A;  3WIN C;  3BX1 C;  3ILA A;  3CA6 A;  3LTQ A;  1I1B A;  1G82 A;  2D22 A;  4FGF A;  4F34 A;  1DJS B;  4QBV A;  3OJV A;  1UPS A;  2VUA A;  4LO1 C;  3ZXD A;  4OEG A;  1KNM A;  4EFQ A;  2FFV A;  2KH2 A;  5EHA A;  3N7K A;  3AKF A;  4Q91 A;  2DRZ A;  3BA4 A;  1RML A;  1HCE A;  3H6R A;  4I8M A;  2NYY A;  3FJI A;  4D0T A;  3CA0 A;  1PUM B;  3P6I A;  4G1R A;  5D61 A;  1DFC A;  3HOM A;  1K5V A;  2FFU A;  3VT0 A;  3E8L C;  3BAU A;  1QXM A;  3O44 A;  1FN0 A;  4A7Y A;  1EYL A;  4JRA A;  4OWK A;  1J0S A;  1MD6 A;  1AVU A;  3HAL A;  3AH1 A;  3MPP G;  4LO0 C;  3BAH A;  3FJA A;  4ZOT A;  1DLL A;  5DSS B;  1ILR 1;  4A7Z A;  2D24 A;  2VU9 A;  5FNX A;  1BAS A;  3BRG C;  3VSZ A;  3QR5 A;  4JKX B;  4LO3 A;  3CA5 A;  4EFR A;  1HCD A;  4J2S A;  4G6M A;  2KI6 B;  1FMM S;  1G9A A;  3ZXG A;  3VUO A;  3N7J A;  3FJ8 A;  4Q9G A;  2D7R A;  4USP A;  2VXT I;  3WO3 A;  1FQ9 A;  1JY0 A;  2UUS A;  2Z49 A;  4L4I A;  3Q7X A;  1AXM A;  2AQZ A;  3WMU A;  4P0J A;  5FZZ A;  4H04 A;  4I7I A;  3AH2 A;  4IY8 A;  2AFG A;  1IOB A;  2I1B A;  4DEN A;  1HWO B;  1ISW A;  1ISV A;  3RSJ A;  3UJ4 A;  3AKG A;  4I4R A;  4ZA3 B;  1XYF A;  5FZU A;  1IRP A;  4QC4 A;  3V79 C;  1DFQ A;  1JT5 A;  4KEJ A;  5E24 E;  1Q04 A;  4I4O A;  2E4M C;  4A7K A;  3Q7W A;  3BAV A;  3N0K A;  2DRY A;  2RQ9 A;  1S0F A;  1JLX A;  3NBN A;  3NBD A;  3VSF A;  2NP0 A;  2D44 A;  1TP0 A;  4GP0 A;  4II0 A;  3JRR A;  3HBW A;  1NZK A;  3RTJ B;  2LIQ A;  2L5X A;  1TFM B;  5BVP I;  2M49 A;  2VXR A;  2D1Z A;  3FJD A;  4Z8S B;  3PME A;  4IQP A;  4QD2 B;  3IM5 A;  5JMC A;  1S0D A;  3O4D A;  3SNV A;  1BAR A;  3R4S A;  3AJ5 A;  1V6X A;  3MAL A;  4H9W A;  1TWE A;  2K8R A;  3IM6 A;  3H6S E;  4QO3 A;  1SR4 C;  1FV3 A;  1JTC A;  1TIE A;  4J2X A;  4D8H A;  4I37 A;  2RST A;  3A23 A;  2ESU A;  3KMV A;  4PC4 A;  5B2H A;  1S0C A;  3F62 B;  3RMY A;  1P63 A;  5BP5 C;  4ISR A;  2D23 A;  3ZX7 A;  3V0B B;  1S0G A;  4LO2 C;  4J2K A;  4I6I A;  2NZ9 A;  4JKQ A;  1HWP B;  1OQL B;  5BXR A;  5BQU C;  1WBA A;  3FJK A;  1AF9 A;  1SZ6 B;  4ZFY B;  3HSM A;  3PHZ A;  3K1X A;  4KEI A;  3OJ2 A;  2VSE A;  5EC5 A;  3TC2 A;  3S8K A;  4LO1 A;  1AVX B;  4I4X A;  2F8X C;  5FZY A;  2BFH A;  4ZFW B;  1V6W A;  3BAD A;  3VWC A;  3WO4 A;  5BXT A;  1JT7 A;  3B9U A;  1DQG A;  3OBR A;  4EKX B;  1QQL A;  3FJE A;  2HW9 A;  3O49 A;  1DIW A;  2LIE A;  2Y9G A;  3A21 A;  5HPZ A;  1CE7 B;  3POK A;  3LLP A;  4J23 B;  1HWN B;  2MIB A;  2Y9X E;  3O3Q A;  4LO7 C;  2D7I A;  4I96 A;  4AN6 A;  1PZZ A;  3WO2 A;  1HIB A;  5DVH A;  3OGF A;  3UDA A;  1R8O A;  2IHO A;  3O5W B;  2P39 A;  1T9F A;  1PC8 B;  3S8J A;  4LO0 A;  4KBB A;  4F83 A;  3OJM A;  3FGM A;  1XHB A;  1CVS A;  4GOY A;  3V0B A;  4LO3 C;  1WBC A;  3NBC A;  1W3F A;  3QYD A;  1M16 A;  3FJH A;  1EPW A;  3NBE A;  1BLD A;  3CA1 A;  3BAG A;  3W9T A;  1T4Q A;  1ONK B;  2F2F C;  1ABR B;  1BA7 A;  3HN1 A;  3A22 A;  2FO1 A;  4KC3 A;  1YXW A;  4I4V A;  5G00 A;  4EEE B;  3BRF A;  4P0L A;  3IIR A;  4DEP A;  3F1R A;  1RY7 A;  2KI4 A;  4IY9 A;  3FJ9 A;  1JQZ A;  3PUB A;  3BAQ A;  3CRG A;  4HR6 C;  4ISQ A;  4EB2 B;  1BFB A;  1GGP B;  3CRI A;  2VSA A;  3I29 B;  3JUT A;  2NM1 A;  2DRE A;  1FWV A;  3ZC8 A;  1L2H A;  1QQK A;  3I2A A;  4GAI A;  3NJ5 A;  1N4K A;  2NVH A;  4OW4 A;  2Y9F A;  4LO8 B;  4OEF A;  1AVA C;  1D0H A;  2RG9 B;  4I4Y A;  1IT0 A;  3BRD A;  4X39 A;  1PUU B;  1S0L A;  2AXM A;  3R4U A;  4P6A A;  3CAH A;  2YUG A;  1S0E A;  1M2T B;  1TWM A;  5BXS A;  3FFZ A;  2BEA A;  1ISX A;  3AZV A;  4J2Y A;  1AFC A;  1Z4S A;  2Y9W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...