4G9PA

Structure of the gcpe-mecpp (ispg) complex from thermus thermophilus
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
405
structure length
405
Chain Sequence
EGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the GcpE (IspG)-MEcPP complex from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 133
structure length 405
sequence length 405
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4g9pA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4g9pA02
1Q8AA 1Q7MA 3TYCA 1AOPA 3K13A 3VKTA 3NOYA 1AD4A 4D8AA 4HB7A 6GEPA 3TYDA 2E7FA 3VM1A 3MM5A 1AJ2A 3VKPA 3VLZA 5JQ9A 4S3AA 3TYEA 3MMAA 4DJDC 3MMCA 3MM9A 3MMBA 1Q8JA 1TX2A 2AOPA 3BOFA 2H9AA 3MMCB 3MMAB 3MM5B 2YCJA 3BOLA 2Y5SA 2AKJA 1TWSA 3MMBB 3H24A 4DAIA 1AJ0A 4O0QA 4S3DA 4DJFC 3OR1B 3H2EA 3VKQA 5GEPA 1TX0A 1TWWA 2OGYA 4GEPA 1ZJ9A 4MWAA 3MM6B 3B0JA 4NILA 2XSJB 2Y0FA 3VLYA 3H23A 3V5OA 4MWAB 3VLXA 4NL1A 3MCNA 3H2CA 4DAFA 4D9PA 3H2FA 4MWAD 3OR1A 3H2NA 3OR2B 2V4JB 3MM8A 4S38A 4CCZA 3B0MA 4DJED 3H2OA 4S3BA 4DJFA 3TYAA 3MM7A 2XSJA 4S3EA 4DJFD 3MM6A 4D8ZA 3MCOA 4NIRA 2H9AB 1Q7ZA 4DJDD 7GEPA 3H2MA 3B0HA 3MM9B 1Q85A 3H22A 4C1NA 4MWAC 3VKRA 3H21A 1F6YA 4O1EA 4DJEA 4G9PA 1EYEA 4S23A 1ZJ8A 3MM7B 3TZNA 2Y5JA 4NHVA 4G39A 3MCMA 1TWZA 4AOPA 4C1NB 2DZAA 2VEGA 2V4JA 3MM8B 5AOPA 4MWAE 3B0GA 3AOPA 2VEFA 2DQWA 3GEOA 1Q7QA 2DZBA 4DB7A 4HTRA 3H2AA 4PZVA 3OR2A 3TYBA 2YCLA 2GEPA 3B0LA 4S3CA 3TYZA 3VKSA 4DJDA 3B0NA 4G38A 3H26A 1AD1A 2BMBA 4S39A 3TR9A 4O1FA 3TZFA 4S3FA 2YCLB 3VM0A 2YCKX 8GEPA 3TYUA 1AJZA 2YCIX 4DJEC 2VP8A
chains in the Genus database with same CATH superfamily
5DO8A 2PTZA 2BY0A 3GTFA 3TYCA 1OD0A 1IZJA 3VKAA 3P81A 3PC0A 4HCLA 1NSJA 1JRCA 4GYPC 4AHOA 1PKYA 4ZQRA 4LUYA 1DEDA 4DM2A 1XLKA 3Q58A 3W81A 2HE5A 4C6MA 3N19B 1WO2A 3PZGA 3FOKA 1TZ7A 1WZKA 3GY1A 3LPFA 4H7CA 1RJPA 4JN8A 1E56A 1AW5A 2GDUA 3MYOA 2JIWA 4HIBA 2PDQA 4Y2WA 1M9HA 1UD8A 4OOZA 4PMQA 1GQLA 2ZRYA 3VIOA 3E74A 3AYRA 4CCEA 1BEUA 2XWEA 3VLXA 1BLIA 2I17A 2XPKA 4C6DA 1XICA 4D9PA 3CEPA 2O0TA 3EOLA 3IJ6A 3EDDA 4L80A 4W7UA 3C8FA 2C18A 3RLVA 4DJED 1BXNA 3LM3A 3OBAA 3S2MA 3DC0A 2VGIA 4N6EA 3FX4A 4AD4A 1Q85A 1QPQA 3E2QA 3P5YA 4RV3A 4O57A 4L4PA 2BHZA 3CMGA 2QULA 4EP8C 3A9BA 3G3DA 3L5AA 3SIZA 5TAOA 4IPLA 1RK6A 3G1DA 4MIMA 2J9XA 1M7XA 3E2SA 1VBHA 4NJKA 3PZ9A 5CC5A 2YCIX 5AC5A 3HN3A 3P7YA 5F4WA 1OGBA 3L68A 2DSWA 1EOKA 1JYVA 1XD1A 3GH5A 3FFSA 3PBGA 3IUHA 3S47A 5FA5A 3RCYA 4UFMA 3GH7A 1EX5A 3LG3A 4Q8MA 4X63A 3WLMA 3SQLA 2IMRA 2WWCA 3A3XA 1Q6DA 2V63A 4N4QA 1ZJIA 2FTYA 2A3EA 1LRNA 3UT0A 4O53A 3DH7A 1XC4A 5A5WA 3KAOA 1LQ2A 2ZE0A 4ATDA 3U2OA 3C3UA 4IIGA 2RDXA 2WZMA 4E8CA 4IQJA 3ITLA 3H23A 3NQFA 4ASTA 4EAMA 4IIDA 3V36A 1V3HA 4LAKA 2GVGA 3ZYZA 1JZ8A 3CIWA 4ILSA 2I7GA 2I5IA 3MYPA 1Q6GA 4C60A 3WD2A 1WZMA 4JFUA 2OYKA 4RZ5A 3G2GA 4IL0A 5FCZA 3VNKA 4YTQA 4G9PA 2GOKA 2ZXQA 1R2SA 2WW5A 2V5BA 2Y88A 4MJ2A 3PTKA 3UG8A 3OBKA 1TELA 4CCCA 1OF8A 5XINA 1EDGA 3LA4A 1KM2A 5FACA 1LQAA 2ZUVA 1QJWA 3HMCA 3MA8A 3SW6A 4P7OA 5FL1A 2C1GA 2ATMA 4F0KA 4YXGA 4GQBA 1ISWA 1XG4A 1B9BA 2EPNA 5FJOA 3NOEA 5GVJA 4XD3A 3MJMA 3LBCA 3BLIA 4QNEA 2QXWA 3CB3A 3NM1A 4I9TA 3CV1A 2NX3A 2D22A 3GXIA 1PDZA 1HJSA 1W1ZA 4QEEA 4EANA 4C7FA 3W7LA 4HKPA 5BXTA 3OA3A 4PMJA 2OZ3A 4RPQA 3TTOA 2PC4A 3EA1A 4ZE4A 1KGXA 3NEVA 1X8FA 1TVPA 4XZLX 4DRSA 1OBAA 3LGDA 1B0IA 3EPMA 3FCPA 2CCRA 4OV9A 3E0FA 5HWNA 1U1JA 1IT8A 3WQ4A 4ERGA 1MZRA 2XYLA 3B9NA 3UJEA 1V02A 1B4EA 2PLKA 1YXYA 2E9MA 3A64A 3IIZA 1WQ5A 4RUBA 1FCBA 3WF0A 3LSBA 4KWUA 5K2ZA 2OSWA 2ACQA 1A0EA 2HVOA 2OX1A 2YA0A 4IMEA 3VNIA 1YX1A 5G2WA 3ITCA 4CGTA 3LHVA 1MW0A 1V51A 2ZRVA 1A47A 1A0CA 4K68A 5A6LA 5AC6A 2P88A 4O1DA 4GNKB 4M1BA 5C2XA 3CAKA 2ZUSA 2CLLA 2NXIA 1N8WA 2A4AA 3A4WA 1DE5A 1EJWC 1VFSA 2OO6A 2IQTA 2EAWA 5I6SA 4JQAA 1SO5A 4CU7A 2J7HA 1JFHA 3DENA 3NZ1A 4LW7A 3APYA 2G8ZA 2QCCA 3BO9A 2GFTA 2XN0A 3WLIA 4KEVA 1NFPA 1SFLA 2H8ZA 5I0DA 1WZLA 4PBGA 2DSUA 2Z7KA 2AAMA 2GUUA 5CJNA 5C70A 3IIXA 3NL6A 2ON3A 3L5LA 2FKPA 3S5NA 4IZGA 5A6JA 2WPGA 3ALFA 1K9FA 2CLIA 3WBYA 1JPKA 4OBRA 3IWPA 2CYGA 4QRNA 2PWVA 4DY1A 3AWNA 2WKLA 3LHYA 4Z2GA 3INPA 2CU0A 3WUEA 3FXGA 5FF0A 3O6CA 3GXFA 3H7UA 2RDUA 1YKWA 3IGSA 2VZUA 3EX1A 4HP5A 3VZZA 3LCXA 4NAFA 2VGBA 3RYSA 1PWMA 5MKGB 2HNEA 4O1CA 3GZ3A 3LCGA 3B0GA 3CV2A 3VIIA 5FSDC 2WMJA 1V02E 3LNPA 3VIFA 4RXGA 2Z2AA 3WMSA 3B40A 4B5WA 1MO0A 2CW6A 4PUEA 1VCVA 1NJJA 3A4AA 1KKOA 1GW9A 4LRSA 2PEVA 1WUFA 4NZJA 4U3AA 1JQVA 1RR2A 3KOZA 2B7QA 3H4WA 4A4AA 4UQBA 2PS2A 2O7SA 1WBHA 4E2VA 4IJBA 2PURA 2YCEA 1IXPA 4BS0A 1FWFC 2CPUA 3F2CA 2JFEX 1ICSA 1G6CA 1X8CA 5AYYA 1NDVA 5D04C 3RILA 3SJ3A 1XC6A 3EWXA 5G4WA 1FCUA 3W84A 4NZ1A 5ABGA 1ZS2A 4ATLA 5EMYA 4GH3A 1DL3A 3EDEA 1GG1A 4JD4A 1CBGA 1ZY9A 2MNRA 1GG0A 2VHLA 1H1NA 3SY1A 1E43A 3L0NA 3EX2A 2AQVA 4KCUA 1ITCA 2VCCA 1T5AA 4ONVA 4WJXA 1EHAA 1Z48A 4EACA 1ADDA 2VKZG 4F0LA 5A1AA 3SGGA 4Q8TA 5D2YA 2YZRA 3MM8B 1RJQA 1JFXA 1UD5A 3NZQA 3N15A 4HTYA 3UNTA 3WQVA 1FHUA 1QUMA 2JIEA 2PTDA 2CLKA 5DN1A 4AZHA 2YCLB 2OSYA 3GVWA 1Z42A 1S1PA 1PIGA 2VP8A 3GBDA 1N7KA 2E77A 3QGAC 3D3AA 2XH0A 5HQEA 3TX9A 2CIPA 4GZ7A 3PZIA 1WAUA 2YYUA 2X05A 3VMNA 1E9ZB 4H6RA 1KCLA 2VZOA 1L2QA 1Q6EA 3P60A 4JTFA 1T41A 2YDSA 1OK6A 3CV6A 1YDYA 4TR9A 4C6OA 4L5ZA 4HK5A 3W2KA 3IAPA 3HZ3A 3S1UA 1BVWA 2VFFA 3Q65A 5EA9A 1XCXA 1GVSA 2GGIA 1E1FA 1KW1A 1W1IE 3N2BA 3N34A 3OVQA 1M01A 2Y1HA 4QE5A 2PA6A 3ATZA 3T05A 3B4UA 4Q4KA 5LNRA 2ESCA 2OFJA 4JTJA 4DBUA 2Q3RA 4GZIA 1GVFA 2PP3A 1QNRA 3GS6A 4B3ZA 3A21A 2IQDA 4XAYA 4RKAA 3S2JA 5CAHA 2AMXA 1LG2A 1VHCA 2C1IA 5J5DA 4C6NA 3M64A 1XLGA 1NWTA 3N18A 1TJRA 5CG7A 3SCPA 1KV5A 1PEZA 3GNXA 3EMCA 1QHZA 3WDJA 3S1WA 3PBWA 3VTRA 2AGTA 3TZFA 4Y9PA 4FNRA 3TOPA 3M46A 4KFOA 3CQ0A 3STPA 4I7VA 1H62A 4HHMA 1IIGA 1N82A 2QJGA 4WCJA 4RLIA 2EPKX 2VXNA 4P5UA 2ASHA 2E67A 1OK4A 3DHPA 3QY8A 4ZQPA 4Y8EA 3PNUA 4US6A 3O9NA 4DWSB 5BRBA 4QX4A 3ISIX 3UZ5A 2ZA2A 4PSPA 3ITYA 3LK6A 5G4EA 4UTKA 1GK8A 2QCDA 3JVAA 4AXNA 2Z6JA 3QLLA 1M65A 4S3DA 3WLJA 4ZQCA 3BZJA 3UXAA 2EPMX 4QTGA 3BAIA 3S3GA 4PUJA 2BVWA 4GVHA 4UXDA 2DW6A 4PTWA 1ZTVA 3WUGA 4NZ3A 3NO5A 2WOQA 3LX9A 2YDRA 4I90A 3QMTA 1SR9A 4FS9A 2DJLA 3I10A 4B3KA 2CLHA 2ZZ5A 3N6JA 1T99A 3HPAA 3PSWA 1OEPA 3EWCA 1B3OA 1L6WA 4D8ZA 1Q7ZA 1C8XA 5ABFA 1C8VA 4US5A 1KQZA 1K9TA 3OJGA 4Q8NA 4LVGA 3NGFA 4WXZA 3WF2A 4GINA 3W53A 1GUVA 4F0MA 2ZCGA 4IG2B 2OLSA 3JUGA 5ABFB 1W3LA 4L4MA 4CD4A 3J7HA 3KVJA 3KZPA 1OFPA 4Y9NA 3PBMA 5DQPA 3CZEA 2VCAA 1SR0A 1H7NA 3DAQA 4OUIA 1JEZA 1ZSXA 5EU9A 2VJXA 1JPIA 1QOPA 4WZHA 4EPDC 3PWAA 1VFOA 3IVTA 2XUCA 2WSRA 4HA1A 3B06A 1J10A 4HN8A 5F7UA 5DANA 4LUTA 2Z4GA 1VH7A 3ZSTA 2PZNA 3OEXA 4JDBA 3CQHA 4O0QA 4NZCA 2J7EA 5T9CE 4PMXA 4ORIA 4G6CA 2B7OA 4NI3A 1HG3A 3AIBA 1JF5A 1MXGA 3B8UA 3RCMA 3PBYA 3WBWA 4GYPA 4AWEA 1LG1A 3FJ4A 3GAYA 5A6BD 1RK5A 5GNXA 4C6KA 3UGRA 5EFDA 3VIHA 1HKIA 1K1DA 3ITOA 2O9TA 1O68A 2J9YA 2ZUMA 4HCDA 1TA3A 3UQNA 1QR7A 1UIPA 3ITGA 4ZQOA 4DF2A 2OB3A 4JAWA 3POCA 3WQFA 1KLYA 2F2HA 1QATA 4O50A 5ECUA 3C2RA 1FWBC 5EGRA 3QV8A 4Q4RA 2Z0IA 2Q6ZA 5KMYA 3CAQA 3W1NA 4JQ4A 1W9DM 1EJVC 4JY8A 3S1XA 3L21A 3ABZA 4GIYA 3R5EA 2PDLA 3RO8A 4HPHA 1E73M 3VNJA 1IEQA 4O15A 2QZRA 3S9YA 2VR5A 3DZ1A 4EIVA 3VM0A 4YYCA 1Q3NA 2OQLA 1ZJBA 1TTJA 1VFUA 2UBPC 3UJFA 5A6MA 3N3MA 3N2MA 1S2UA 2GVLA 3EMZA 4IUGA 3V18A 4FXFA 4Q6JA 3A13A 3EWDA 5C2GA 3VINA 5H6HA 3MUIA 4GUGA 3WK1A 3RO6A 4AW7A 2ZX9A 3GNDA 3M5XA 3SR7A 4DYKA 2VDIA 1YNPA 3DKLA 5DLCA 1XSJA 4X0NA 4LAMA 4UTWC 4IUOA 1TA3B 1JIBA 4JOMA 1WXYA 2Y0FA 4KGJA 3GHUA 1DJIA 2P3ZA 2D0HA 4HOWA 1M7JA 2PCEA 3FEMA 4P8XA 2PFHA 1KD0A 2PMQA 1MW2A 3HGJA 3G0SA 3LNMA 2F6UA 2NQ5A 3L67A 1D7KA 3V16A 4FPSA 3E5BA 1S2VA 2DUAA 1P7TA 1HN1A 1JI2A 1MW3A 2BY3A 1PIFA 1S5TA 2ALRA 1F9CA 1K77A 1RV8A 1TTPA 2HZGA 1K6WA 3UERA 1UA3A 3VD4A 1RH9A 3M5YA 4UOZA 3KL0A 2CXEA 3G18A 1SU5A 3F4NA 1TIMA 5F1VA 1R86A 1UBPC 4R27A 3CO4A 3L2IA 3CUFA 2ZVIA 1BQGA 4KWVA 4JTLA 1XINA 2V2CA 4PEEA 5M17A 1AVAA 2HTMA 3ABRA 3GVVA 1AH4A 3RJYA 3EXTA 4O8AA 3AROA 4NRRA 4QEHA 2ZX6A 4HNTA 1QPNA 1WCGA 3TKFA 2ZX5A 4IG2A 1D3HA 1ICPA 3C2OA 3UCCA 3CHDA 3ABQA 4AHQA 1X1NA 3V1PA 3IPWA 4AD2A 4F40A 4K7VA 4MUZA 5A6TC 4PMNA 5IBXA 4V27A 3GAKA 1LROA 3KBMA 3W7EA 1RAKA 2DH2A 1C93A 1V6XA 1MUMA 4JEQA 3VGDA 4AZ5A 4H9ZA 4H9TA 2WJEA 4JX6A 4R7OA 1SQ7A 3V7PA 1K8YA 5JH2A 1YPIA 2A3BA 1J12A 1K9EA 4IFOA 4DHGA 3PAOA 2CBUA 4KCTA 3L4WA 3LI1A 3QTPA 4C1NA 4RV8A 5EKYA 5H2ZA 3GVQA 3T78A 3BANA 3NTYA 3TTSA 1X39A 3E1F1 1W2VA 4F2BA 5AOPA 2A3AA 2ZZ4A 2OYMA 1OFDA 3L4YA 1R38A 5D33A 1KRAC 4AH7A 5TD4A 3C2EA 2HISA 4AMCA 2VMFA 2GJLA 2NQZA 3GW0A 4ZL1A 2JKEA 1VP5A 1U5JA 3KHDA 5A8QA 4AY8A 4Z2IA 6GEPA 3O05A 2DV0A 3FKKA 3R8RA 3TSBA 2J25A 3PUDA 3LLXA 1JDFA 1KFEA 3TQ0A 2INZA 3DI0A 4KCWA 4QROA 3PPHA 1XWYA 1AJ0A 3CBWA 4XZBA 3EKZA 1WOBA 5G2IA 3BV7A 2WWDA 3CZ8A 3TJXA 1OD8A 3K1GA 1A3XA 3W22A 2AOSA 4Z1DA 5AHNA 1TVLA 1FDZA 3K4AA 1EKOA 1Z8AA 1ZENA 2DDXA 2W67A 3HQPA 4AAJA 3W82A 3WQ8A 4H01A 3RMJA 4B92A 1FX6A 4KEUA 1VEPA 1LL6A 3GU2A 5A2BA 3U5UA 4BQ4A 3CUJA 4NAFB 1OX5A 3DYOA 1XYZA 4HHLA 1KCKA 4JTTA 4LS2A 1KBLA 4NZFA 1Q66A 3UYCA 2X2YA 2NQHA 4BF9A 4UFLA 3I6EA 2ABAA 1EGZA 3W6MA 4KRUA 4UTMA 1HNYA 1TYGA 7TAAA 3FXYA 4MFEA 3T09A 2PZ0A 3F2BA 3VDBA 5E9AA 3W01A 5A6AA 2R1LA 3GM8A 4GQRA 5MF5A 3W3OA 4MGGA 1POKA 3IACA 4QBXA 1Q7MA 3FS2A 5I2UA 5G1TA 4K36A 5IDZA 3BJSA 4D8AA 3DG6A 1XYCA 4KIEA 4IGSA 2WMGA 4MKVA 3KLLA 4ZQNA 4FLQA 4LVDA 4KQNA 3NL5A 2WBGA 3T40A 5C7VA 1EIBA 2WZTA 2CLMA 4JR5A 4CN4A 1MUWA 1D2KA 3I4KA 1TQXA 2D1ZA 3URNA 2QMKA 1RZMA 1KBKA 3OYZA 4LFYA 3P0XA 4BZYA 3PPFA 4M82A 4BHYA 2ISDA 1AL8A 1JNDA 2Y24A 3MCNA 1PX4A 4FLOA 3UJSA 1V3JA 5ECVA 3TWAA 3NYDA 3PF3A 3TIMA 3R1ZA 3TEVA 2OGJA 3ZR4A 4XIAA 2J66A 1LTDA 4GIEA 3CH9A 5I3FA 4Z0JA 5HMFA 3KBSA 1S5NA 2E6YA 2E1DA 3SRDA 4A2SA 2ZUUA 3RM8A 1TR9A 5K4XA 4B15A 5JBDA 3C5QA 1FXPA 1SJDA 1GGOA 3NL2A 4ECLA 4UQDA 4C91A 4LU0A 4MWAE 1KTNA 1XF0A 4FXSA 4GI8A 2CWNA 3ARVA 4QLJA 3G1VA 2CNCA 3WFAA 2WMKA 2WCGA 4GKLA 4JHMA 5FAJA 3SAZA 4DLFA 4BFAA 1JCXA 1R87A 2V5LA 3WLKX 4AEFA 4PCPA 1FFRA 4GG9A 1RCXB 4M19A 1W56A 2WM1A 2ZBTA 2V81A 2WVUA 3UD6A 4EXQA 1DHPA 4CNTA 3BOLA 4HSNA 4MY1A 1YMYA 1K3UA 2GQ9A 2Z1SA 3E3HA 3N9SA 4K38A 1TX0A 2Q8LA 4NAEB 3HIJA 4C6IA 2XG9A 1U1UA 1R85A 3B8IA 3P84A 2YOCA 4GVIA 5D2XA 3D6NA 2NVCA 3BVJA 2WV8A 1JG9A 3CUXA 1X98A 1T0OA 1Y8BA 3GIYA 3M0LA 1EJ7L 4PRWA 3QHOA 4GIRA 1XKJA 3G0XA 4AD0A 2GK1A 3H2OA 2YZ5A 3LMYA 3T6CA 1RBAA 2R1MA 1J4EA 4GISA 3U5YA 5DY2A 4WJ8A 3FSTA 3CYJA 1Y5VA 1UWAA 1GVRA 3MANA 2QMJA 1IWPA 3S5YA 1XJBA 5CC7A 3THQA 4UIOA 4ZOCA 2GSHA 4IPIA 2OELA 4LUSA 4CD6A 3MHFA 3NSMA 1QPOA 4LSBA 2FGBA 3GD6A 4NAEA 2W66A 4QLKA 3C2FA 1CCWB 4H4IA 3QSTA 2ZZ1A 2QS8A 4GCAA 3RU6A 5AN7A 4QJ4B 3DFHA 4W4QA 5IFTA 3R8GA 5A6SA 2ALDA 1XIJA 3GFXA 3LN3A 2GGEA 5I3DA 2XVPA 5TQLA 3NEHA 1OGSA 1J6PA 4IHCA 3LSCA 4PB4A 3NDOA 1H09A 2ZDSA 4AC7C 5IXEA 3VOCA 1Q6LA 3VIPA 5LKYA 1FA2A 1TPEA 1QT1A 1TWIA 4XG1A 3DFPA 4MNMA 1MYRA 2YL9A 3B8DA 4RE0A 3WN6A 1JCMP 1V6YA 3LQGA 3GC5A 3M47A 3K4DA 3DC8A 4FA3A 3UF9A 1VYPX 1QI2A 4M1RA 1O1HA 3IVUA 3UXDA 4NYYA 2PDPA 3A5VA 1VGAA 3G6LA 2W61A 4JHOA 3EPNA 3WUBA 4JYEA 4U10A 5GPRA 5CCZA 2QYGA 3QY7A 4QDMA 4NJIA 4LQ1A 1XLIA 3B0LA 1QHOA 1FXQA 4E8DA 4G38A 2GQAA 4RE2A 4LPCA 5BYWA 1OX6A 1ZALA 1PE1A 1ZU8A 2R94A 2PC8A 4AXKA 1XYAA 1W3TA 3WQCA 1NOUA 1CXIA 1JCNA 3PUEA 2W92A 1SMDA 5EBAA 4JCMA 2R24A 1W5NA 1R9XA 3W7MA 1OF6A 1R3WA 3L4TA 5C9XA 4XBSA 2EG6A 3VYLA 4WY0A 1XYMA 3MMBB 3L4UA 1TKKA 1XLMA 1QU4A 4MJ4A 1K03A 3EOUA 3W74A 3WO8A 1DBTA 3IV3A 3OGRA 5A8MA 4B9ZA 1VFLA 3SSZA 2ZUWA 1RQBA 2ISFA 4W93A 3GNRA 1E4NA 4CCZA 1PKNA 1FWHC 3CT7A 5BXRA 1YEYA 4LBSA 4LCQA 2A3LA 4UMAA 5FJJA 3M07A 1F3XA 1LYXA 3M1ZA 1QTWA 2XFFA 2H6RA 2PGEA 4ZB5A 5CQ1A 5I77A 1G94A 3R11A 1GYLA 1TTIA 4G8TA 3WLRA 4YTTA 2ZICA 3AZSA 3NG3A 4OOUA 4U2YA 1J0IA 2DGAA 4K7YA 1I4NA 1H7PA 4NJJA 1GNXA 4GIAA 4AOPA 4Q4OA 4JFVA 4GQQA 2Z1XA 4NU7A 4DELA 4MKNA 5A2AA 4DB7A 3TQKA 4UQCA 3U2ZA 5JU6A 4A35A 5D8WA 2Z1WA 3K8LA 3WYZA 1V79A 2ZX7A 2PF8A 4DBEA 4E4PA 3C6CA 3BTNA 4IMCA 3BG9A 3FLUA 3EX4A 1I45A 3WH6A 4WOZA 4HNCA 4QM1A 3NPUA 2QCDB 4K1WA 3WLQA 1KFKA 4LUSB 4H19A 2A7PA 2PPGA 2ZXBA 1E9LA 5G1YA 3LTSA 3EB3A 2G41A 1UR4A 1G01A 3QOKA 1CX9A 4XSLA 4ZSTA 2W79A 4WXYA 2E6AA 1XDMA 2OQYA 5HR7A 4KIRA 3W1AA 1MRAA 1PVNA 3PVFA 3OR1A 3HM7A 4J3TA 4AZBA 3MQTA 2X40A 1O12A 2WYSA 4AY7A 1CB2A 4WSHA 2O4QA 4KS0A 4QE4A 1E40A 1DIKA 2DUZA 1X96A 4A8IA 1DWHM 4O19A 1QNQA 3E49A 2DVUA 1Q63A 2PP1A 3FSUA 4CVUA 3CPUA 1MXDA 4WD0A 5FKYA 1DIEA 4HN4A 4W84A 3EDFA 4A22A 1KCZA 4LS0A 3WJYA 3FGCB 1J9YA 4JGDA 3KTSA 1UPMB 4UFHA 3IEBA 1WDDA 2O55A 2PCQA 3TR9A 1A5KC 4S2CA 1KKRA 1L6YA 3EB2A 2NQLA 1MVYA 4H04A 3ARZA 4MZYA 1C29A 1A50A 1EQCA 1A5CA 4RCXA 3AIUA 1H50A 1MDRA 3PZNA 3QMRA 4DPPA 4M5PA 4PFMA 3IS4A 3WJZA 3AHVA 1EO5A 2C71A 4PEKA 1NU5A 1C91A 1ZFJA 4GMEA 3G8RA 2EXOA 4NX5A 3MMAB 1H5YA 3UZWA 1CGYA 5JH1A 5IHRA 2V5KA 2Y5SA 1CXHA 3UWWA 3A5FA 4UQEA 5C0QA 1O6IA 2F6XA 2D2GA 3U57A 3OLIA 4NNCA 2C3ZA 2CFFA 2NT1A 2YBVA 3C56A 1UG6A 1YTKA 4IPNB 1WDPA 2X8RA 2X41A 3P0WA 3SCNA 3FJ6A 5EMJA 2I9EA 1TPWA 1DJXA 1MEIA 2WCSA 2YFNA 3GHTA 1U22A 3NFUA 2TYSA 3L2LA 1I2OA 2JF6A 3CV7A 4PMDA 1W2PA 2VFGA 3MC5A 2YW3A 3PS7A 4BI7A 1REQB 3S9ZA 3U2EA 1ZGDA 3SCOA 1FHVA 4GI9A 2WSQA 4W89A 3AU2A 1AFSA 1QNSA 4G5DA 4XAFA 1ZZMA 5AVNA 1RP8A 4QLLA 4G2DA 4AB4A 1ITXA 4NSBA 2XH2A 2FB2A 4LH8A 5BOOA 4Y90A 3TZNA 3QPZA 1C9DA 2EEXA 3UPBA 4PMOA 2BXYA 1FY6A 2FHCA 4EPBC 3B8TA 4WJEA 2ANUA 2VEMA 3GWQA 1IF2A 1C8YA 1N8IA 1TPB1 1Q8AA 1XSIA 4EKJA 3QW4B 3LEPA 3N14A 4CUCA 1QNPA 3AMKA 4ZSUA 3W7GA 4M24A 1EP1A 1H3GA 3LENA 3LV5A 1BTMA 3K5XA 4YN5A 1XIMA 3FVDA 1H63A 4Y9OA 2NQ9A 4WGXA 2CLOA 2QPSA 3LTPA 4DQWA 3W7KA 4R88A 2X42A 4L1WA 3PZQA 1FHDA 2Y7DA 1H0GA 1NM9A 4LOCA 3RPMA 1JVNA 3NSNA 4IGNA 1UZDA 1F5ZA 4J3VA 1XLLA 4N9EA 1V3KA 1JZ5A 3GSMA 2VVSA 1BWVA 4IJCA 5LZLA 4H6KA 2DZTA 4ZR8A 3BQ6A 4W7VA 1LLWA 3QW3A 1W31A 1PX8A 2QCHA 5FEPA 4KCVA 3HPZA 4QISA 3W2JA 4MNLA 1VKFA 3QHMA 1GTEA 3KE0A 2WLYA 1M04A 2VEPA 4KESA 4MJZA 4LALA 3M7SA 1OFAA 5DY3A 5JIPA 3WNNA 1TWDA 3W70A 1AMKA 1TPUA 1PJ9A 1PIIA 2DSVA 3W6LA 2W62A 4O18A 1EQPA 5FIPA 3FN9A 5IHSA 5HWMA 1SJCA 1TCDA 3SCTA 2ACSA 3K46A 5C2CA 4LV9A 1V7AA 4BQ3A 4ZE5A 4UWMA 2DIKA 4L61A 1PCWA 1PZ1A 3HU7A 4HK6A 5DT7A 1HW6A 4QJ5B 3VE9A 3I3BA 3SUTA 4H9VA 4YMZA 1ZLPA 4KFNA 2EHHA 2DEPA 1GOOA 1O7AA 2OTDA 3G24A 3F4CA 1V4YA 3R12A 4GX9A 1R47A 4NRSA 3TTQA 2IPGA 3W73A 4EF9A 2J24A 4JTDA 2HROA 1XFBA 2JGQA 1TMLA 1JGMA 4LAOA 1ZCCA 1VHNA 2GDQA 2WANA 3BGGA 1F74A 5F4SA 2BGNE 4Z08A 3H2EA 1B30A 4JIPA 3W88A 2R82A 4GEPA 1P48A 1J5TA 4UOQA 5D9PA 2Z28A 4F2TA 2W5FA 1B57A 1OC6A 5DXYA 1J18A 5EFFA 3NPWA 2P50A 2HK1A 3R10A 2ZRUA 2R8WA 3MW7A 1Q2RA 4Q8UA 2R1PA 3QSRA 2XU2A 1KC7A 3F03K 4LYRA 3NQ2A 3VD3A 1VZWA 1DE6A 3VM7A 3EGJA 2PDGA 1LRQA 3OODA 4JTUA 3FJNA 4CQ9A 2XIJA 2PDHA 4L4OA 2NV9A 1WBJA 3WQWA 1D7FA 2J77A 4CLMA 3LY0A 2FPVA 2HWGA 4YS1A 4F8XA 3ERPA 3GBEA 3SGZA 2XHYA 5REQB 5I06A 4LNCA 1LWHA 4O52A 1Z6KA 2DT3A 8GEPA 4UTTC 4CNUA 4FX8A 1XIEA 1NWSA 3K13A 4XQ6A 3MO4A 5CC6A 4J4KA 3E5PA 4PTNA 4YVXA 3SN4A 5E6YA 1IQ8A 2HXTA 3OG2A 4F0RA 1IGSA 1UWIA 3BLLA 4XD6A 3ME3A 1T40A 1SZNA 5LGXA 3ANYA 4MSSA 1QASA 4MB4A 3WH5A 4QDPA 1BYCA 1EH9A 3M4HA 3MB9A 2E5CA 4PMUA 2DPEA 4MB3A 3ARRA 1XG3A 1NF7A 1LLOA 4MWAA 3V1HA 1U33A 4D72A 4IGHA 5C9WA 5LIUX 1RUSA 4XISA 2J8FA 3SCWA 3DIPA 4BI6A 4DO7A 4D6FA 4IM4A 1W5PA 2HDJA 3IJ7A 2WM0A 1YRRA 1XSKA 3TVAA 1JDAA 2VI0A 3O7UA 1DWFM 4QNWA 1KNWA 1OHLA 4FR6A 2P3EA 3A4XA 1UKQA 3VNLA 4FEZA 3BLPX 3GVRA 3TP4A 3GUWA 4QR6A 4C6BA 2DZBA 1W1B1 5BMXA 5D32A 4REQB 1RA5A 5CGTA 3GHSA 1XQKA 2A7NA 1DWJM 3WD0A 4QITA 4WX2A 1RJRA 1HGWA 1GOMA 3VOFA 3NIYA 3GDTA 1KM3A 2AL2B 3UG3A 4XO7A 3E6EA 4GBDA 1XIBA 2DIEA 2GGJA 4Q22A 4ZO6A 2X1SA 4A3UA 4WSJA 2A21A 2PGFA 5CPLA 5CBIA 4J3SA 2RHGA 5H91A 1UZHA 3TK7A 3XIMA 4UZUA 4NJHA 3P93A 4HBKA 1L6GA 7PTDA 4FF7A 4G56A 1VC4A 2GDVA 1DV7A 2Y8KA 3STGA 4A21A 2QGHA 2CITA 4M7TA 3I6TA 3ZZ1A 3U3HA 5C54A 3NNTA 3C2YA 3CGTA 3ARSA 3BCFA 3CQKA 1ONWA 3BCDA 3MM8A 3U4FA 3MUY1 3ZT6A 4GYKA 1AA1B 3T0AA 4DJFA 3EDKA 4AHPA 4IL2A 3W25A 1FCQA 3C8NA 3CO8A 3NPVA 1PV8A 2YX0A 1V03A 4HYRA 4DXKA 4HJFA 3ZM8A 1ONRA 4WLCA 1E51A 1PS9A 3ARTA 4NZ5A 3RN6A 1JZ3A 4Q8WA 4V1YA 3WLOA 2O9RA 2OT1A 1DKWA 5BWAA 2CLPA 2ZRWA 4AISA 2UV8G 2EKCA 1ZAIA 4BY3A 2DVXA 4GC4A 4H00A 4NX0A 4M0XA 2J4GA 1MWOA 4QP0A 3GUGA 4TU1A 1I0BA 3PJUA 4ZZ9A 3W2MA 1E6PA 1LF1A 2VELA 2OT0A 4JTGA 4MFDA 3PG9A 1LM1A 2PDBA 4XKYA 1DQUA 1XIIA 2WHLA 1PYMA 2D2JA 3MDWA 1TB3A 3OIHA 1T8XA 1DVJA 1HT6A 4JS3A 4JTIA 5L6UA 5E6ZA 3P74A 2OGYA 1EJTC 1B3WA 1PZ0A 3NQEA 3ARUA 2P76A 3C3NA 1UPPA 4F79A 3K2GA 1IXOA 5EB8A 2Z6IA 3AXMA 1VF8A 5D9OA 5TBOA 1G4PA 4PULA 3S9IA 3FDGA 4C6CA 1L2UA 4S3JA 1YNYA 3ZQ9A 4F3HA 4JZ5A 2PU1A 4JNMA 3GYCA 4AYSA 3UR8A 3KVMA 4DYEA 2OKOA 5A6KA 2X1IA 1PBGA 2ZZ7A 3CB8A 1F6PA 4B5TA 3MM9B 2J79A 2REQB 5GJPA 3KP1A 1BYDA 4J28A 2QDDA 4N7QA 1ALDA 1CLVA 1QOXA 3AIQA 3QOMA 3BMWA 3W83A 3WBAA 1BXBA 1H7WA 1QO2A 1LZOA 3QPEA 4C6EA 4DO4A 1TUXA 1UC4A 4CD5A 2FTWA 3DG7A 3IIOA 2VD9A 1ZBKA 3WDQA 4XVEA 4JPGA 1YXCA 3E0LA 4ZOBA 3B3DA 3UXKA 1I60A 1UZ4A 1WUEA 1YYAA 2RJGA 3N4AA 2PDXA 2J88A 3BSMA 1PZ2A 4W88A 2D24A 2NSOA 3WF1A 3PP7A 3MMCB 4WVXA 1PTDA 4MF4A 4OQVA 1B5TA 2YB1A 3H8AA 3QYSA 1UW9A 4Z1BA 4I7UA 4DO6A 1Z89A 3N4FA 3GXNA 3ITVA 1RBLA 2X2GA 4XUYA 2PTWA 3E2RA 3TU9A 1QRQA 3M0JA 3BQ5A 1ML1A 4H7ZA 4Q33A 2QPUA 3TV8A 3ZLFA 2VDHA 4MWAD 3LUTA 4MKSA 3T2OA 3TE9A 3L12A 4DJFD 4LYPA 1JGIA 4DJDD 1QI0A 1AW1A 1DIOA 1VFFA 4WKHA 1R3SA 4O1EA 4RE3A 1EXBA 3GRIA 2CHNA 3O2LA 2V5DA 4MLRA 2NSXA 1GWJA 4OBTA 2LLEA 3AMGA 1BQCA 2PB1A 2HEJA 1A49A 2V8ZA 2ZWZA 1AODA 4Q6XA 3T81A 1L8PA 1SFTA 5IM51 2EO7A 3OQ8A 3IJQA 1YE6A 4F48A 1V8EA 3VABA 2VRJA 1J79A 4XO6A 2BMBA 3IAQA 1UASA 3KL5A 3URAA 2PWDA 4WR3A 5FEXA 5LIXX 3S6DA 4DM1A 4UZSA 4PTVA 3CHVA 5HXMA 3QRHA 3TXVA 1G4TA 1UC5A 5M2FX 1TFVA 3W1XA 4IP4A 1TO3A 1IV8A 2VO5A 4QDWA 3TN5A 3N12A 3T08A 4WY0B 1HO1A 4MZ1A 5LA1A 4US5D 1HGYA 1TV4A 1G7VA 1FWNA 2P53A 2IS7A 5A3HA 4R9OA 4JDYA 2V30A 3W2NA 4S3KA 2A6LA 2BBFA 3NURA 4PCNA 1GZGA 3TW7A 2XGIA 3VOHA 3WZ0E 3MHGA 3SURA 1VBGA 2Y4SA 4GBUA 3L4XA 5T26A 4NILA 2A3HA 1ZUAX 4HPXA 5CBBA 3QPYA 3N1AA 1HP5A 2HK0A 3NQBA 5A8NA 3B03A 1XV8A 3URBA 3B0MA 4WOQA 3UXIA 3CT2A 1W9PA 3I6RA 3JW7A 4YCOA 2QF7A 4K6AA 2J62A 3FV9A 1TG7A 4E8GA 4GJIA 4KH2A 5HDRA 4FNUA 3OVRA 5I7GA 1M7PA 1XUUA 2RKXA 1PDYA 3KW3A 3R0UA 4EE9A 5AVHA 2KZHA 4Z42C 1NH6A 4KEZA 1BTCA 5KTLA 3OVGA 2X16A 3OOQA 1W1TA 2ZC1A 1XLJA 3HFYA 4LUJA 1VYRA 5FF3A 1EHNA 1JULA 4RNFA 3GKAA 3KBNA 2VENA 3SI9A 3BGJA 1I2NA 3N73A 3MPGA 2E25A 3CASA 2FVKA 3AYSA 4IGMA 4A8LA 4Z17A 4TV6A 2VX4A 4I3GA 1ISXA 3KBVA 1U1HA 1ONEA 1UCWA 2HPIA 2UY3A 1VBRA 3RR1A 3QFEA 4PR4A 1QI5A 4PYSA 5DELA 3WD4A 1AG1O 1EGMA 1E1CB 5LNVA 3FYYA 1A5LC 5C55A 2DORA 3B9AA 3G77A 1F73A 1XUZA 4IT1A 4O0KA 1SSDA 1CXEA 2R91A 3N17A 2PAJA 1O60A 4M56A 3VUPA 2OX4A 1HKWA 2XN2A 3G6MA 4GVFA 1LBFA 3H55A 3B0HA 5J04A 1UROA 4H9UA 3WF4A 2YDQA 1PL9A 1P0KA 3PUGA 3L65A 1UP3A 1SFJA 4FMVA 3DFQA 3WH7A 4QIUA 1W8GA 3W1TA 4HD5A 1NDYA 1M53A 3OZMA 2XSXA 1KB3A 2PDFA 3MVIA 1P1MA 1XS2A 2YA1A 1KM4A 4J3WA 3S5SA 3WQPA 2FZDA 3CM4A 5LA2A 3OYXA 2YL5A 4JTQA 1R9YA 4NYUA 3ZFHA 5LNWA 3UWUA 1PHQA 4AD5A 3L66A 3HMJG 4OU1A 4AMAA 4ML4A 2EKGA 1HFBA 4DLMA 4NF7A 1Q8JA 3ONBA 4GQGA 5HR6A 3QV6A 4AWTA 1P6BA 3QV9A 2QUVA 3KWXA 3P3BA 1ZAHA 2J47A 1LOQA 3UA4A 1JUEA 3VFLA 1TMQA 1ZJ9A 1P4CA 1HZYA 3MWCA 2PLMA 4WDWA 4Y8FA 3PTQA 2XZ7A 4XZWA 4F9JA 4YTUA 1EC7A 3L2MA 5I3KA 1LWJA 3EBVA 2QUTA 2FMOA 2PE4A 4H9XA 5K3VA 1KXTA 3WJWA 3PG8A 2WMHA 3WUFA 5LSMA 1DIDA 3MKCA 4L4LA 3A4JA 3FA5A 1KFBA 4KT2A 3FNDA 1TUFA 1LT8A 5GNYA 4OVXA 3KOYA 3MI3A 5ENLA 4DI8A 4RNHA 4DWSA 1AH3A 2NT0A 4A3HA 3UCQA 3E9AA 5BXSA 3K4WA 3O0KA 3TMQA 4UTHA 1W5QA 1W9BM 3NCOA 3GXPA 3TLLA 4FXRA 3CUZA 4NQ1A 2PDUA 1OGGA 3ID7A 4IPJA 3P14A 6TIMA 5HK4A 4W5UA 2CHOA 4FZIA 5AHMA 4CQAA 4XBJA 4Q8OA 2WAGA 1W9UA 2VR4A 1WDQA 4D6GA 2GOUA 1LCOA 3TJ4A 3NWRA 1B3XA 1E3ZA 3NQ7A 2C1HA 5KZMA 3UWQA 3B9DA 3R94A 3AMLA 3BLOA 4DBWA 3KS6A 3AC0A 4AC1X 1QWGA 3RPTA 3T42A 1JAKA 4R34A 2J7GA 1GVQA 1RPKA 1P0DA 2QJJA 1JYXA 5BW6A 4C1LA 3SRHA 3NUKA 3WNPA 3EWZA 4UQ9A 5CG0A 4D8LA 1F4AA 2ZZ6A 4W8LA 1I2PA 2PDJA 5CSUA 1QBBA 3GVGA 4DZIA 1J2WA 4FOJA 1B31A 3GDRA 2Y5EA 1UMLA 4KEMA 5D8ZA 3AS0A 2A85A 3VKRA 3ZVHA 4UBPC 3DFSA 3GB6A 3FVMA 4S23A 4ZEPA 5GNZA 2PDKA 3RDKA 1XX1A 2Q71A 2V4JA 2BXVA 2VUNA 1QAPA 1VFHA 4XZ9A 4RDYA 1GZJA 2G95A 2IQ0A 5CH9A 3AZRA 4TX6A 4E4FA 1UR8A 1XGDA 2WB5A 3CS2A 1EWDA 1X7FA 3GR4A 2O9OA 2VZTA 4E6MA 1F3EA 1KBIA 1XLFA 1MRQA 3KRSA 1SO4A 2ODOA 4QXIA 2OJPA 4LV4A 3TWBA 3EA2A 3CTTA 1FTXA 1MUCA 2XSBA 2H9AA 3DYPA 1NVMA 2Z24A 1FDYA 1IWBA 4PRTA 4YNGA 1FWAC 3L0KA 3OIXA 4B90A 3NQ6A 1QK0A 3OR1B 5A8OA 2G50A 1CXLA 2Y2WA 1SYTA 5JXQA 4G7FA 1SUXA 4XWUA 2V82A 1FWSA 4CD7A 4P7LA 2Y8VA 5D4YA 3RGTA 3UVAA 4E3VA 2OWXA 1LRTA 3B0YA 3LXCA 1P43A 4OE7A 3MP4A 3EXSA 1UYQA 1UQYA 1R30A 1OQFA 2DH3A 3IV8A 5E0KA 1KXVA 2RAGA 1HUVA 3PPCA 3CZKA 3VD5A 1XBYA 4A8RA 1WPCA 1C9WA 4JIRA 1IEWA 4URIA 3UW6A 5LXEA 1FCVA 3IRSA 1A5BA 1P0BA 1FQ0A 1UJQA 2OLHA 1BPLB 4R7WA 3UGVA 3TYBA 5LXXA 3I7SA 1AQ0A 1C8QA 3BE7A 4W9TA 1OZQA 4HTBA 6A3HA 1H11A 1L9WA 4K8GA 1V6UA 4M6PA 5HUPA 1K8CA 5DX7A 2HXUA 2FJKA 5FOOA 2WZIA 4GNVA 1GVIA 5CZ0A 4Q8PA 1DXFA 1MQPA 2ISVA 3RFAA 3VDAA 4P8UA 4HPGA 1TE6A 3W02A 1L8NA 4MG4A 4Q8QA 3DGRA 5AOUA 1E6ZA 1S39A 4QAIA 1UB3A 4ACZB 4ZQMA 1YTEA 1UHVA 1G0CA 4BEQA 2VX6A 4GUJA 2HS8A 4U5IA 1CXFA 5M5DA 3W86A 4RPPA 7A3HA 1B1YA 2WHJA 4LC8A 2ZZ3A 5IRPA 3K8MA 3MHUA 1XW8A 4AX6A 3EKGA 2C0HA 3PK7A 4QSFA 2G0WA 5HANA 1E0XA 2J6VA 4J1OA 4J7RA 3GX9A 4LGXA 4RE4A 4YL2A 2PDWA 3N3TA 4PUDA 1F6YA 4UUIA 3KOFA 5FEZA 1E71M 2ZTKA 3VNZA 4TV5A 4LWWA 1TCMA 1SZEA 1UKTA 2AKMA 2GVEA 1PX3A 3LXAA 2NXHA 3AJ7A 2JE8A 3AQUA 4D6CA 1XIDA 4GX8A 3VKJA 2DSZA 2WVVA 4F4RA 1RP9A 4Q4PA 4UTIA 3M0MA 4UB9A 5IBXC 3WK3A 1DTNA 2WMIA 3W2UA 4N0RA 1KWKA 4D2JA 1CDGA 5FD0A 1FOBA 3MSYA 3T0BA 2VEKA 2TMDA 3BAKA 1CGUA 4ES4A 2VWSA 3TAKA 1GHRA 5C9RA 5KITA 2L5HA 3IJIA 1J93A 1GEHA 2WLZA 3RG6A 1WX0A 4B9YA 1RSCA 3ZT5A 4MHBA 2CZ5A 4UTLA 3QQ1A 2YYTA 4QFUA 4OJYA 3W24A 3JZEA 3ZWTA 3WFLA 4N4PA 3H2CA 4PBFA 3UU0A 1W3NA 3ZT7A 2D0FA 3S46A 4NVTA 4UTWA 4NZ4A 2V3FA 2DUXA 1OT2A 3MI6A 2Q09A 4Q4MA 3ORWA 4L9ZA 2QEZA 2C79A 1G9HA 3O0FA 3GTXA 3W6YA 4MY9A 4X0VA 4TX8A 1EBHA 3EX6A 3DOPA 4TVUA 2TRSA 1A0DA 4DX3A 3DU0A 2MUCA 4W7WA 4J3ZA 2J8GA 5U4NA 3AHYA 1CTNA 2FDSA 5I3JA 1DJNA 3SEPA 5CEWA 3TFCA 2INFA 4FNPA 5HAOA 4ZOAA 2PP0A 2V2HA 3O15A 3LRKA 3ZOAA 3CAWA 1VPQA 4DWSD 1JDCA 2B7NA 3VOGA 3M0VA 2F38A 5HMDA 3DKJA 3PY2A 4OUEA 2XN1A 4HJWA 1UR1A 3VCCA 2DY3A 5FEWA 3WK2A 3GTHA 1R2RA 2WQDA 2VZVA 3BC9A 4WGHA 5C8BB 4UTUA 1KXQA 3C52A 3CZLA 4L7ZA 1W3JA 1GORA 3B97A 1IT7A 3ES8A 4MM1A 4LCSA 1TZ9A 1VQTA 1E55A 4BQ5A 4ACYA 1GYMA 4DF0A 5E70A 3MZ2A 5DBTA 1UP2A 1POJA 4LVAA 4IMFA 5FJUA 1Q13A 2PBOA 4NKCA 2R14A 4JIIX 1V3IA 1J0YA 4JTSA 4HHHA 4JL1A 1GQJA 3XINA 4JEJA 1QOQA 1KXHA 1OM0A 3P67A 2V4JB 2XGZA 3NSXA 1XR2A 5CBJA 3MDUA 2QCEA 1JR1A 1Z9AA 3AU6A 4B91A 2OG9A 2ISSA 1W1A1 2HJPA 3M0HA 1OIFA 4O16A 4AFYA 4JTAA 3WD1A 1XGZA 3RIKA 2C19A 4NHVA 3TLQA 4D1IA 3CMJA 2DZAA 4PA8A 4ZXLA 1F8MA 2CZDA 3ABSA 1XISA 2Z27A 3IJ9A 3MUXA 4MB1A 3KVKA 1F3TA 1OFBA 1V0KA 3MT1A 1E3XA 3HV9A 3F1QA 3WJSA 1F76A 3OG3A 4XBKA 3BLEA 3UEQA 5CZTA 1V5XA 2NLYA 4NJGA 3OLDA 1UH4A 2BXZA 3VNMA 3CWNA 2GWGA 4M8UA 3V0SA 1GOIA 4ZB0A 2DZWA 1N2VA 1VJZA 2WZHA 3MMCA 3VUSA 4CN6A 5DRIA 1XL9A 1ZNNA 4A3RA 3CIVA 3R0KA 1UD3A 3HURA 1BYAA 4Q7BA 5H8PA 2ZQ0A 3IJ8A 3QV7A 3G1SA 4XX6A 4B5UA 2WNZA 4DUWA 1NQKA 1UUMA 2GUBA 1XLHA 2VL4A 1DYSA 1JCTA 1W37A 2QDEA 3IUIA 5EY5A 1XH1A 1RD5A 1I6NA 3IGXA 2JBMA 3LHZA 1CIUA 2PF0A 3R4IA 4MB5A 2H9AB 5EMUA 1W6TA 1CGXA 3SB0A 2OQHA 2REQA 5EYWA 2QCMA 2VNCA 2WSKA 2Y89A 4H8UA 3AIWA 7XIMA 2BGSA 5DEZA 3O6DA 1WYIA 3W38A 4GOAA 3T0DA 4A3YA 2O92A 4ZMGA 2D2OA 1MNZA 4U4MA 3KM8A 4RW3A 2NVAA 3VMPA 5AB3A 3EPOA 4BWLA 5HJYA 1BSLA 3PZTA 1UJPA 4CKQA 1EOMA 4RDVA 1BKHA 5HA7A 4HGXA 2WMIB 1R6WA 3BSGA 3W7RA 4CQBA 1QMLA 1JZ4A 3N2OA 4Z2LA 1W3IA 3MJYA 1UA7A 4JICA 5DMYA 1CI1A 1UKPA 4RXFA 1EC9A 3PJTA 3EB4A 4AWUA 3C0JA 2B7PA 1QW9A 4ADTA 1V3LA 3REQB 3SY5A 3EXRA 3WLLA 3SBFA 3ZLGA 4DN1A 1J0ZA 4E0CA 3VD9A 3VIJA 2QIIA 4QG9A 1E0WA 2WNWA 4BJHA 2V5JA 1SJAA 1TWWA 3ZSSA 1D9EA 3C0LA 1V08A 4GJ1A 4K8HA 4WIWA 3PUOA 4DBSA 1JF6A 2YPIA 1TREA 5AZ0A 3BAJA 4JCLA 3U7VA 1K4GA 3APTA 1UBSA 2YKKA 3GDKA 3WNMA 3W37A 1LUCB 3HFTA 3I65A 3HA1A 5AC7A 1I2RA 4IISA 3GG7A 1A53A 1GTHA 2A2IA 3I3EA 2NW0A 1GEQA 4XB3A 1RD6A 4GC3A 3IJLA 3QQ0A 2ZXAA 2VEFA 5AYIA 3LLDA 2CBJA 4PODA 1F7BA 3LHTA 1J5SA 1W32A 3ONCA 3ABOA 3OB8A 3MV01 7ODCA 2ACRA 2IPWA 2F8QA 1E0UA 1FVPA 1IXNA 1BD0A 2CESA 3CL7A 2NUWA 1LDCA 1PSCA 3APGA 1DWIM 1FUYA 4R33A 2A7RA 2E5BA 1LOLA 2O9PA 2BFGA 4MUPA 3BOFA 1MFVA 3URQA 1EB3A 5ABEA 1JUBA 3VIKA 3NQVA 1R0MA 1RPXA 3MMTA 4G7EB 2TSYA 3QEZA 3ZVHB 1KCXA 1JQXA 4Q32A 5CZKA 3VX1A 4C65A 2PU0A 3TROA 4M6QA 1FP9A 5C9ZA 3G1AA 4ZFMA 3GU9A 4IIEA 3NAVA 5D9MA 4DAFA 3P8JA 2YGYA 1NARA 2F2KA 4Y9MA 1CZ1A 3W7QA 4JYDA 3BMVA 3P80A 1XPYA 3FAWA 2NUXA 3MKKA 1YBQB 4WRHA 4QS5A 2HRWA 5HOSA 5D03A 1OWQA 4NIRA 3H2MA 4NI8A 1IHIA 4NG3A 1BRLA 2A6NA 3BH4A 2CZFA 1KQYA 3ICJA 1ZJ8A 2DZUA 5G1MA 3YPIA 2VGGA 3EEZA 3GXMA 3U4AA 1QI3A 4C1NB 3SGUA 1C92A 1GPFA 3ARXA 3RR4A 3GK0A 5CZSA 5CLWA 1EC8A 1SW0A 1Y7VA 5HUOA 1DJGA 2OOFA 1R5YA 4B2DD 2KX9A 2X09A 1A3HA 4HT3A 4AZIA 1DTUA 4DXXA 5CPTA 4A2RA 4CQDA 3KOXA 4B5VA 1QFEA 2ZOXA 4N9DA 3VO0A 4EWND 3WLNA 3BW3A 3ECQA 1RA0A 4DJDC 5T8GA 4RNIA 1D3CA 4GUHA 3G1FA 2B0MA 2VGFA 3P61A 2AKJA 4JYFA 3H24A 5FI8A 3PSVA 1MNSA 3PR2A 2ONEA 1PO9A 3UR2A 3R0DA 4ZOEA 5DCEA 2CBIA 2Q3OA 6ENLA 1XDLA 1V0NA 1KFLA 1E72M 3RMEA 2Z2BA 4YVVA 4UNKA 4GZEA 4EX4A 1W3KA 2YXOA 4V1XA 3KRUA 4L64A 3MV11 4ATWA 1PPIA 3VOIA 3UVIA 4UCFA 1PXGA 1TZZA 2PDIA 7GEPA 4JTRA 1I2QA 2BWGA 1J0KA 3BSHA 4JY9A 1KWGA 3V5CA 3RNDA 3PZOA 2J75A 1A4LA 4D6HA 3UCDA 4C5YA 4QJ1A 3RX2A 5M1TA 4ZO8A 2QCGA 3MY9A 4IFRA 5A8GA 3H2AA 1BF6A 2XTKA 1UR9A 1KRBC 5F2GA 1M41A 3TC6A 2WKGA 1X1ZA 3ARQA 5D09A 4PMZA 2NZLA 1WE5A 5LIWX 1AZ2A 3DXIA 4FALA 1IEXA 1XLEA 1KGUA 1SM9A 4WKFA 2FVMA 2ACUA 4DUOA 1ICQA 2OSXA 3RRXA 1H4PA 1K8ZA 4JTCA 5C71A 4H8HA 3MMDA 1KRMA 1JYWA 4LF2A 4HZ7A 4NUWA 1UMYA 5A8PA 4HQVA 3W07A 5IOBA 2Y70A 1E4MM 3O3RA 3GIPA 3O6YX 4K2SA 3QC0A 3ZXWA 3S2CA 3OBEA 3RLUA 1T96A 4U31A 3HBLA 3T44A 3IK4A 3V0UA 3GLCA 3KDOA 4FNQA 4HMCA 3LTYA 3GDLA 2HBVA 3GYEA 5CSYA 1IR2A 3SUWA 4GCXA 2XIMA 2GZXA 1XH2A 4H6QA 1JYNA 3OA5A 3PTMA 5KZDA 2NWSA 1US3A 1S2WA 4ZVJA 3UR5A 5C9UA 3BPWA 3TUUA 1B3ZA 4LYKA 1P7TB 5EMLA 4L6HA 5B7ZA 4GRSA 4O4VA 1VENA 2OU4A 1P1XA 4AVNA 2E40A 1NDZA 2EF9A 3AHTA 3QY6A 4F9DA 1PTGA 3H26A 3CQJA 3Q67A 3T4CA 4Y9AA 1B4KA 1SPQA 2ZTJA 1M68A 2DW7A 2D3LA 3SCRA 2C7FA 1BSIA 2QGYA 3LS9A 3EAUA 4GY1A 4DWSC 3CEUA 3WQEA 2VFDA 1KM5A 3RITA 1TPFA 1FWEC 3TTYA 2INEA 1NIUA 5DCBA 5K9DA 2ZVRA 3UXLA 1O5RA 4PRRA 1DOSA 5LHEA 1G69A 3O63A 2B31A 3F4DA 1JI1A 1TMHA 3KXQA 3BOXA 5TNVA 1MZHA 4P2VA 2ZYFA 4TMCA 1EX1A 2OR2A 1BAGA 1JDDA 4KFPA 3T7VA 3BV4A 2QCLA 4HU3A 1OSEA 1CLXA 3EYPA 4HU0A 1Y5WA 5KINA 4JFSA 2VT0A 1S5MA 4O4WA 3PZUA 5EMMA 3XISA 2ZRXA 3SUUA 1E1CA 3DGBA 3E12A 3R6IA 1HL8A 5IDIA 2WSYA 5E09A 3F4WA 4AVFA 4YLWA 2QCNA 2POZA 1FKXA 1ONXA 3HV8A 3GW3A 4LB3A 1GHSA 3VZXA 3M0YA 4DJEA 4HPNA 5HPOA 3W00A 5I5RA 3QFWA 3W28A 1VRXA 3AIEA 3M6YA 1GOWA 1UR0A 1CT5A 3F5JA 5TF0A 4WK9A 3T2PA 3USBA 4PZVA 3WDPP 3LM7A 2JKPA 2WBKA 3LPOA 4TMBA 3VA8A 3PPGA 2D3NA 4GE8A 1YQ2A 2BNJA 2F84A 1YDNA 4AU0A 4BCEA 4B2DA 4ZTXA 2GUYA 1FWRA 3UNDA 3VNDA 1O4UA 3F5LA 3N11A 2BVDA 4ZO9A 3CYVA 3ZO9A 4OBSA 4KF1A 4WDUA 3UZYA 1C7SA 2PSNA 2Z7GA 2RUSA 1NAL1 1XIFA 3UY8A 4F2UA 1XBXA 1CLKA 4C6QA 2J13A 1LWIA 1YPFA 4FLSA 3VGHA 4LCRA 3VNYA 3B9EA 4YIWA 1YBQA 3NDZA 3D47A 1ADOA 3BK0A 1TV5A 1MW1A 3T1GA 4ICNA 1J0HA 1K7XA 2FIQA 4YWIA 4LBUA 5F4XA 3KWSA 1JUKA 4C6FA 4KRZA 1ISYA 4WSKA 2B4GA 1JNEA 2XDFA 3PWGA 4JTHA 4CEXC 3W76A 7REQB 3H4GA 4XSMA 4NNAA 1EDTA 3MUZ1 3WQ6A 2NLIA 2GQ3A 3CUIA 2J7DA 1KBJA 2QAFA 1N55A 5CJMA 1UWQA 3GEOA 4XD4A 3W1MA 3PNZA 4G1NA 2VCBA 1XFCA 3DI1A 4HZ6A 4O28A 2BZNA 2DJXA 4HU8A 1FRBA 4BWLC 1GONA 4X3ZA 2FH6A 1OG6A 3WEMA 3QZEA 4LT9A 3UY7A 2DQXA 3AI0A 2VX7A 4O1BA 3TYDA 3WBEA 1W0MA 3L0GA 3R7MA 5BWFA 4J9JA 3VKPA 1XPGA 1XCWA 5DF0A 3Q45A 4DZHA 3O07A 3LGGA 2W63A 3KFTA 4Z1YA 1J01A 3MMUA 2A79A 1H7XA 4IFKB 4AEOA 1TWSA 2QLYA 1H61A 1MQQA 4IP7A 4Z2HA 4A29A 4KETA 2VOMA 1OG0A 3G5EA 2R6OA 1UOZA 3RM9A 1JPDX 1UWRA 3B0UX 3LHWA 1V6WA 2WZEA 3HF3A 4BKNA 3MVTA 2X7VA 2DT2A 1IIHA 1DP0A 3SADA 4LBRA 1UKSA 2BLEA 3EA3A 1QPKA 4G1KA 1CNVA 3ES7A 4PUMA 1CXKA 2JEPA 5HBFA 3ALGA 3WNLA 4LY4A 1GJUA 4R5EA 3PBVA 2PRHA 4UOJA 3NR0A 4DUXA 1RY0A 4BF7A 1UUQA 3OTRA 4PC8A 2GL5A 4WDXA 5D05A 4HSHA 1IZKA 1TSIA 2QVHA 1E6RA 1GQNA 1R46A 1M5WA 4UTFA 2CETA 3W26A 1XIHA 2FPYA 5M3WA 4XZIA 1OYBA 4LAZA 2HNHA 3VU2A 5MKGA 1CGVA 3LD5A 3A9IA 3D0CA 3DG3A 3DN5A 1XYBA 4G7EA 1P5BA 3FYOA 3H70A 3CHEA 5I23A 2Y63A 1BWLA 2IPJA 1BKSA 2D73A 2IKIA 2OEKA 1J8VA 1CECA 1UKOA 2QKFA 3DESA 1XQLA 3USZA 2ZA3A 3NA8A 4DJFC 4LX4A 1NOFA 4YPJA 2Z29A 1I1WA 2DZVA 2POTA 4FOUA 4HMEA 4ICCX 4NT0A 3NM3A 1TTQA 3ZJ7A 1G7UA 4BR1A 2FFIA 3H2FA 1K4HA 2C8NA 4FNTA 1TIWA 1YDVA 2I16A 3LCFA 2BOFX 1EBGA 3R2GA 4JQ2A 4XTIA 3LBMA 8TIMA 3L23A 3NGJA 2QAPA 3AXIA 1RLDA 1DJWA 3WG6A 3V5FA 3CNYA 4DEFA 1FFQA 3NQMA 4J35A 1CGWA 3I3DA 3MM7B 2O56A 3WF3A 2C15A 2WO5A 1S2TA 1EEPA 3D5HA 2PUZA 3RX3A 3QLDA 3M0ZA 3UWZA 1GOXA 4PFHA 1WKEA 3FW6A 3AWOA 4OKDA 1A5OC 1QNOA 1F8IA 4RZ6A 2ZE3A 3M5VA 3BW4A 1EP3A 4LAUA 1AJZA 3LBOA 3LRMA 3IVSA 1EJRC 2ZADA 1W1YA 3S5ZA 4A8NA 4HPJA 4E5TA 3VLZA 4LVFA 2VR2A 4HSOA 4I9MA 5DMLA 4UR8A 1HKMA 3P5ZA 2BHYA 1CW2A 3VKKA 3WLTA 3RM4A 3CIXA 4JNZA 2QUUA 4FF5A 4GGHA 3TSMA 3CLMA 1RVKA 2QUNA 2I1OA 2FGZA 4DYJA 1NDWA 2E9BA 1R8LA 2J8TA 3WBXA 6XIAA 1E1EA 8XIMA 3FIGA 4ZGYA 2CEQA 1J6OA 3RCNA 4DNMA 2GJXB 3F7JA 3W9ZA 1EA9C 1JPHA 2GQ8A 3OVPA 1E9YB 2YLAA 4AD3A 5HMEA 3AYTA 3NJ3A 5LGZA 1QDSA 3RRAA 3P2VA 3W7JA 5RUBA 1HKKA 2PDCA 1KM0A 4E4UA 3DFOA 4DPQA 4J3UA 1AK5A 1EYEA 1MI3A 3MP3A 1RVGA 4O12A 4MYAA 3CUGA 4M6UA 3RLGA 1US0A 4L1GA 4AIBA 1WKDA 3BWWA 4KPLA 1QHPA 4PGLA 3SSJA 1ADSA 2IPFA 4J2PA 3VKSA 5DXXA 2IXVA 1W3HA 2AL2A 5HQMA 4JX4A 4E2DA 5HINA 2QJNA 2NX9A 4GQ0A 3V75A 2OEMA 3TOYA 3W7OA 2D0GA 4M3PA 1L6SA 5AHEA 1DJHA 4O10A 2XVNA 1JCYA 3NQCA 3DUGA 1IYXA 4CNSA 1WKFA 4WQ6A 1HKVA 3FY1A 3WK0A 2OPJA 1KR0A 9XIAA 5EPDA 1HVQA 2QT3A 4Q7NA 1W5MA 2G3FA 4O0ZA 1R7AA 3HB9A 1XM3A 2OKTA 3ANVA 3VLYA 1XH0A 1LORA 1QXLA 3E0WA 3UPMA 1KFCA 4KBXA 3I68A 3L9CA 4S1FA 5CPMA 3BJFA 2W9MA 3H2NA 3V3WA 1RALA 1VFMA 3R25A 1K70A 4FIRA 1HP4A 3WSUA 3CQIA 2Q8XA 2XSJA 4JNYA 5CGMA 1C90A 2F61A 4N9BA 2V5CA 3MCOA 3W7PA 1G5AA 2J7CA 1R3YA 4LRTA 4AZCB 3BJTA 1FH9A 2YBUA 3TA9A 4FXJA 4OECA 3AXHA 4JIQA 3WLHA 3WL1A 4OHQA 2CBVA 1DJYA 1EXPA 1TJPA 1X6LA 1V3MA 2CZEA 1E70M 1SMAA 1S38A 3OR2A 3V35A 2OVLA 3SCVA 2PRLA 3H53A 2WMFA 1UD6A 3VGEA 3SM0A 4UR7A 3PFMA 3WDIA 2EGZA 3S5OA 1ZBCA 1K8XA 3W1UA 4CEUC 4NNBA 1CYGA 5F2LA 1WXJA 4C6LA 4KW2A 1MMFA 3OLGA 2B81A 3THCA 1OJXA 1Q6OA 3KZSA 3TQPA 1SGJA 2BODX 4HCHA 1C7TA 3BLKA 4PCTA 3NO3A 1XYFA 5B7YA 5T9BG 1U83A 5AHLA 1ESWA 3P6LA 1TE1A 1JDEA 3CPRA 4TVDA 3GZAA 4GO9A 1ZBWA 4L9XA 3BL3A 1QVBA 5DCDA 2XH4A 2DFAA 3B8SA 3DECA 1UWTA 3V5OA 1QPRA 3UPWA 1W9VA 3HPSA 4XZMX 4ZCWA 1TQJA 4ERAA 1TVNA 1ENUA 3EWWA 4HA4A 4J40A 3S83A 3G0UA 1CENA 4IX0A 2G4JA 1UH3A 1TR1A 3BG5A 2VC9A 1CGTA 5H8MA 4J5NA 4JKMA 4U2ZA 1X1OA 2OEJA 4YCPA 3H22A 1SJBA 4MWAC 3UETA 1VLWA 5FJTA 3LMZA 4GYJA 3TQVA 1RCOB 3GC4A 4J27A 1QO5A 5FJRA 3GNPA 2V9DA 3KCLA 2QF8A 3BAWA 2HVNA 5D38A 5CSSA 2HSAA 2ZFAA 2BG5A 4HTRA 4MADA 4QG8A 6ALDA 3B05A 3QMSA 3K30A 3TDFA 3WX7A 3MUAA 3ZJ6A 3WFZA 1KM1A 4W86A 2GJRA 2VC5A 2IKGA 4Z0SA 3VGGA 1A4MA 2BB0A 1AD4A 1TJ0A 1JXJA 3SUVA 3THAA 2WC4A 2DZPA 2FVLA 3CHFA 1KFWA 1ITUA 1HJWA 1I75A 2G4FA 1TJ2A 3GDBA 2E6FA 3QH2A 1U30A 2ZUNA 2IXUA 3ZJKA 1L6FA 1KGWA 3AJXA 4UNLA 5GEPA 1ZCOA 3O8AA 3P62A 4QS6A 5A69A 5MHBA 3MM6B 4TTGA 4GLEA 1RCQA 2CC0A 4ACZA 3M7WA 1SZRA 3STEA 2Y6ZA 4Q4SA 1X6UA 3OR2B 2WSPA 5HQLA 1ZB5A 5I3GA 2GWNA 1YTDA 4MDPA 4GNJA 4IQDA 5B80A 3GU1A 1UD4A 3ARYA 1GW1A 2G5WA 3NXFA 5JVLA 4FX6M 1OADA 1Q45A 1QW8A 3A47A 2QJHA 3DCPA 1Q4NX 3QGVA 2C6QA 4KGLA 5HATA 3UA3A 4LYQA 4FNSA 3WNOA 1LP6A 3CH0A 3AS2A 4P8WA 1ECQA 4S3CA 2WJZA 3ITTA 4NXKA 2HPMA 5E0FA 3NO1A 2YCKX 3T55A 1GKQA 4UR9A 2G37A 1O1ZA 2PBGA 2VFHA 1WOAA 3LPGA 2AGKA 1V77A 3TXZA 3CU2A 3IRDA 3CAVA 1J96A 4R9XA 1Y65A 4FK9A 3IGUA 3G22A 2CHRA 4WUIA 4YTRA 4LC6A 1QCWA 3QF0A 4FB7A 5AY7A 4XIMA 1TPDA 1OZMA 4RZ4A 3M5ZA 1FH7A 2O4MA 4IF2A 4O54A 1BVNP 4IIFA 4O8RA 2GLKA 4RK8A 4GK8A 4TX9A 4UC5A 2D23A 3BAYA 5T91A 3ZR6A 5I02A 3GE7A 4X9SA 8XIAA 1QK2A 1H5VA 2OMAA 3E0VA 3GO2A 1I1XA 4W85A 3M43A 4FR1A 3AMCA 1NP0A 3NVTA 1DJQA 3N6HA 1MEWA 1GKPA 1BFNA 1T7LA 4PCSA 5BXPA 3GG0A 4CNOA 2FH8A 1BRLB 4X61A 5HNRA 5CC3A 4B5SA 5HNNA 4B5XA 3NZGA 4OV4A 4ENLA 3OHMB 2OWCA 1U5HA 1YPXA 2WVVB 4AVOA 5XIMA 1YADA 2XWDA 3PJXA 2QV5A 3N25A 1Z41A 5JUVA 4H9YA 3ANUA 3CPGA 4ZENA 1R2TA 4ERIA 4H8VA 4JL2A 2YJQA 3L4ZA 4ZXOA 9CGTA 4O14A 5J8LA 4TUFA 1IGWA 3WD3A 3UESA 2YXGA 2WJDA 4ZO7A 3KCJA 2QDHA 1UUOA 2FMNA 5FAGA 2C14A 4R3UA 1WV2A 4MTVA 2ZIDA 4CVWA 3QR3A 1ODUA 4YVPA 3WEZA 1UP0A 2Z2UA 1M1BA 3SQSA 2G96A 1XXXA 2QJIA 2FDMA 3S42A 4M80A 2XIIA 2UY2A 3GNOA 4KKXA 3AXXA 4IJRA 4UTJA 1WDSA 1US2A 4K1GA 4NY2A 4MVAA 3PZVA 2VVNA 4GXMA 1RXOB 5DBUA 3Q4DA 3LERA 1W8SA 2PDYA 3STFA 4PL2A 5FF2A 2W4XA 4C5ZA 4GY7A 4GI6A 1UQZA 2V68A 1OFQA 3S2LA 2CZVA 3B04A 2V38A 3H4XA 3HQOA 1UH2A 4IWWA 1PCKA 1RHCA 1TV7A 2IUZA 3RX4A 5FSEC 2NWRA 3ATYA 2WC3A 7ENLA 3GKFA 2JF7A 3SFWA 4PBEA 3W2LA 3OHIA 2Y61A 1FDJA 4LXFA 3AAMA 1DPMA 3VFCA 4L6OA 3AS3A 3UWYA 1W91A 4EAYA 1MSSA 5D30A 3JR2A 4QJ3B 1PYFA 2WJFA 4DAIA 1Z69A 4IXXA 3VKQA 4BQ2A 1BXCA 3AICA 3EKLA 3B0XA 2XJ7A 3ZJ8A 4B16A 3TR2A 2QQ6A 3B4YA 3V4BA 1Z44A 5BU6A 1EJSC 3GFZA 4U3CA 1W17A 1KTBA 2YDAA 3KTXA 5XIAA 3BCJA 1E4LA 5CGQA 3TW9A 1S5VA 1W9XA 1ZPTA 4U33A 3OU8A 1BGAA 3S0CA 3W1PA 4KRTA 2D2HA 3QGKC 2XSAA 3H21A 1PUDA 2ATSA 8RUCA 4TTUA 3HTWA 4PUWA 1G4EA 3JRKA 2PTXA 1XP3A 3EEGA 3FAXA 3N6QA 4PCFA 4UMCA 3N2CA 4UNIA 2A5HA 1XYLA 1H1YA 1B3YA 4C7DA 3VDGA 3GNNA 4I5RA 1NWRA 3IGHX 3W71A 1NOWA 5U7SA 4H1ZA 1D3GA 4S3FA 2EG8A 3FKRA 4ZFCA 3CZGA 1PKLA 2X0SA 2J7BA 4AEEA 5PTDA 1U5VA 3A24A 4EXBA 5BU9A 3C4UA 4HOZA 1T6MA 5CPOA 4Q3MA 2VURA 5ABHA 1HF6A 1HXJA 1AJ2A 1OC5A 4QG6A 3BMXA 4N42A 2Z1BA 3DYMA 2X1TA 3KHJA 1A5AA 1TX2A 3K1DA 2YL8A 3JU2A 1NQ6A 4B4HA 4ZODA 1KTCA 4Q4QA 5AFDA 1V0MA 3S6OA 3E02A 2XSJB 3ARWA 3W23A 3H12A 2F6KA 2QVNA 1FWDC 2ICSA 2PGRA 3LV6A 2HS6A 1RLCL 2G3JA 4AZ6A 4PTMA 2FZMA 3P8IA 2P0OA 4XUGA 3PM6A 3VGBA 2E28A 1K7FA 3UG5A 1GOQA 4IQLA 3AHXA 4HU4A 2O7QA 1T8QA 5AYZA 3SO7A 4UQAA 1J0JA 1EEXA 1E6SM 5BOFA 2V6AA 4Y6GA 3GHRA 1LLZA 3FDKA 5HWJA 1H7OA 4GACA 1DXIA 4D1JA 1SZGA 2GVYA 4QAWA 4DF1A 4QGCA 2VEGA 5LA0A 4EK7A 1A80A 2TODA 2OYLA 4IP5A 3EWYA 3H7VA 1AD1A 3VILA 1VIZA 4S2BA 1LQ0A 1FWTA 3TNOA 2PD9A 2WQPA 3MKVA 3VI2A 2X30A 3UP8A 3PBUA 1V6VA 4AIEA 2FHBA 2XVGA 5IFPA 1LL4A 3QR1A 4L9YA 3UJRA 3PWIA 4QSHA 4RDZA 4UFKA 3MM5A 2QUMA 4XKYB 1UD2A 4MLJA 4B4FA 1MFUA 4I5UA 4MYXA 3TC7A 3AMDA 5D02A 2YXXA 4CNPA 2H90A 1WZAA 5HULA 1H49A 2PRMA 2EQDA 3WNKA 2BOEX 2P1FA 4CQ8A 2P0IA 4MY8A 4GABA 3PB0A 3PULA 3A6OA 4AD1A 1MXSA 2E9LA 1OY0A 4NL1A 1GYNA 1EF2A 3THDA 1OIMA 2VWTA 3EWBX 4AIUA 3WELA 5E9XA 1DXEA 4J2MA 1H7RA 4HZMA 3MM6A 3ITXA 4LEFA 3W1QA 5I00A 3STCA 3VKDA 1HIZA 1VCGA 3TN6A 5LNSA 4RL3A 5A6BA 1LL7A 4H6EA 3EX3A 3U9IA 1KO0A 1X38A 3GR8A 3TH6A 2OWWA 1S2CA 1EP2A 1R3TA 3MBDA 4ROQA 1DHKA 2ZA1A 6XIMA 2Q8ZA 1NEYA 1PHWA 4F66A 3QZAA 3OZOA 1WAWA 2PWUA 3VKTA 4WF7A 1UWUA 3TC3A 3HG5A 4C90A 1G4SA 3VM1A 2EJAA 2ISWA 1Y0EA 4V28A 1BG9A 3TYEA 3C0SA 4AUBA 1F6KA 1TPVA 4MAZA 4ZA0A 1CB7B 2YCJA 2EBNA 1HJUA 4GY0A 4O1AA 1NTHA 3C2VA 4L56A 1PKMA 5ABTA 1GVEA 3O1NA 4IOTA 3DHFA 2C91A 1BWKA 4I8DA 3SRFA 4RR4A 2ZUTA 4N9CA 4CCDA 2VQUA 3FJLA 1GQIA 2CLFA 3N2XA 3GG8A 4R7JA 4JN6A 2JGYA 4M81A 4S3BA 1BG4A 3MM7A 2DSKA 3T0TA 3SN1A 4INFA 2UY5A 1XIGA 1B9ZA 1VJIA 4MNJA 4WHBA 2XISA 3SFKA 3OZPA 2FZBA 2QCFA 1E5NA 5D37A 4MPQA 4W8AA 4G39A 4S3GA 3OGSA 5E5CA 2J78A 5CLTA 3HG4A 1S5WA 4GXPA 3QYQA 3LCIA 4E2BA 5KEZA 3W7CA 4C6PA 4O1FA 3OPSA 3CJPA 3GC2A 1UR2A 9RUBA 3AS1A 4JXCA 3QJAA 3VM5A 1XLBA 1EUAA 1A5NC 3ABXA 3ZS4A 4PTXA 3COTA 5DT5A 1R7OA 1L0PA 3M41A 1S1RA 1VCFA 5C7HA 4TIMA 4AF0B 1ZQ5A 2V2DA 4LY8A 4H2CA 1ISVA 1O95A 1A3WA 1NWUA 5K7JA 3S1VA 4GFIA 2GJXA 2EPHA 3CTLA 1UZ1A 1VEOA 3RPDA 4CD8A 2OXNA 4IX2A 1JZ7A 3H54A 4HA3A 2I57A 5I78A 4P7NA 1A5MC 1P6CA 4IH3A 4AWSA 4F0HA 3M0XA 3MBFA 2P5NA 3DFNA 1A5SA 3CMFA 1EZWA 2NX1A 4ALDA 3MSRA 2HV5A 4UCGA 3CHCA 3VC6A 3WLSA 3HGRA 1HX0A 1M3UA 6TAAA 3UWVA 6REQA 1XDJA 5CPQA 1AH0A 1PWLA 1HQTA 5AHIA 3W85A 2E5DA 4FX7A 3S6TA 1EIXA 3B8VA 4GGBA 4M29A 4D6EA 9XIMA 3RJXA 3VMOA 1XBZA 3O06A 2YBTA 4UFIA 2F7FA 1CWYA 4PE8A 4JIEA 4NP7A 4I6KA 3Q94A 1ELSA 1JZ2A 3B0NA 3LQLA 3NQ8A 1E9IA 3H6OA 2ZDRA 4AZGA 2V3EA 3EOEA 1SO6A 3TYUA 3FHQA 5FF4A 3ZWSA 3LHUA 3GR7A 2RGLA 1ZJAA 2V69A 4H9MA 1W54A 3DFYA 3E2VA 5JQ9A 1XRSA 1UWSA 4PTDA 3HO8A 3DDMA 5AC8A 1VRDA 3MS8A 4MNKA 4GYFA 4MDOA 3E0IA 2ZXDA 3SN0A 5K4ZA 3HGSA 4JTEA 4JTKA 5A94A 2CERA 3A3WA 1RBOB 4YJ5A 3PAJA 1N8FA 3N2TA 3PN8A 1RQEA 2XM1A 3QN3A 3R43A 5DFAA 2XINA 1FP8A 4DIAA 1XRFA 1LOSA 4FOKA 2VTFA 4LUTB 4QQUA 1LBLA 3POHA 2XVLA 3L4VA 5JBEA 5GJNA 1I0DA 3C0QA 5DRCA 4D71A 2ADAA 3VZYA 5G2HA 3HG2A 1F4HA 3G8EA 2E68A 4MOZA 1S3TC 3QQWA 2PWHA 4UMBA 2QW5A 3GTNA 5HMSA 5SWUA 1TPC1 5FF7A 1GVOA 2QR6A 1VPXA 4MMWA 2VDGA 1BF2A 1I9CB 1XBVA 3AZTA 5REQA 2P8BA 2YIHA 5EL1A 3A12A 4PMVA 1IWAA 3KRBA 1E6XM 3RHGA 3ZLHA 1HTIA 2E8ZA 2KAUC 2HQAA 2YB4A 4EXAA 1O66A 1VLIA 4IXHA 3S4TA 2VEIA 4LS1A 1D8WA 2BVYA 1XI3A 1Q65A 2HCVA 4XAGA 1H2JA 2RH9A 4HZ8A 4B3LA 2NQJA 2OCZA 3C61A 1EPXA 3TCEA 2VFEA 1HJVA 5M03A 4GVGA 4U5KA 1AUSL 5BROA 3ZIZA 1H1ZA 2QPXA 3F4VA 3GXDA 3QKEA 3VCNA 4DZ5A 1A5UA 4MWAB 1K02A 1TRDA 3NYZA 2FZ8A 1Q6FA 1YHTA 2WK2A 2BY2A 4EWJA 3ARPA 1IZCA 3G3MA 1OYCA 1SSGA 4HNNA 3UG4A 1AMYA 3N29A 1EF3A 1EZ2A 5LHFA 2DZXA 1PAMA 1K6AA 2DT0A 2BHUA 1RY8A 1NP2A 3WJXA 3EWUA 4HNVA 4X22A 2PLJA 1V6TA 3W27A 1K7EA 1TWZA 2Z1VA 3WEOA 3UJ2A 1OINA 1GPWA 4W5ZA 2W27A 2R1KA 3HPXA 3P82A 1B90A 5F2IA 1V0LA 2YLLA 1FWWA 4M6VA 3VE7A 3L7RA 3WDHA 1SW3A 1R3RA 1BGGA 5BCAA 2OZ8A 3KVLA 3N4EA 1XRTA 1OCBA 3R13A 1O94A 1KLZA 4QHRA 4BF5A 3MMAA 4JBRA 3MM9A 2NV1A 3B0PA 4IFKA 4PB3A 2V3DA 1Z32X 3GDMA 3VIGA 4LNYA 3W7NA 1TV8A 2Z26A 3TCSA 4HOXA 3F5KA 3VK5A 3UR7A 2E1WA 5TIMA 2GSEA 4D6IA 4XKMA 2WPBA 5D2VA 3K8KA 3QR0A 3TN4A 4LJ3A 1G1YA 5KETA 4XD5A 3OP2A 4DWDA 3KBJA 3MI2A 1M6JA 4GA8A 3ZMRA 1J2BA 2DIJA 5I09A 2GGHA 1B2YA 3FHAA 4XZHA 3WENA 4LUIA 2I5GA 3UZXA 2QHAA 2PLCA 3MP5A 3LZ5A 3R79A 3M6DA 3NDYA 3VIMA 2GPTA 8CGTA 4HA0A 5KZ6A 1OABA 3D3FA 1F05A 4X60A 3B0VC 4MAVA 4CU8A 1O5XA 5A95A 2XFRA 4W8BA 2YCLA 1HO4A 1JJKA 1LBMA 1ODZA 3GQYA 4FLRA 2RFGA 4RDWA 5JBFA 4C1KA 1V7YA 3T07A 3MUCA 5K9CA 1EO7A 3AOFA 4L6DA 5HNUA 3NOYA 4JFTA 1M03A 1JRBA 1E0TA 4HB7A 3LCLA 4K37A 3MO7A 3Q37A 2Z00A 3TTEA 4I6VA 4H2HA 1OB0A 2VYOA 3FK4A 2VUYA 4I9AA 3ELFA 5D2WA 4PUUA 4AZCA 2J7FA 3CUHA 3N13A 1QW7A 1X7IA 2JK2A 5HJLA 3CZJA 4CNNA 1WDRA 2EPOA 4RJEA 1YXDA 3A3HA 1VIWA 4KMQA 3LZ3A 4Z2JA 3GFYA 2X0HA 1EL3A 4JIHA 3SDOA 4FSAA 5I07A 1UR3M 3TYAA 3WQ5A 5I3IA 5HPCA 2GSJA 1HJQA 1EUNA 2BSLA 2OO0A 3TONA 3WY1A 1MQRA 4PSRA 4RNJA 3QKZA 3VPLA 1VB9A 1UOKA 2W3ZA 2YR1A 2R1NA 3W7IA 4H3DA 4FP1A 1DJZA 4H41A 1Q4WA 5BZAA 4XV0A 8A3HA 5AC4A 4LB4A 1ZRQA 4GWEA 3IIVA 1F3WA 2Z1KA 5FJPA 1TJ1A 4EOUA 3QBUA 4REQA 4DUVA 1PTAA 3R58A 1OYAA 1F07A 2Q01A 2VD8A 3RU8X 4XVDA 3GIQA 3JZUA 3SECA 2PWGA 4IMGA 1R9ZA 3M9YA 2E8YA 3NQDA 2CKRA 1MDLA 1Q6RA 3VX0A 2EG7A 4YU1A 3VD7A 2CKSA 3HGOA 4NASA 6CGTA 1VYSX 3RAOA 3VAVA 1FWJC 3DBPA 7TIMA 4P8VA 3G1YA 3THUA 3AUJA 3QZ6A 2AL1A 4ADSA 4IICA 1EDQA 4LEQA 3FEQA 3SCSA 2IKJA 2YA2A 4ZB2A 3T8LA 5FL0A 3D46A 1E5JA 5C6MA 1J11A 1WA3A 3TW6A 3U0HA 5KSWA 4BA0A 3I7RA 1DQWA 1WNOA 3R89A 3BDKA 1ZHAA 1EA0A 1XGEA 1Q6CA 4XZNX 5JIWA 2X1UA 2G3IA 2WVTA 1RQHA 1VS1A 4I7WA 3AO0A 2VC7A 5CZJA 4IPPA 4P7RA 2UZ9A 3DX5A 1XKYA 3W75A 1ISZA 1OFRA 1IE7C 1Z7AA 2X7WA 4IIBA 4AYGA 1NFGA 1YLVA 1REQA 5I3HA 1H41A 3E38A 1AW2A 3QXBA 4TO8A 2BASA 1KV8A 2GJPA 4IIHA 1WKYA 4Q7IA 4OGZA 2I56A 3PANA 2JQXA 1QNVA 1W1PA 1E4IA 4OIFA 2BDQA 2D69A 4YYFA 3BICA 4CU6A 4BI5A 1XD0A 3L5MA 3BAXA 3EMQA 5LIYX 6PTDA 4XK2A 2BTMA 4A3QA 4S3AA 3WLPA 4AQLA 3DBNA 2GYIA 1TRIA 2XVKA 3T2QA 2I9UA 1KRCC 1NELA 1E6NA 2UY4A 5CJ5A 3HJZA 4WKAA 1UIOA 1AQMA 3O16A 4QQ3A 3QC3A 5CAKA 2RDWA 1GVYA 4GUFA 1Z3NA 2PGWA 2BX7A 2VC6A 4C7GA 4TQTA 4KERA 3AUOA 1VPYA 4TOQA 1JAEA 4Z1CA 2H3BA 1JXKA 3LYEA 3QM3A 3QTGA 1ME7A 3A22A 3TJLA 1ITQA 3R8HA 3W7DA 2BV9A 2Y7EA 1FWGC 1AL7A 2OODA 2WNNA 1EJXC 3PZMA 3KL3A 2P10A 3GH4A 3PJWA 5BRQA 3KBWA 7REQA 4C6JA 1PB0A 2XIQA 3HJEA 4L1XA 3WKZA 5CSRA 3LCWA 1OT1A 1GT8A 2D20A 3A23A 2VRQA 2NV2A 4HNOA 3WMBA 1FWIC 4BEUA 3BARA 3PTDA 4JKLA 1WXZA 3II1A 4GJJA 4E3TA 2CWXA 3LB0A 2RDTA 2GVJA 5EBUA 7CGTA 3AIRA 2YSWA 3NQGA 4O17A 4JQ1A 3I7QA 3BZGA 3DFTA 2FGLA 3QVQA 1M7OA 2AOPA 1ZAJA 3LRLA 3KRZA 3OO2A 5I03A 5D9NA