4G9PA

Structure of the gcpe-mecpp (ispg) complex from thermus thermophilus
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
405
structure length
405
Chain Sequence
b'EGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Structure of the GcpE (IspG)-MEcPP complex from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 133
structure length 405
sequence length 405
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4g9pA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4g9pA02
3BOLA 4NIRA 4MWAD 3MMAA 2VEFA 4GEPA 3VM1A 4MWAE 3MCNA 4S23A 3H2NA 3TZNA 4S3FA 3TZFA 2H9AB 4DJFC 3TR9A 4C1NB 3B0GA 4D8ZA 3MCMA 4DJEA 2V4JB 1TX2A 3MM5A 3OR1B 4O1FA 2OGYA 3MM9A 2Y0FA 4DJDC 1AD4A 1Q7MA 4MWAC 3BOFA 3MMAB 3H2AA 3H22A 3VLXA 3VKPA 2AKJA 4DJDA 2GEPA 4HTRA 3V5OA 4O1EA 1TWZA 4MWAA 3B0LA 3MMCA 4S3BA 1TX0A 4NILA 5GEPA 4D8AA 3B0NA 2YCLA 2YCKX 3H26A 1TWWA 3H2EA 3B0MA 3MM5B 2YCJA 1AJ2A 3MM8A 3VLZA 3MCOA 4DB7A 1Q8AA 3MM9B 3OR2A 5JQ9A 3MM7A 3AOPA 3H2FA 3VM0A 4DAIA 1Q7ZA 3VKSA 4DJFA 1AJ0A 4S38A 1AOPA 3TYBA 3H2CA 7GEPA 1ZJ9A 3H23A 4G9PA 2AOPA 3MMCB 3H21A 1AJZA 3VKRA 2YCLB 4HB7A 3NOYA 3B0JA 3MM6A 3VKQA 4AOPA 2DQWA 4O0QA 3VKTA 3MM8B 3TYCA 3TYAA 3OR2B 2VEGA 8GEPA 1TWSA 4DJED 3MM7B 2Y5JA 1Q8JA 4NHVA 2VP8A 2DZBA 3TYUA 2YCIX 1F6YA 2XSJA 4S3DA 3GEOA 4DAFA 4S3AA 4S39A 3B0HA 4PZVA 4MWAB 3MMBA 4D9PA 4DJEC 1ZJ8A 2BMBA 3H2OA 3H2MA 3K13A 1AD1A 5AOPA 1EYEA 2Y5SA 3VLYA 3TYZA 4S3EA 2H9AA 3H24A 6GEPA 4C1NA 4DJFD 2XSJB 3TYEA 4S3CA 2V4JA 2DZAA 3OR1A 4NL1A 4CCZA 1Q85A 4G38A 3TYDA 3MMBB 4DJDD 1Q7QA 2E7FA 4G39A 3MM6B
chains in the Genus database with same CATH superfamily
2ZUWA 3ZS4A 2V2DA 1LQ2A 1XFCA 2A7PA 2Q8XA 4ZTXA 1MXGA 2J47A 3SCRA 2G96A 3ZVHB 3BK0A 3LS9A 3E12A 1WAUA 4WZHA 1UR8A 2V5BA 3UXIA 4Y8FA 1TE6A 3QZAA 3SUVA 4LJ3A 2PDPA 2VQTA 3ZYZA 3VLXA 3UWEA 1V6XA 4IFKA 4QCFA 3TNOA 5HQMA 3VNIA 3VUPA 1UG6A 1C92A 2OGJA 3M4HA 4JBRA 3LPFA 5G2HA 2VC9A 4C6BA 1IE7C 2PWGA 5DF0A 4OU1A 3MJMA 4HZ6A 3MSGA 1UD3A 4XZBA 4H1ZA 6ENLA 2ZZ5A 1VKFA 3NIYA 1EGMA 1DJWA 5DMNA 3CIXA 3KRZA 1Y7VA 4H8VA 1GJUA 3C5QA 4J2PA 4JTTA 2VP8A 4IOTA 4LBRA 3C3UA 4QSHA 1MUWA 6CGTA 2CC0A 3QPEA 1FFRA 1QUMA 3H70A 1UZHA 3OJGA 2ZADA 3TWBA 4DZIA 4OHQA 4DUVA 3CYVA 3I7SA 2P8BA 2D1ZA 3RK8A 4QQUA 1EYEA 3UT0A 5LA2A 2XWEA 3OBAA 4PCNA 2QVHA 4B3LA 3A21A 3B04A 4AEEA 4F2TA 4WDWA 3VM7A 1S1RA 4TQTA 5FJPA 4YPJA 1QPRA 2VELA 2GJRA 3B05A 4A3RA 3QOMA 2VEFA 3ZR4A 1RH9A 4WDUA 5HMFA 1VPQA 2BOFX 3WBXA 4I6VA 1HJWA 3N73A 4PA8A 4E2VA 3MSDA 2Z1XA 3R0DA 5FAGA 4H04A 4AF0A 2MUCA 4KWSA 3LSCA 5HBFA 1Q2RA 1IWAA 3SRDA 5DEZA 5J5DA 1MFUA 3UJRA 2YCLA 1K7EA 2CXGA 2QQ6A 4K1GA 4JTAA 4B5WA 2QS8A 2ZUSA 4FF7A 9XIMA 4WLCA 2NQHA 2Z1KA 3EGJA 4WXYA 2ZDSA 4QROA 1AJ0A 2VCBA 3AXMA 3H23A 1NQ6A 2TMDA 2TYSA 4UB9A 1RPKA 3QYQA 4JTSA 2DZSA 1HW6A 1MRAA 3OVGA 1F3XA 1AZ2A 4ERIA 1IZCA 4S3KA 5CZKA 4GUHA 4WSKA 3SEPA 4HZ7A 3B8SA 1FWRA 1XYLA 1OM0A 3N3MA 4NX0A 4UMBA 4ACZB 5ABFB 3UJSA 3QF0A 3VOHA 2W4XA 2X1SA 4R7JA 3H2OA 4QE4A 3MMUA 4Z2HA 1DYSA 3SCTA 2ZE3A 1GOWA 1FWNA 1UWIA 4LNYA 2EG6A 6GEPA 3E0VA 1M7PA 1V3MA 1XIJA 3F1QA 4AUBA 2NXHA 1OGGA 4OKDA 3V16A 1W1PA 3VKCA 1E71M 3RHGA 1K4HA 2OEMA 3M43A 3LGDA 4XWUA 2PFHA 3WBAA 4J3TA 1VLIA 1OC7A 1QNSA 1KFWA 1SU5A 4J5NA 4KQNA 5A6BA 1A5OC 2CITA 2A85A 1CXLA 2OELA 2P50A 2PZNA 4OE7A 5DANA 2UV8G 3E2SA 2WC3A 1OCNA 4DAIA 4DJFA 4PTNA 4U5IA 3UXLA 3RM4A 3N9KA 3W2UA 3LERA 4N6FA 3NQMA 4JKKA 4CD5A 3TYCA 2V38A 3IAPA 4DPQA 3KL5A 3OLIA 4I9MA 4QS5A 1W1B1 1EDGA 3AOFA 4F3HA 5CC5A 1P1XA 1PV8A 3PAJA 1DIDA 3B0XA 1FHLA 3AS0A 3S5OA 3LBOA 4MVAA 1HJXA 1OFPA 3O6YX 2PDUA 4L1WA 4UIOA 3VTRA 3H2MA 1T8XA 5CQ1A 2E9BA 3LQGA 3GU2A 4AW7A 1NU5A 3WQ4A 1A3XA 4F2UA 5HMDA 1M9HA 2ZQ0A 3NSNA 2DY3A 5F2GA 1LG2A 2F84A 2ZXBA 3ICJA 2PWDA 4G39A 4AIEA 2QZRA 4NJHA 3QN3A 3VNMA 3B9EA 1HO4A 1GW9A 4MDPA 1VYRA 1XW8A 1XH1A 2VHLA 2QJMA 3GDTA 4TIMA 3T4CA 3KEHA 1FDYA 1X7FA 4L61A 4ZFMA 1KB3A 2VX4A 1JAKA 4MB4A 4V1XA 4FIQA 3ARPA 1J11A 2X2YA 3W1PA 2Z29A 3TA9A 3REQA 1XSIA 1JFHA 4X61A 3R58A 3KFTA 1F73A 2QCEA 3W7QA 3KOZA 1OGSA 1OHLA 3GHUA 5DCBA 4GUGA 5E9XA 1PDYA 1C8YA 5MHBA 4LGXA 1JR1A 4Q32A 3HG4A 3FJ4A 1HP4A 1Q6RA 1X6UA 1KFCA 1OGBA 1XBVA 2PA6A 4O13A 5DMYA 2J8FA 3THUA 1Y5VA 2PDXA 4ROPA 3GQYA 1XUUA 3WO8A 2QLYA 3PTDA 4GXPA 3N9SA 1UROA 4RXGA 1LWHA 4U33A 1K4GA 2PE4A 4J3SA 3HGRA 4IIEA 2GJXA 3W1QA 3OVPA 2ZRXA 3UCDA 4BEQA 5A6SA 4UTWC 3DI1A 4F4RA 3MS8A 4HP5A 5I78A 5BZAA 1BYDA 1XYFA 3IIVA 3VGHA 4GBUA 3BGJA 2JFEX 4O4VA 3AS1A 3U57A 1GW1A 3W22A 3TA6A 2QPUA 2YPIA 3L9CA 5GNYA 1VFUA 1F3EA 1SPQA 4GXWA 3DH7A 3CGTA 3FV9A 5D8ZA 4UQDA 1NY1A 1J01A 1ZL1A 3V1HA 3E5PA 1TTPA 3UZYA 3WZ0E 1PHQA 1UWAA 9RUBA 1E0UA 1IXQA 2PDQA 1QAPA 1UR9A 2FHCA 4L65A 3XISA 3TC6A 1G01A 1MNZA 4FXRA 1PKMA 2FPTA 2VDGA 4XX6A 1T6MA 3ARTA 3QGKC 3VI2A 5F2LA 1L6FA 3B97A 1TZ7A 1MEIA 4CUCA 4BQ3A 1EJ7L 3IV8A 1JCLA 4JL1A 3EDFA 5GPRA 1ONWA 5D38A 1IV8A 3PBMA 1SQ7A 1KO0A 5D2YA 3A3XA 2VNCA 2I16A 7REQB 4AQLA 1HZYA 3F03K 4ZOEA 4Y7EA 3QZEA 3WJZA 3HIJA 4DEFA 3EDDA 4B3KA 3W9ZA 3D0CA 3NYDA 2GQ3A 1W3TA 3WF4A 4F0HA 3W02A 3GFYA 3NNTA 1R46A 4DWSD 3E0LA 1I4NA 5KITA 4LX4A 3VIPA 1NEYA 1XRSA 1K8XA 1SZNA 2DFAA 1TV8A 5EFFA 3MQTA 1AA1B 3NPUA 2HZGA 5I3GA 4AZ6A 1LT8A 2Q01A 1M03A 3LLXA 1ADDA 4I9JA 3VIOA 1RP9A 3G1RA 3ALGA 4NAFB 5CXPA 2VYOA 3EWXA 2ABBA 3JW7A 1ZAHA 4KEZA 3PJXA 1OK4A 3MM5A 1RA5A 5IRPA 1NVMA 1RJRA 4RZ4A 4A2RA 3XIMA 3G6LA 4Q4RA 1TYGA 1VYSX 2HSAA 3WDJA 3VX0A 1ZZMA 1P0DA 4MGGA 4ZQMA 3B0UX 1JZ3A 3G24A 3BTNA 3QLDA 3MA8A 3TCEA 2MNRA 4NJKA 1AQ0A 3CYJA 3H2FA 1P48A 3DZ1A 5I3IA 3IARA 3NJ3A 3QKEA 1YQ2A 1OFEA 3W2KA 3FGCB 3GXFA 4ALDA 1RXOB 4CNOA 3LSBA 1OFRA 2GK1A 2DT3A 1UIOA 1H0IA 1Q3NA 1XS2A 4QNEA 4TX6A 2A7RA 4JQ3A 4H2CA 5F2MA 1E1CA 5FESA 1G1YA 5GJMA 6REQB 4R33A 5HDRA 3NQFA 2GPTA 3NGFA 1R9XA 4NYYA 4ZMGA 3HU7A 4J27A 4Q8QA 4E0CA 2QJIA 1UKPA 4IIBA 1FH9A 3RX4A 5ECVA 4DXVA 1W3LA 2VRQA 2JEQA 1T99A 1LM1A 1AUSL 3B0GA 3KBMA 2XIBA 3PUEA 3ZIZA 1GPWA 3NEVA 3QR1A 3A23A 3LLDA 5FJRA 3F2BA 3N11A 1W1TA 5BU6A 3CU2A 4IQDA 2PBOA 4HTRA 4KCUA 3KL0A 3EMZA 1X98A 3ABSA 4Q8VA 2DH2A 4B4HA 3M1ZA 1IWPA 1THFD 3FA5A 3WQEA 4ZL1A 4L80A 2OQHA 3WLJA 3KBJA 1JPHA 1V03A 2P88A 4Z1YA 1VLWA 3B8TA 2ODOA 7GEPA 2RUSA 3GNOA 2JF7A 3VNZA 3OBEA 3BE7A 4HNUA 2WYSA 4B5UA 1AW5A 3BLPX 3FVDA 1JDFA 2V67A 4BZYA 4M7TA 4NHVA 2Q3OA 3DKJA 3FYYA 4R9XA 3NQEA 4KWWA 1VAHA 1NOUA 4GQGA 3WD2A 5LIWX 3NWRA 3VOCA 1V08A 3E9AA 3W37A 4XIMA 4L1XA 4IIGA 2RKXA 4GABA 2D69A 3G1AA 3W0KA 2NZLA 4JIIX 3P5YA 5CSYA 5CLTA 1OYCA 4FALA 5K3VA 5DFAA 2XG9A 2ATSA 3OP2A 2PB1A 2DUXA 4P7NA 1RAKA 5IOBA 1JUBA 4Z2LA 5AZ0A 2D73A 2J6XA 3ABZA 2YCEA 3FJ6A 3IJDA 1K6WA 3BMXA 4EF8A 5E93A 1SFTA 4AX7A 2QVNA 3OHMB 4PTDA 4I3GA 4W4QA 1OIMA 1KRCC 3WJXA 3P6LA 1KR0A 1AQMA 2PTXA 1DJYA 4HGXA 4QRNA 2C71A 5HINA 1HT6A 4BR1A 3WQVA 3T2QA 4GCXA 3GG8A 5I6SA 3WUBA 2PP3A 4BF5A 2GQAA 2PF8A 4GBDA 1P43A 3U48A 1RJQA 1KWGA 4O14A 1YTKA 2VUYA 3GS6A 1CXHA 1FCUA 1KV5A 1PZ2A 3G1DA 3QW3A 1PE1A 2NVDA 1BHGA 5EMJA 2BLEA 2G3FA 1XGEA 1DWJM 2YDSA 2PGWA 5CKSA 3RU6A 1ZALA 2NQJA 1OWQA 1A0DA 4ADSA 2ZZ1A 1D9EA 1JZ4A 3CO8A 3GVGA 1MXSA 4NL1A 2WKJA 1IZKA 4D6DA 3BLDA 4JFVA 1YDOA 2X7VA 1FKXA 2W66A 3AZTA 2VUNA 3TV8A 1FHUA 4Z2KA 1U22A 3TR9A 3SDOA 1J4EA 2EJ1A 3NO1A 2G37A 4JTKA 4D6CA 3L2IA 3QQ1A 1EC7A 2ESCA 4JL2A 2ALDA 1M7JA 3GYCA 4CU7A 1CXIA 3VOIA 2BY0A 4Z2JA 4BQ2A 4KFNA 3H2EA 1F76A 4C5ZA 1DORA 1MMFA 2VR2A 1PPIA 1IT7A 2BOGX 4GNJA 5LA1A 1BRLA 1Q4WA 1UR3M 1JPKA 3GZAA 5LIKX 3USBA 1UZ4A 1C93A 4U10A 3TTOA 1QBBA 1JZ6A 4UFKA 2F6UA 2J8GA 2HBVA 3EA3A 3T07A 1V3IA 2A3CA 2CBIA 2A1YA 5DN1A 3K1DA 1S2UA 1S5WA 1UR0A 2VJXA 2YCIX 4WEVX 1JZ2A 2OEJA 5EBAA 3WFAA 2E28A 3AIEA 1IXNA 1D8CA 2Z4GA 4MKVA 1ADOA 3THAA 2W92A 1XBYA 4MUPA 1B3XA 1ME9A 3CH0A 1E9ZB 3CAKA 4ZOBA 2OJPA 4AY1A 3TMQA 4AZCB 1X1NA 4I5UA 3JZUA 3MO4A 1KW1A 1TRIA 1KM3A 1H7OA 3H8AA 3QLLA 3N2OA 3TCSA 4EANA 3KVKA 3MVTA 3MC5A 3CEPA 4AY8A 2F38A 4JY9A 1HO1A 4GHRA 1O6IA 5H8PA 3JVAA 3O06A 1W32A 3L5LA 1FA2A 3OPSA 1TQXA 1RCOB 1NWTA 4E3TA 3SY8A 3GXIA 4MTVA 2JE8A 3H2AA 2QCGA 4ZXOA 3R43A 3U5YA 1CENA 4GE8A 2FGLA 1SJBA 5H6HA 1YLVA 3K4DA 4S3BA 2ZDRA 3BGAA 4AZ7A 2ZRUA 2NQ5A 1SSGA 2DSVA 1R7AA 5BRBA 3FY1A 1W1YA 1GUVA 3IIPA 4BI7A 4MFDA 3AIVA 3TYBA 3ECQA 1E6RA 3SI9A 4HK6A 4J3VA 5G1YA 1PWLA 2WJFA 3VDGA 3W2LA 2RDTA 2FZ9A 4OV9A 4WVXA 1D8WA 1XLKA 1U5JA 1V0LA 4PMXA 1IIHA 2J78A 2H90A 4HJFA 2Z6IA 1QOQA 2CU0A 3WD1A 1JDAA 1ICSA 4GQBA 3NDOA 1DJZA 3VU2A 4W8LA 3KTXA 3AHVA 4B2DD 1WZLA 4WDTA 1BGGA 2BXVA 5ENLA 4RLIA 1LJYA 5HUOA 4S3AA 4IG2A 2DSZA 2P0OA 1QO2A 4OBRA 4PC8A 2IUZA 3AS2A 4AHQA 4HN8A 4HOXA 3VNYA 1QO5A 4NJGA 5E0KA 3M9YA 5T8GA 1GZJA 3LI1A 3ZO9A 5MKGB 3SB0A 3BAKA 3S5YA 1T0OA 3GC5A 3W6MA 2FDMA 4LY4A 3DFPA 1QI5A 1N8IA 2PURA 4ML9A 4DM2A 1E4LA 1HN1A 3OEXA 1UD4A 3SIMA 2WMHA 1RK5A 3MWCA 3WQ6A 1VJZA 4UZSA 4UTWA 4GOAA 1QW9A 2XH0A 3VNJA 1UH3A 3VOFA 3BW2A 3IGUA 5XIMA 4D6EA 2AKZA 5ECUA 2GGHA 3S6OA 5JBEA 2X30A 3T8LA 4RNFA 3NPXA 3TN3A 4CCEA 3VKRA 4OUEA 3PHAA 2ZX6A 1IEQA 3ALFA 1TIMA 1UZDA 2VGGA 2HE8A 5KETA 1EXBA 2XTKA 3WQGA 1KFJA 2Z1SA 2X16A 4ORIA 2CERA 1FCBA 4MM1A 3TVAA 4NX5A 5D05A 4BQ5A 3K8KA 3CZ8A 1VCGA 3T40A 3GDLA 3LZ3A 3MYOA 3FN9A 1HJQA 1UJQA 2QCLA 4JQAA 3CPRA 4QAWA 1QCWA 1KTBA 4A4AA 3KVMA 2Q6ZA 2FZ8A 4QJ1A 1AFSA 3G1YA 1G94A 1C7TA 1MNSA 4POCA 3CV2A 5KZ6A 3K5XA 4LS0A 3NQ7A 3VM5A 3W7HA 3PFRA 3Q37A 1J0KA 4UWMA 1G7UA 4RJEA 3UNDA 1FWTA 3AIRA 1XD1A 3R13A 1MDRA 2VQUA 5A95A 3L2MA 2V30A 1TV2A 3LG3A 4XD5A 2AL2B 3TSMA 4IMGA 3IUDA 3K4AA 2WJDA 5IM51 2JBMA 1I1WA 1UA7A 5JQ9A 3R10A 5DT5A 4L4OA 4LY8A 4G7EB 1FOBA 4HA4A 2FQIA 2DJXA 4N42A 3BLOA 4GJIA 1DQXA 1RBOB 4LAZA 3TN6A 1Q6OA 4FIRA 1M7OA 1PDZA 4AZBA 4J35A 2WM0A 2JIEA 4DI9A 1QR7A 2IPJA 4K8HA 3OBKA 3P8JA 2R1PA 4K8EA 3H54A 4CNNA 3FYPA 1NWRA 3F5KA 4IIFA 2DEPA 2DGAA 1E6NA 4IIDA 5JH1A 4RV8A 1J9YA 2CLLA 2WZHA 3MHFA 3WL0A 3BAIA 1RPXA 4L6DA 2TPSA 5BXTA 1RR2A 5JUVA 1FRBA 1O1ZA 5ABHA 3WUGA 2DP3A 3OA3A 2R24A 1TG7A 3AHZA 4REQA 4XZMX 2J9XA 4MJMA 3CZKA 1OT2A 1QPKA 2WBGA 3CUJA 4BJHA 3SRKA 3VGEA 3IVUA 3BPWA 1OCJA 1AZ1A 1EF3A 5JU6A 4C60A 3I4KA 2ACSA 2JF6A 1LLWA 4JFWA 9CGTA 4F0LA 1ITUA 3DFYA 3AHYA 2QULA 3FEMA 1RK6A 4FB7A 3U5UA 2FMNA 2REQB 1CGUA 4R85A 3UWVA 3AU6A 1F74A 4M51A 3AIBA 3NUKA 1LT7A 4WSHA 2CCRA 2CYGA 2QUVA 3AU2A 3D6NA 4TMBA 1QWKA 3ANYA 4GQRA 4BK9A 3VMOA 4JKMA 4GFSA 1KGWA 1OG6A 4Q6JA 1QK0A 2Z24A 1AODA 5JIWA 1OVDA 5MF5A 4AMCA 4B5TA 4EAYA 3I6EA 1E4NA 1FDJA 4AWUA 1YEYA 3FDGA 2WPBA 3LV6A 3PWAA 5A6BD 2ZX7A 1Y65A 2YZRA 2Z6JA 4CN6A 1PSCA 3I3DA 3AYVA 2ZYFA 1V7AA 1E9IA 4HNNA 4JYDA 4QG6A 5LNSA 3SCPA 2BZNA 4CQCA 4PRTA 3LHZA 1QTWA 4FX8A 3QW4B 3DN5A 3OA5A 1P6CA 5I02A 1QU4A 1WKFA 2ACUA 2Z2AA 2GL5A 3QHOA 5HAOA 5FEPA 1SJDA 3QKZA 5F1UA 2QPXA 1KBLA 4CEUC 3Q2DA 2E5DA 2GSEA 3ANUA 2W63A 5A8GA 2ZA2A 4X63A 3WEZA 4UFHA 1I2RA 3LGEA 1IEIA 4YWSA 2BGNE 1A5BA 3RRXA 4IPPA 5CLWA 3TFCA 1BTCA 4O53A 2BSLA 2PDLA 4NZ1A 4PMVA 1ITXA 3QTPA 2GQ9A 3F2DA 4ICMA 3IRDA 3W1UA 3EX4A 4IMCA 2G3NA 4L4PA 2XGBA 5DBUA 5ABGA 4FX7A 1ODUA 3CMFA 3EAUA 3OZMA 1MWOA 4S3EA 1JNEA 3H24A 1XRVA 2YL5A 3SQLA 3ZFHA 5BOEA 4EPKA 5M1TA 3N2CA 3VLZA 4LCSA 5D02A 2V82A 4M1RA 3GDKA 3A47A 1DJXA 5U4NA 1MZRA 3M64A 3Q58A 4ZR8A 2E25A 4PL2A 4LXFA 5LKYA 4O52A 1CLXA 2ZXAA 3MPGA 3WF3A 4ZB5A 2FJKA 2R91A 2PP1A 3VCRA 3HQ1A 3BH4A 3B3DA 3MMCA 1N2VA 5F2IA 4LSBA 4W86A 1JYNA 4C6KA 2BOEX 4M80A 4ASTA 3O15A 1TPEA 5AHEA 3J7HA 1F8IA 3EWZA 3N9RA 1ZLPA 3CK5A 3CUIA 5HWJA 1EB3A 3Q67A 4F79A 1Z7AA 2CLHA 4O0QA 2CKSA 2I1OA 1XLFA 5I03A 4UNKA 2HCVA 4WY0A 3GR8A 2PLCA 2VZVA 3CIWA 2ALRA 4HA0A 1DHPA 1JCXA 5LIUX 3GEOA 1PCKA 3TQPA 1WUEA 1DE6A 3HQOA 3S47A 3MP3A 4XV0A 4R27A 2O0TA 4ZTYA 3S46A 4JTJA 1HQTA 2BDQA 2PLKA 2XFYA 4Q3MA 4O1DA 3SQMA 1BG4A 2ZUTA 1VGAA 3LA4A 3L68A 3PC0A 4CD6A 3GG0A 1PHWA 1UD6A 1FFQA 1POJA 4QJ4B 1TMLA 4PUNA 3C52A 3LNMA 3EDKA 1KR1A 2FVKA 1YW1A 4C6FA 4D2JA 1XISA 4E2OA 1EF2A 1DJNA 1K9DA 3KHDA 3O6CA 1GT8A 3DHUA 1KLZA 4F0SA 4OT7A 1IT8A 4D6IA 1LZOA 1DXIA 4FNRA 3KDNA 4MZ8A 5AY7A 4W7UA 2O4MA 3KP0A 1Z42A 4FO4A 1X97A 1QMLA 2YR1A 3VABA 1E5NA 1XX1A 2QXWA 3WLIA 4O1AA 2NWRA 5H91A 6PTDA 3DIPA 3T0TA 1S2TA 2IQDA 3M0XA 1L8NA 4LUJA 3GBDA 4G7FA 4IWWA 1GQJA 2GUUA 2PRMA 3CAVA 1GEQA 3AMDA 1S2CA 4GGBA 4RDVA 4RE2A 5AC8A 3GNXA 1O12A 4LUTB 4XTDA 1BF6A 4H8HA 5F4SA 2PU0A 1H41A 1RVGA 1V8EA 5T26A 1MEWA 3N2BA 2CXEA 2ZZ4A 2ISWA 2DH3A 3UY8A 1HL9A 3LYEA 3ARSA 1P5BA 1S5NA 4JX6A 3VE9A 1VCVA 2ZOXA 1LL4A 1WYIA 4C6CA 4GYPC 3P5ZA 4UR9A 1TELA 3HMCA 5AHIA 1KM2A 1XG3A 4JOMA 4DO7A 1W2PA 1D7FA 1A80A 4NG3A 1H60A 2BVDA 3OYXA 5I3KA 3TZFA 1V51A 1KWKA 1SZGA 1UD5A 4D8ZA 5FJTA 3W38A 3QTGA 3COTA 4EE9A 4MZYA 2J75A 1H1YA 4LF2A 3PZQA 2QV5A 2VWTA 1WXYA 1JI1A 1KCKA 1VHCA 2Y61A 4HYRA 1LP6A 3IJLA 2DQXA 3LXAA 4BHYA 4XSLA 2V3DA 2HRWA 1VPYA 3L4VA 1J2BA 4WXZA 3LHUA 3TLQA 2CNCA 1SO4A 3ITGA 2DSUA 3P82A 3PJTA 1ZJ9A 4Z1DA 2FZBA 2QIWA 1DXFA 1DIEA 4L64A 4LF1A 1XSKA 1K77A 1TPC1 3L0GA 1EWEA 1VIZA 4ZQCA 1FWAC 2GVLA 2VRKA 4P8UA 4C6EA 1VFTA 3ZJKA 5FIPA 3C2OA 2WCAA 3HA1A 2VGIA 4JTIA 4IL2A 1HKKA 1U1HA 2C1IA 1DIOA 4OBSA 3E2QA 1T8QA 1QI4A 3CAWA 5A6MA 2I9UA 3PFMA 2BVTA 2E8YA 1ZJBA 1UMYA 5D33A 5I77A 3ATYA 1QHZA 2FZDA 4IQLA 2Q71A 4KIRA 3ZJ7A 3VFLA 2P0IA 3BMWA 3WF2A 5H8UA 5EB8A 3MDWA 4UBPC 3MU7A 1XDJA 1PTGA 5IXEA 1EGZA 3NDYA 4BF9A 4IF2A 1LRTA 4MWAC 4C90A 3BMVA 4CQ9A 1BXBA 1XHGA 4M7SA 4JFSA 1KXVA 1V6TA 4IX2A 1OX4B 4YWIA 3C2RA 3E2RA 4PR4A 5F7UA 3IUHA 2QDDA 4ATLA 4AF0B 4DYJA 4F66A 4A3QA 2W91A 3E3HA 2G97A 1WA3A 3HFTA 2JIWA 4L9YA 3L5MA 3TTYA 4TVDA 3EB4A 3USZA 1GGOA 3WIJA 3SGGA 4C6OA 3OQ8A 5AYBA 1HKMA 2A5HA 3WLOA 4GZ7A 3VGDA 3EWYA 2QCMA 4M56A 2YCLB 1PYMA 3T78A 3NOYA 3EOSA 3DFNA 4E2BA 2E1DA 1JXKA 2QUNA 1G4PA 2W9MA 3S3GA 4XK2A 1BAGA 1VB9A 2NVCA 4MLJA 4CU8A 3RCNA 3AZRA 3WH5A 2IXVA 3T0BA 1K3UA 4RDZA 3LV5A 3DGBA 3EKGA 5I07A 1BQGA 1K7XA 4GIYA 4DELA 4UQAA 1HX0A 5HPCA 4QM1A 5M3WA 2YXXA 3K13A 3PPCA 1EIBA 4F0RA 2WOQA 4RZ6A 4IGNA 3WD3A 3B4YA 3C2VA 3V0SA 3E74A 4ICNA 3L23A 2C1HA 3QXBA 3W7NA 4AG0A 2G5WA 1GCYA 3VZYA 3V1PA 3W00A 1TCDA 2E6YA 3C2FA 3W72A 4FAMA 3ARVA 4RV3A 2J4GA 4NZCA 3ITCA 3QY7A 5D9PA 3VIHA 3HPSA 1RHCA 2F61A 1DBTA 1D7KA 4JEJA 2YCKX 2B81A 1ONRA 2OLSA 4Z08A 1J2WA 3WQCA 1Q6LA 1WAWA 1E43A 1Q6GA 2EKCA 4HTBA 3W1AA 3W7IA 2CWNA 4UQCA 5AVNA 4IICA 2J7CA 3AI0A 1VFLA 2ONEA 3RJYA 1VHNA 2YBUA 3E38A 1DWGM 2JKAA 3WDRA 1JQVA 5M5DA 4EF9A 3NXLA 1XIDA 1KGUA 3HJZA 1FWGC 2ZIDA 1DWFM 3WBWA 4EK7A 3UR2A 1F7BA 1SMAA 1BXNA 3P14A 1C29A 1VEPA 4NXKA 3VCCA 1WE5A 3GIYA 1GZ1A 2XGZA 3HZ3A 5FAJA 2PWVA 3F7JA 1LUCB 4YS1A 3UPBA 2OG9A 2YFNA 4KFPA 4RL3A 3LRMA 3UZ5A 1EHAA 4W8AA 3CZEA 2PTYA 4GY7A 3EXTA 3E0FA 4ZQRA 4CN1A 5AHMA 4P61A 4KS0A 2TAAA 3G6MA 1H62A 5EBUA 3IRSA 4E4UA 1KFBA 3IS4A 3WDQA 3SJ3A 3VD7A 2QNEA 3N12A 2IPGA 3G3MA 3SSZA 3SUUA 1V79A 1FP8A 4XKYA 2C16A 1MRQA 2DUZA 3QGVA 3M5VA 1FWWA 2MANA 2EF9A 4JIPA 4ZO7A 2ZC8A 3UA3A 4ICCX 3TJLA 4H6KA 1VD6A 5REQA 3KWSA 4AZCA 3REQB 4M5PA 1D3CA 3WMLA 1OBAA 4P8VA 3VPLA 3GY1A 3VKAA 1XLIA 2G3JA 4OWGA 3LN3A 2DUAA 2PBGA 4IUOA 3II1A 4IJRA 5J5RA 1KC7A 1JEZA 1EJTC 4IGSA 3A13A 4H9TA 3R89A 1QNVA 1UKSA 1KM5A 1YYAA 1W8SA 1HF6A 2W6RA 3C56A 4GYFA 2ZUMA 4YTUA 4JD4A 4QHRA 1UW9A 4PE8A 1WX0A 3GG7A 3ZOAA 3ARUA 3FVMA 2XFRA 4E8GA 2ZRVA 2HTMA 4AIBA 4Z0JA 3RO8A 2AMGA 3VZXA 2GJXB 1DQWA 5BOOA 3C4UA 1C8VA 4O1CA 3KS5A 1XGDA 4LBUA 2V3EA 1WUFA 1Q6CA 3O8AA 3STPA 3GO2A 8A3HA 1EL3A 3CL6A 3BOFA 3GHSA 1HG3A 4HMCA 3M07A 3HPZA 3UXAA 2E67A 2Q09A 5GEPA 1WO2A 5HMSA 4QJ5B 2E9LA 1CCWB 1I9CB 2WHKA 1UQZA 3MM8A 3SCVA 4Q8NA 3TMLA 2P76A 3W1TA 1HL8A 1PKNA 3PZVA 4XZHA 2RAGA 1MDLA 3W1RA 4GUJA 3LPOA 3S2NA 1J5SA 3A3HA 1BXCA 1QASA 4JX4A 2VENA 3PBWA 3EXSA 4R34A 5T9BG 4K7VA 1I6NA 3S1WA 1E56A 4LUSA 3OG2A 4N7QA 4MNMA 1CW2A 1XYAA 4MY1A 1KKOA 3BQ6A 1CXKA 5KZMA 4GH1A 1I2PA 1MVYA 3QZ6A 2G4FA 4MY9A 4V33A 1XIIA 4YTTA 1ZJAA 3K2GA 1PUDA 4WKAA 2WQPA 1GYNA 4OTKA 3WMSA 4HYVA 2VRJA 3DECA 2Z1VA 1KRBC 2PWEA 3UG5A 4NRRA 2ISDA 3W53A 1JYVA 1F4HA 2QPSA 5E9AA 3M7WA 4DX3A 1R87A 2IXUA 3JR2A 1KFLA 3BOLA 4V28A 3ARXA 4HYWA 2PTWA 2E9MA 1PXGA 3W1NA 3P84A 4EP8C 1BFNA 2X41A 4CNPA 5LXXA 1FHVA 1ONEA 2PDCA 4LEFA 1NQKA 2E77A 1EYWA 5DQPA 3NQ6A 4HMDA 2YBVA 2QCCA 4JIHA 1V5XA 3D3AA 3NZQA 4XZNX 1UKQA 5AYXA 4C91A 3QR0A 3MM5B 2P5NA 4Z42C 4YVVA 1TV4A 4IQJA 2VL4A 4CD8A 3BCDA 3VKSA 4UOZA 4RX0A 3RF9A 4NU7A 4J3ZA 3L4WA 3MMTA 1XV8A 4MPQA 2OVLA 3P62A 3VO0A 5J8LA 3W25A 3PZIA 3T9PA 1XLDA 3S1GA 3W07A 2O4QA 5CPQA 2WV8A 3FLUA 4FNPA 5FF2A 3GC4A 1ISVA 1IIGA 4HU8A 3CPUA 1O5XA 4K3ZA 3CHFA 1EJXC 2I5IA 3SBFA 4WKHA 1ZGDA 3V5FA 3OGVA 3EB3A 1W1IE 2ISFA 3LCHA 5JVLA 1B3ZA 4JTRA 2GK1B 3VNDA 4BWLC 1QPOA 1XICA 2PMQA 1YXDA 3W24A 5I0DA 5K4ZA 1E1CB 2DSKA 1X8CA 2X40A 3MM6B 2ZX8A 3BQ5A 4LYKA 1FWFC 2ZWZA 3VGFA 1CLVA 1YDNA 3VKBA 1XC4A 1JNDA 2EXOA 2PDJA 3LCLA 3E0WA 1KTNA 3ZM8A 4EACA 2GDQA 2PDWA 1Z9AA 1W6TA 4WSJA 1KQYA 3GX9A 1RALA 3B40A 3IGSA 4N2YA 2J8TA 4CKQA 3H7VA 3QR3A 3R2GA 4OBTA 1XL9A 2GVEA 4F0KA 2W0UA 2YKKA 4WOZA 3MCOA 3DI0A 1AQHA 5C6MA 2AQOA 3TTSA 4RNJA 3ZR5A 2INEA 4C1LA 3WF0A 1HKWA 4UTFA 3L5AA 4K1WA 4AVNA 2W61A 1HFBA 3S9ZA 3U2CA 5FEZA 2WLYA 3S2LA 1PVNA 4DLMA 2Z28A 3HG5A 1FCVA 1UOKA 2AAMA 2E5BA 4QLLA 2GGEA 3IUIA 3CTLA 1A53A 1Z69A 3UA4A 3EOOA 4IPJA 4CN4A 1GJPA 3WLLA 4PL1A 1KXQA 2DSWA 4S39A 4LV9A 1TJRA 4ILSA 3A4WA 3IIXA 1H7WA 1LCOA 1WDPA 3NQBA 1S3TC 3THCA 4PULA 1UWTA 3GNNA 2V4JA 8TIMA 1XI3A 3ELFA 5H8MA 4PUEA 1R2TA 4K6AA 5FJIA 3WMBA 4F9JA 3W7CA 3MSRA 6A3HA 4IMEA 2I17A 1MZHA 1YXCA 2XVLA 1NWUA 2C13A 3EPNA 2JKPA 3EWWA 4LALA 1FWJC 2HK1A 2PP0A 1TX2A 3CO4A 2PDBA 3UFYA 1HKJA 3B06A 4RNIA 3FDKA 3URQA 1FY6A 4NJIA 3VIMA 2ZWYA 1XLAA 5E6ZA 2WMFA 4LU0A 3HGJA 3RM8A 4DO6A 4GC4A 5K4XA 3B0NA 3CWNA 4ZOAA 3RLUA 1SZFA 4L9ZA 1R8LA 4IJCA 2OO6A 2P3EA 4YTQA 3K46A 3KE0A 3HQPA 2F8QA 3T0DA 1VFFA 2DZWA 3HF3A 3H21A 2WCSA 4H83A 3PBVA 4N0RA 4OZOA 2VX5A 1J93A 1HKIA 3R12A 4FNTA 2GOKA 4MYAA 3N1AA 3MT1A 2Y1HA 5EU9A 5EMMA 4NJJA 4NXSA 4JIQA 4S3DA 3WMCA 3TAOA 3ZWSA 4EWJA 3TAKA 3DBPA 2UY2A 3K1GA 1LYXA 1DPMA 4DF2A 3R6IA 3MHUA 1ZY9A 4JGDA 2DT0A 3W82A 4WKFA 1X39A 2VFFA 3AMLA 3GKAA 3BC9A 3M0JA 5TBOA 4AZGA 2OCZA 2OYLA 1UUMA 1LOSA 3R0UA 3DG3A 3B4UA 1ONXA 5DLCA 3QM3A 1ME8A 1UC5A 2WSQA 3FK4A 4GX8A 3WH7A 4Q8PA 2ZRYA 1AMYA 3PPGA 3TROA 3UNTA 2Y5EA 3CJPA 2X09A 1LQAA 4RPQA 4Y2WA 5G1TA 3G18A 1TWZA 1JF5A 3ONCA 4B5SA 4H00A 1PAMA 4UTMA 1M5WA 1J96A 2BY3A 2OEKA 1OG0A 4ZE4A 1AL7A 4QQ3A 1AW2A 4AC1X 3ITLA 4M19A 4OUIA 3OLDA 1UD2A 1S2AA 4NP7A 1AL8A 1NELA 3AICA 2X05A 3GIPA 4M6QA 4HIBA 4FOJA 1W9BM 2D3NA 3CQIA 2BX7A 5BMWA 4XVDA 5XINA 4KRZA 4FP1A 5AC5A 3VNKA 3L65A 1BRLB 3LMZA 1O5KA 2FPYA 3U7VA 7ENLA 1BLIA 2R9RA 3M0ZA 3W73A 3M46A 4U3CA 3DYOA 1S39A 1R9YA 4EXAA 3T44A 1HKVA 3H7RA 5I09A 2WHJA 4QG8A 3PR2A 4GZEA 4JTGA 2V63A 1QBAA 4DWSC 2G4JA 3SR7A 1Q4NX 3PWGA 3GK0A 3WSUA 2VZOA 4GEPA 4LC8A 5G4HC 2WC4A 1RD5A 5C9ZA 1YADA 2AGKA 3B0YA 2ZZ2A 4NY2A 4RW3A 4IXHA 4OV4A 4MJZA 5JMUA 4LAKA 4EIVA 4N4QA 1A3WA 4JQ2A 1E3ZA 3ANVA 3WQWA 4PUDA 4NF7A 2FFIA 2C91A 4DPPA 2B7NA 1EJVC 2I5QA 2VKZG 5AB3A 2XJ7A 3MDUA 3MUIA 4XAYA 3FFSA 1BKSA 3DKLA 2ACRA 3GHRA 1LWJA 3V36A 3BSGA 2QYGA 1A0CA 2HVNA 4ZE5A 3NQ8A 3PTKA 2PWUA 3ZT5A 2D23A 3GXTA 2XIMA 4AOPA 3UG3A 4QNWA 1L0PA 1Z89A 2YL8A 4DYEA 3N6JA 1MW3A 2YDRA 4PYSA 4LAMA 4DYKA 2EKGA 4Z1AA 1K8CA 3Q94A 4Q33A 2B7QA 1GVYA 1NDYA 2XSAA 3EWUA 2X0HA 1A5MC 2QAFA 4I7VA 3AMKA 3NG3A 1F05A 4J3XA 2J79A 3G1XA 1E9LA 3TWAA 1JZ8A 4IL0A 1RZMA 4WRHA 4IG2B 3QBUA 5CJNA 4MLRA 2V69A 2RJHA 1Z6KA 3PANA 1VFSA 3H2NA 4V1YA 4P7OA 1GK8A 4LB3A 2HS6A 1S1PA 1AD4A 3TOYA 1EZWA 3LY0A 1NFPA 4LUTA 3HURA 3JS3A 1CPUA 4MB3A 2EG8A 3OQEA 1FTXA 3LCXA 1E1FA 3SADA 1R7OA 5AC6A 1V0MA 4GACA 1VENA 1MQPA 1BQCA 2ZVRA 1Q66A 5FJOA 1M1BA 4XZIA 5KTLA 4HNTA 5FF0A 1RSCA 4O0KA 1ZFJA 2P8CA 4XTIA 1DXEA 2XINA 4H6EA 3RO6A 1UIPA 1LG1A 4FSAA 1WCGA 4AD0A 1CBGA 4LANA 2DIEA 3QYSA 3B8DA 3WENA 3KVJA 3T8QA 2PDNA 1X8FA 3RLHA 3A22A 1ZB5A 3GUWA 1UUQA 1TQJA 1E40A 4IM4A 1RCXB 1YBQB 2NVAA 2ASHA 1G69A 3W2NA 1GKPA 3TW9A 4FLQA 5CPSA 3HV8A 2OMAA 1ZQ5A 5CSUA 1F3TA 1C90A 2EAWA 2IPWA 4S3CA 3NR0A 5DO8A 3PTMA 3M44A 2ACQA 3TQVA 1OFOA 4IH3A 3VC5A 3AQUA 4FPSA 4HPGA 1E72M 4TUFA 4GXMA 2BB0A 2CHRA 3C8FA 3BL3A 5C2CA 3EWDA 4HHMA 1S2WA 5LGXA 4FXFA 2FMOA 2ZA3A 3V0UA 3P60A 3QV9A 3T09A 5AKQA 2PGFA 1TTIA 4ATDA 4QISA 3NQGA 1S2VA 5CGTA 3IEBA 4DJDA 5CZTA 2NV2A 2E6AA 4HPHA 2WKLA 1M68A 4GA8A 3C0LA 4OIFA 1EOMA 3O1NA 4ONVA 3AC0A 1R2RA 4B4FA 3EX6A 3NA8A 4H8UA 3QMTA 1V93A 4M24A 1XLHA 2YXOA 3AIUA 3OTRA 5DCDA 4XIAA 3AXIA 4WCJA 2PDGA 1X1OA 3LX9A 3SUSA 4M3PA 3B0JA 2PD5A 3CL7A 3T6CA 4XO6A 1JFXA 4I7WA 4ORMA 3H6OA 3NQVA 1P7TB 3S2MA 1POKA 1B3OA 1E0VA 4M1BA 4D6GA 4HNVA 1PX4A 5A94A 4FS9A 4DN1A 1MSSA 3KBWA 1V4YA 2WNQA 4CVWA 2R14A 2NT1A 5L6UA 4MY8A 2BVWA 1KFKA 4PEEA 4HSOA 3RM9A 4V2XA 2ZBTA 3TYZA 1OX4A 1MQQA 1US0A 2PEVA 1WZMA 2ZXDA 5A6KA 3W27A 5H2ZA 5KMYA 5M2FX 2ZRWA 5LGZA 3GB6A 3PUDA 5BMXA 1H7RA 3R25A 4RCXA 4F8XA 3PF3A 1PX3A 3BLFA 1GYMA 3PB2A 4MNJA 1R3QA 4GVFA 3ZLHA 5AYIA 4LEQA 1J0YA 2E6FA 4BWLA 2GFTA 5CH9A 4DNHA 3PAOA 1CLKA 3VIKA 1ZJIA 2WBKA 2R82A 1ZBKA 1QWGA 3GC2A 1TJ2A 4REQB 3LD5A 2D0HA 2A2IA 3BAWA 3IWPA 5HWMA 2HEJA 1E51A 2GQ8A 3HB9A 4O17A 3VOGA 2PF0A 2WNNA 1E15A 2RDUA 3NQCA 4N9DA 3VGBA 1PZ3A 2HQAA 1Q6FA 1Q5MA 1B3YA 2GOUA 3CS2A 1TWSA 3KBSA 1XF0A 1GOOA 4AISA 3SECA 1W91A 3WJYA 1BWKA 1ZCCA 1EC8A 1IEVA 1V02A 1BKHA 3UR8A 5EA9A 5GJPA 1VBUA 2NQLA 3IJ6A 4JNZA 4MZ1A 4U2ZA 4DVOA 3ABXA 2J6VA 4PTXA 1JUKA 2VVSA 4JN7A 2XU2A 4JKLA 1BGAA 2YL6A 1GVSA 1TRDA 5JH2A 4NZJA 2IKGA 2FJUB 1HVXA 3K8MA 4HOWA 1IR2A 2HE5A 2VR5A 3GUGA 1ISYA 1JCYA 2WZEA 3GYEA 3VYLA 3KWXA 3KXQA 4AC7C 3PZTA 1Q6EA 2ZX9A 3C2YA 1E6ZA 1TPFA 4TX9A 3KOFA 3UG4A 2E8ZA 4S2BA 1V3HA 4C1KA 2OKOA 5HANA 1E0WA 2FVLA 5CC3A 1QT1A 3SN1A 4HNOA 1BG9A 4KCVA 2OU4A 1E1EA 3F4DA 1JCNA 4C6IA 3R5EA 3OR2A 2WSYA 1LUCA 1WPCA 3MM7A 1R3RA 3QSTA 2OYKA 1E4IA 3N4EA 5AOUA 1MFVA 4WGXA 2GGJA 2WWDA 2E40A 2OKTA 2FYMA 1PZ1A 4OECA 4C7FA 3CEUA 3NL5A 4TOQA 2DVTA 5D9NA 1XIHA 1W3JA 3SRFA 1JRCA 1M04A 1LOQA 4C6PA 1SSDA 2R6OA 1Q8JA 2NXIA 4XISA 1HVQA 3SW6A 2FGBA 1MQRA 1W5NA 3AFBA 3F4WA 3UD6A 5CZSA 3ZQ9A 3W81A 4DF1A 3WG6A 4DZHA 1HIZA 2WW5A 2ZZ6A 2E68A 2POTA 3SFKA 3FXGA 4BF7A 2HPMA 4AIUA 2FKPA 2PTDA 2GJNA 1KM4A 3FYOA 4EX4A 1W3HA 1JZ5A 2C18A 2Y8KA 5E5CA 2NW0A 1ZHAA 1E55A 5A1AA 1JG9A 3BZJA 4GISA 4NZ5A 4O1FA 4O16A 2XSXA 3O7UA 2VD8A 3IANA 3WBYA 1O95A 1WBJA 2O7QA 3PBYA 4QITA 3WLHA 3WK3A 1XBZA 3TX9A 3W76A 5FF7A 3B0LA 3LQLA 1W5QA 4GUIA 3VVGA 5GQBA 4QG9A 2WCGA 2OYMA 3AOPA 4O19A 3A3WA 3P61A 3SZ8A 4BI5A 3EX2A 3H2CA 4WQ6A 3AALA 1IEXA 3MMCB 5LHFA 4FNSA 1GORA 3WLQA 2YA2A 1JCTA 3A64A 3QY8A 3CQ0A 4NVTA 5J04A 3BV7A 3O9NA 4DBWA 3V7PA 1YE6A 3FKRA 4D71A 4N02A 1F6YA 3ITXA 5HWNA 3B0VC 5CC6A 1R3TA 4X22A 3ABRA 3LXBA 3S6TA 5D2TA 4M0XA 5LNUA 1C91A 4KPLA 1M01A 4GH3A 3F2CA 2ZA1A 3BZGA 4WY0B 2WKGA 3T05A 1QXLA 4ZODA 2F7FA 1R3SA 1R38A 1TCMA 1RV8A 4NZ4A 4EXBA 3N2TA 1U1UA 3RITA 2CW6A 1W5PA 4R3UA 1M53A 7TAAA 1Q85A 1RCQA 3GVVA 1QW8A 4L7ZA 5G5IA 3MMAA 3RCMA 3WK2A 3C3NA 4HSNA 1F6PA 2EG7A 3TTEA 2CBJA 1MYRA 1EFZA 5DRCA 2VOTA 1RLCL 1BSIA 4UQ9A 4ZO8A 3DG7A 5D8WA 4GO9A 4GZIA 3EOLA 1KM6A 1XIGA 4M81A 1ZTVA 2XSBA 1YPIA 4DWSA 4TTUA 1UQYA 4QLKA 4PUWA 2GLKA 4J3WA 4DB7A 2Y2WA 2VC5A 4HHLA 3VM0A 1K1DA 5HA7A 3L12A 3GWQA 1JYXA 4EPDC 3ZXWA 4V27A 2EPNA 1FWSA 3POCA 4D1JA 4Y96A 3I7RA 5BRPA 1JJKA 3T2OA 1LDCA 1NARA 2AOSA 1VFMA 1NF0A 3CT2A 4RDWA 4AZ5A 1DV7A 1SUXA 4JX5A 1XRFA 2WB5A 3S2CA 3SUTA 3AMGA 3ZT6A 2EPHA 1GHSA 2ZXQA 1P0NA 4XD3A 1G7VA 4IUGA 2OWWA 1L2QA 4WUIA 1VIWA 4GY0A 3A5VA 2OFJA 3A9BA 2AL1A 5A3HA 3M5XA 1T41A 3PJWA 5CCZA 3WQ5A 1WDWA 4JTHA 4UNLA 1W3KA 3CLWA 3W85A 2BHZA 4WJ8A 1JGIA 3QPZA 3WUFA 4P5UA 4CU6A 3WBEA 2NUWA 2B0MA 4XUYA 3EDEA 1EWDA 1TUXA 3RCYA 5A6JA 2NLIA 5C5YA 4JEQA 4AZHA 4IPNB 2YGYA 2J7HA 2C8NA 3QSRA 3GKFA 4BI6A 3H26A 3S0CA 3VOJA 3R0KA 2HVOA 1VBHA 1KLYA 1L8PA 2GWNA 3UW6A 4L9XA 4N6EA 3BARA 1S5MA 1NJJA 3M7SA 1U2YA 4QAIA 4Q7BA 5T91A 3MM6A 4WF7A 2BODX 4DJED 4AWEA 3LK6A 4PBFA 2DVXA 3A9IA 3ARZA 4UOQA 1QNRA 3U7BA 5GVJA 1PWMA 3RJXA 4YHGA 2JALA 4HK7A 4HU0A 3APGA 3LI0A 4OJYA 2JKEA 5F1VA 2D3LA 1LLOA 3GNDA 3MUCA 1BTMA 3M0LA 2FHBA 3I4EA 2A3EA 3IIZA 1GQLA 1U1JA 1C3FA 1MW2A 5I7GA 1W5OA 3QEZA 2OSXA 4CCCA 3BG3A 3H7UA 1HNYA 2VDHA 3K8LA 4LRSA 5LA0A 4AU0A 1J12A 2WSPA 1A47A 4AHPA 3N18A 5C71A 4ZB0A 2VT0A 2WO5A 3O6AA 3NM3A 4UTHA 2WVVB 5CG7A 1LOLA 5C2GA 2CHOA 2J77A 2Y6ZA 4YTRA 1B57A 4JTLA 1E3XA 3BO9A 1BSLA 1JPIA 3H4GA 4K36A 1QATA 1U5HA 4U3AA 3CC1A 4DXXA 3G0SA 1R3YA 4XUGA 2X1UA 2OZ0A 1MUMA 5CPTA 4JPGA 4UNIA 3E02A 1BWLA 2INFA 1XPGA 3THDA 2R94A 1NAL1 4NAEA 4A8LA 3VKDA 4US5D 2F6KA 2AOPA 5ABEA 3TW6A 3GDRA 3BAXA 2IMRA 4C6LA 1MEHA 2GVYA 1OF6A 3TR2A 4NQ1A 1ODZA 4PCSA 1R30A 1XQLA 3LCGA 1C9DA 3EDJA 4K2SA 3RMEA 3O0FA 1ML1A 4GI6A 4MKNA 1SO6A 4G2DA 1GVFA 5HJLA 3TJ4A 3GTXA 2QUUA 4JYEA 4X3ZA 4R88A 2X1RA 1TVPA 4Q22A 4TX8A 2BMBA 3WNLA 2R1MA 3V18A 4YHEA 2QKFA 5AOPA 4ZBCA 3VMNA 3W74A 1TJ0A 3VGGA 3BV4A 4XBJA 1ZPTA 3RUBL 4KKXA 2OXNA 1JD9A 1JULA 2F9RA 3FXYA 2WZIA 4UMCA 3MJYA 3DYMA 1LL7A 5D32A 3RN6A 1KCXA 1XSJA 1G4SA 4RZBA 2YLAA 4MWAE 4Q7NA 4XZLX 3ARWA 4ACYA 1QHPA 4ZEPA 4JDYA 2OGYA 3N29A 4PUUA 1FDZA 3SAZA 2QUMA 4B5VA 1P6WA 1ESWA 4HKPA 4PODA 1ZS2A 4PBGA 4GK8A 1FWHC 3E1F1 2WQDA 1I2NA 3MV11 6TIMA 3W7DA 1SW7A 3STGA 1P6BA 4MHBA 1A5CA 1A5AA 2QF7A 1OCQA 1WDDA 3BWWA 1CB7B 2KAUC 3I7QA 3S42A 3W7KA 3S1UA 1W31A 5FF4A 3GH4A 3MVIA 1F3WA 4AYGA 1BVNP 3NQDA 3E6EA 1LBLA 1KRAC 5I00A 2C1GA 1FQ0A 3U2EA 2Z1BA 3VAVA 3DHDA 1GG0A 3B03A 4G5DA 3G1HA 4PMJA 7ODCA 1OINA 1WKYA 1MW0A 5I3JA 1PIIA 4GYKA 3MMBA 3CLMA 1B2YA 3MKVA 3W23A 4LH8A 1VS1A 4NI8A 3KCOA 5A2BA 2FLIA 1JF6A 2WC7A 3TYEA 5BRQA 3IAQA 4N4PA 1DEDA 3M0HA 3FKKA 3TYDA 3WF1A 4OVXA 4G1KA 2DPEA 3O3RA 3WLSA 2QJJA 1ZP4A 1Q6DA 4L56A 2ZUUA 3UCCA 1ICQA 3W88A 3AYSA 4XVEA 1OFAA 4IP7A 3AZSA 1TA3A 3W2JA 3WJWA 4MPKA 3MUY1 1OZMA 3PZMA 2V5DA 5EGRA 3UQNA 5DY3A 4ENLA 1HJSA 4LVBA 4JQ1A 2YYUA 4YN5A 2C14A 5A8OA 2YCJA 3D3FA 3AISA 3WK1A 1V6UA 1BVWA 1VRXA 2XZ7A 2QIIA 8XIMA 1V3LA 1EEXA 4FZIA 3U4FA 1EEPA 2CPUA 2VC7A 2HDJA 3A4XA 1K9FA 4H19A 5HOSA 2DIKA 1H63A 4XKYB 4YXGA 3W4RA 3WNOA 3VKQA 4GNVA 3B8WA 3MHGA 4HHPA 2OSYA 3RDKA 3F4NA 5REQB 4RPPA 1B3VA 2QDGA 1VCFA 2A4AA 1FKWA 4HU3A 3ZVIA 4GIEA 2VC6A 4H8NA 3LNPA 1B54A 1LBMA 1FWCC 3GTHA 4FK9A 1W5MA 1AD1A 4Z1BA 3C2EA 3A5FA 3OZYA 2QW5A 4ECLA 3MI6A 5CPOA 3CV1A 3D47A 3CZJA 3WH6A 1KKRA 5IFTA 1PJ9A 4X9YA 4L4LA 3O07A 1I8JA 1I2OA 1O4UA 1KNWA 3RU8X 2IQ0A 4UFMA 4C6QA 2VZUA 3GU1A 2VEMA 4ATWA 2JK2A 3N4FA 3HQNA 5HR6A 1JDEA 3Q4DA 4B2DA 3RPDA 1RY8A 4EAMA 1J0JA 4PMDA 1MW1A 1VBJA 2ZX5A 2XFWA 4I8YA 2XIJA 1QOPA 3CHDA 3KOXA 2J25A 1IEWA 3LGGA 1X7IA 1JGMA 1GKRA 1LQ0A 3B0MA 4UTLA 5HQLA 1UWSA 3U9IA 3EYPA 3L4ZA 4Q6XA 4JHMA 2OTDA 3PBUA 3G8RA 3OZPA 3W3OA 2PDHA 4GFIA 2W67A 3WLTA 4QGCA 3MM8B 5A8PA 1UP2A 5HPOA 4C5YA 4DF0A 2VEGA 1HP5A 5BU9A 5C9WA 1GJWA 3WL1A 4KBXA 4A3HA 2ZFAA 2WJZA 4PFHA 3VIIA 1HL2A 4AIOA 1X38A 2Y70A 1HXJA 5HJXA 4HOZA 3WY1A 3BG5A 1DJHA 1ZBVA 1MXDA 4LUSB 1ADSA 3CQKA 4IIHA 2HNHA 2WVUA 1AH4A 4IFRA 3VLYA 2VZSA 5D09A 5C8BB 5C9UA 4KT2A 4KWUA 3VMPA 1H50A 1LLZA 4JIRA 1Z8AA 1XKYA 2P3ZA 1O60A 4FLOA 5JXQA 3UPWA 1TPDA 2X42A 3EOUA 3NL3A 4RE0A 5C2XA 2YB4A 3KBNA 1A5SA 1L6GA 1CGTA 1O94A 1XJBA 2WMJA 4ERAA 4QJ3B 4WGHA 3PVFA 4JHOA 4XQ6A 1QI3A 2QAPA 1OD8A 4HMEA 2EPOA 2ZUVA 2NX3A 1YBQA 3SY5A 1E4MM 2NX1A 3RXZA 2BASA 4XZ9A 3KZSA 5T9CE 1QDSA 3UVIA 3A4JA 4CNUA 4RR4A 1V0NA 1CXEA 3APTA 3L4UA 1IQ8A 4GIRA 5AHFA 4A21A 2Y62A 5EMKA 3E49A 3I6RA 7TIMA 3P0XA 4F0MA 4GJ1A 4W8BA 3GAKA 2VFEA 2CLPA 4W93A 5C54A 4AB4A 1QI0A 4Y6GA 4UFJA 5AYZA 4TR9A 1W54A 4DY1A 3SY1A 4HPJA 3N17A 3SCNA 2OOGA 3EMQA 2FZNA 1NOWA 1QPNA 4DJDD 1W3NA 2GDVA 5I24A 3T0AA 3CASA 3RX3A 1E6QM 3WK0A 3STCA 4LTSA 2VX7A 3VD5A 3MZ2A 3B0PA 1P7TA 4A6GA 4CEXC 1IT0A 3GZ3A 2CKRA 1GVQA 1EJUC 4O1EA 1RBAA 2E5CA 2RGMA 4O8RA 3RILA 2V5JA 1JCMP 2CZDA 4I9TA 4X60A 3WEOA 1TVLA 1EGVA 4HU4A 4ZQPA 4C6NA 4ZSUA 4IX0A 3NZRA 2BFGA 3MI3A 4U4MA 1F2JA 5KEZA 5IHRA 1YDVA 3BAJA 5HNNA 4H7CA 5B7ZA 1RLDA 4H9ZA 5B80A 1TZZA 2QT3A 5IBXC 1H0GA 4XSMA 3NPWA 2CZFA 3V0TA 2DZVA 2OSWA 5LIYX 1ZBCA 1WKDA 1EP3A 3EMCA 4IFOA 2VEIA 4JTEA 4JTDA 1IXPA 1EDTA 2R1LA 5TD4A 2C0HA 3JU2A 3UERA 3POHA 2CWXA 4UQBA 4BKNA 1LROA 5BXPA 1PBGA 3ITTA 3TC3A 4Z1CA 5E09A 4AD1A 3A24A 2RFGA 2YOCA 4H9VA 4ADTA 4JNYA 1EQCA 2EPMX 1EO7A 5CBJA 3SRHA 5A69A 4C6JA 4UMAA 1CEOA 1SFSA 2V4JB 3KRUA 5D2XA 4HVXA 3FNDA 4B91A 3GFZA 4HQVA 2J7BA 4GQQA 5K9XA 1V02E 4R5EA 1AH0A 5I06A 4NZ3A 4AD5A 2VX6A 2P53A 1W8GA 1DTNA 3SCWA 2CFFA 1J6OA 2BXYA 2HNEA 2NUYA 4HCLA 4WY0F 1EJSC 5G2IA 1UH2A 1XM3A 2H8XA 3AMCA 3HGOA 1D3GA 3I65A 3S9YA 5CZJA 2VURA 3WQ8A 4HZ8A 2ON3A 2OQLA 4DM1A 4GI4A 1E0XA 3NAVA 2IKJA 3GR4A 4MG4A 3DUGA 4M6VA 1RY0A 4MWAB 2XHYA 4LCQA 2VDIA 1ZUAX 4LQ1A 5HNTA 2Y63A 2JGQA 5I3HA 3SO7A 1KQZA 4GRSA 2H9AA 2NT0A 4DJFD 2PLJA 1GEHA 2BG5A 1TPVA 1GNXA 4A8NA 4Q7IA 4G38A 5ABTA 1XFBA 1AG1O 3OVRA 2HBXA 3GE7A 5HQEA 4CD7A 4XAFA 3Q65A 2G3MA 3A4AA 4AYSA 4BY3A 1NH6A 2E6DA 1XP3A 1KFEA 2Y8VA 2Y8UA 1JPMA 4MSSA 1XUZA 1BPLB 2VEKA 1GG1A 4F9DA 4LAOA 3URNA 1CECA 1ZCOA 4XO7A 4H9UA 1TX0A 1KXTA 3I68A 4FMVA 2VOMA 2D2GA 2YLLA 1U83A 4NSBA 4JQ4A 1BVZA 4OGZA 1HJUA 1XLEA 4CQBA 2D2OA 2NQ9A 1ISXA 2A6NA 5XIAA 1OIFA 1XCXA 3L7RA 1XPYA 1REQA 1I0BA 1N82A 4TXEA 1B9ZA 1K9TA 4K8GA 1W1A1 4PSPA 3IIOA 1UA3A 4KH2A 4JFTA 5FSEC 3G3DA 5IFPA 2XSJA 3W71A 1DJGA 4YTSA 3HG3A 3NQ2A 1W1VA 4X0NA 2QMKA 1CZ1A 1ZBWA 2HROA 2FIQA 3LRKA 3NL2A 1H09A 1T5AA 4HD5A 4FNQA 1E6XM 1KBJA 1X1ZA 1Y5XA 2PWHA 1EOKA 3TFXA 3DFQA 4FXJA 3BJSA 3EX1A 3RNDA 3CHCA 1ITQA 2DZTA 4ZA0A 1J18A 3T7VA 3AXHA 3DERA 3LLFA 4I8DA 1VBRA 3CV7A 3R8GA 1UYQA 4HPNA 3TZNA 4S3FA 4ZQOA 2ATMA 4WJEA 3CUZA 4LYQA 3MM9A 3LPPA 5D4YA 4NT0A 2WMIA 4B5NA 1I60A 3C8NA 2P10A 4F40A 1UZ1A 4DUXA 3MKKA 2VMFA 4AWSA 3NO5A 3G2GA 2YDAA 3KP1A 4NILA 3EKZA 2PDMA 3LBCA 3SM0A 1OX6A 4IPLA 2Z7KA 4HTYA 2J27A 3WEMA 2QV4A 2OLHA 4FF5A 2G0WA 2V5KA 4PGLA 1ZP3A 1PKYA 3F5LA 2YX0A 2V8ZA 5TAOA 4Z2GA 3VIFA 3CXOA 2NX9A 1Z3NA 2BHUA 4GNKB 4UCFA 3UG8A 2WMGA 1BYAA 4I90A 4D1IA 1XIBA 1EPXA 4AEOA 1CTNA 4PFMA 1V3KA 3ATZA 2TODA 4H6RA 4PMYA 1JL8A 3MB9A 3U2ZA 3LU2A 2QEZA 2C79A 5AHNA 2XVGA 2OOFA 2FTWA 4NZFA 3UEQA 4EPEC 3VD4A 3YPIA 5GNXA 3AUJA 2HVMA 3G1SA 3UF9A 3CB8A 4UCGA 4OOUA 1QOXA 4GLEA 1OC6A 4Y8EA 4PTVA 2XPKA 3OR1A 5E70A 4RZ5A 5D03A 4ZCWA 2E7FA 3OIXA 3QHNA 1OX5A 3P3BA 2BVYA 3UZJA 3WNNA 1TPWA 1IGWA 3UBPC 3BANA 1WDQA 2HMCA 3KZPA 2A3BA 3T81A 4Y9AA 3W84A 1FXQA 2NXGA 5L9FA 1PIFA 2BGSA 4J4KA 4TMCA 1OY0A 4KF1A 1WDRA 2GYIA 4PMQA 4O11A 2G8ZA 4PUKA 4O15A 2O9OA 3HPAA 1OJXA 1XLCA 3BCJA 2GGGA 2A3LA 3NCOA 2BY2A 3L4TA 3QMSA 1B31A 3NDZA 3G1VA 4PUJA 1XH2A 3ENLA 2ICSA 3W1XA 3BURA 4ADUA 1VEOA 1XXXA 4FOKA 3ZZ1A 2E4TA 1DVJA 4AXKA 4CQ8A 3LOTA 4Q4SA 3ZSTA 4GG9A 2E1WA 1PB0A 2W5FA 3ME3A 4HSHA 1UP0A 3TN5A 4E5TA 1SW3A 4HT3A 3WD4A 1EJRC 4H3DA 3S4TA 4C7GA 3VD9A 1J10A 2VFIA 3H55A 4I5XA 4RKAA 4H6QA 4Q8UA 2XDFA 4RXFA 4W5UA 3GM8A 4PTWA 1A4LA 4JCLA 3PY2A 2QCDA 1H1NA 1ISWA 3I3BA 3SSJA 2OQYA 1GTEA 3ZJ8A 1Z48A 4JS3A 1HGYA 1Q7QA 1SFJA 1WDSA 3IJQA 3UWZA 2ZTKA 3TDFA 3PUOA 5FL1A 4I7UA 3QQWA 1UR4A 2ZE0A 4KWOA 4L1GA 3EB2A 4LVAA 1R85A 1SR0A 4ZO9A 2HISA 3VX1A 2YDQA 1CGXA 2ZTJA 2QCFA 4XAPA 3P80A 3QHMA 1ZRQA 4B9YA 3RLVA 1EA9C 1UD8A 1XBXA 4EVZA 2DZUA 4GX9A 5LNRA 1NDWA 3O6DA 3H53A 1KGXA 3VFCA 3L21A 3F4VA 4J9JA 3IV3A 1DJQA 4GGHA 4JR5A 2JEPA 2H8ZA 3GXNA 3GRIA 1G4TA 1SR9A 1W9PA 2AMXA 3FAWA 1T96A 3CIVA 2GSJA 3HG2A 1A5NC 4MKSA 3JUGA 3WKZA 1F8MA 5A8MA 1X6LA 4HA1A 1GVEA 4Q8TA 4URIA 2AQWA 2J88A 3WH8A 3TYUA 1F5ZA 1MI3A 4R53A 3GNPA 1TV5A 2SFPA 2WVVA 3CWOX 4WIWA 2NV9A 5LYRA 2EPKX 3H4WA 2INZA 1WKEA 1P0KA 1DJIA 4XB3A 1FXPA 4FR6A 3TE9A 3TC7A 4PMOA 3TK7A 3HFYA 2EJAA 3SCSA 2J9ZA 1CXFA 2VFHA 1A3HA 1YPXA 2WVTA 2OB3A 1UUOA 3UXKA 3VM1A 4FX6M 1SYTA 3M0VA 3MCMA 4O8AA 2GDUA 2Y24A 3ITOA 1K03A 2Q3RA 2X0YA 2XIOA 3EEZA 3ZMRA 3EWCA 4PSRA 2UWFA 2GEPA 4R7OA 3KM8A 2VXNA 3AS3A 3PB0A 3WNMA 3DHPA 3WQOA 5FCZA 5K9CA 3MANA 2A79A 5H1WA 4TO8A 5HULA 3WLKX 3DAQA 5BXRA 3WUEA 3EA1A 4UQEA 5SWUA 4LAUA 4GVGA 2QGHA 3VNLA 3URAA 5DBTA 2QUTA 1EHNA 1MO0A 3GSMA 2XVPA 2XIQA 2R1NA 2PSNA 4QR6A 4J2MA 4KIEA 3AYTA 3ID7A 2ISSA 2OO0A 5IDIA 4OQVA 1YNQA 3IVTA 3NXFA 3K4WA 3V5CA 4Q4MA 4AD3A 1CB2A 1OFDA 1AMKA 4MB5A 2YXGA 3FW6A 1TPUA 3U3HA 4IHCA 2X8RA 5IBXA 1K6AA 1XYMA 2Z26A 4EOUA 3LM3A 2HJPA 3QFEA 1KBBA 2GUBA 3UYIA 2BY1A 3VINA 4X2PA 3TKFA 4E8CA 3LBMA 3WQFA 5FOOA 2F2KA 5FI8A 4PCPA 2CHNA 3P67A 3C86A 1A5UA 1FX6A 5DELA 1RA0A 2YZ5A 4GINA 4WD0A 3WN6A 5PTDA 3GW0A 3R8HA 1KA9F 1CWYA 3M0MA 3O16A 1ME7A 4DWDA 2J7EA 1FWIC 3LCWA 4A22A 3CZLA 3S9IA 1T7LA 1P0EA 3DFSA 3IJ9A 4O4WA 5D2VA 1D2KA 4AEFA 2QCNA 5EY5A 4AHOA 4AMAA 1A4MA 1XWYA 5HNRA 1H7PA 1NWSA 5DXYA 1Q2SA 1A49A 1JIBA 2IKHA 2WPGA 3EXRA 2CEQA 3B9OA 3W70A 3OR2B 2E09A 1BD0A 2PWFA 3MM7B 3WDHA 3DXIA 4O57A 3MP5A 3KS6A 2WAGA 3CUHA 4E6MA 2BP1A 3MO7A 3M47A 4PZVA 1DOSA 1B5TA 3I6TA 3MWAA 2OZTA 3WQPA 3H4XA 2DIJA 5BROA 3SN4A 3LHYA 3S1VA 4QIUA 4JTFA 3GNRA 3FSTA 1EXPA 1B30A 3KBVA 5K2ZA 1WXJA 4QEEA 4N9CA 1WBHA 2PU1A 2Y85A 3EPOA 3E5BA 1WV2A 3FHQA 2GWGA 1JUEA 4FNUA 4KETA 3TIMA 5AC7A 1SO3A 2B31A 3DG6A 5CZ0A 3RPTA 4Y90A 3EZ4A 3LM7A 1ECQA 3ITVA 2W62A 5LNWA 2J66A 3AO0A 1TV7A 2QDEA 1OABA 3VK5A 5D2WA 3AHXA 2DORA 4QDPA 1H2JA 2QJGA 5AN7A 2DW6A 3GVRA 4ERGA 2V81A 1QFEA 3RG6A 4Q4PA 2GJPA 4J1OA 1PX8A 3FHAA 4AVFA 3VC6A 5FACA 1BF2A 5C7HA 1AW1A 4WR3A 3W29A 3OGSA 3IK4A 3XINA 2FTPA 4H4IA 4JAWA 1KV8A 1M65A 3CUGA 3AIQA 3C0QA 2EGZA 1TREA 2FB2A 4W7VA 1W1ZA 1XCFA 1PCWA 4PB4A 1UHVA 2Y5JA 2HK0A 4B16A 1XIEA 2DZBA 4PCTA 4RUBA 3U4AA 3STEA 2YB1A 3W2MA 4QP0A 1FH8A 3HJEA 2G3IA 4H41A 3OG3A 1VRDA 2XGIA 1G6CA 4W88A 3W75A 1Z44A 1KD0A 2F2HA 5HMEA 4H7VA 3TQ0A 3LTPA 5EMUA 4C1NA 3EOEA 5BWAA 3CTTA 4BQ4A 1KXHA 2DV0A 1TMQA 4INFA 1RQBA 1V6WA 1NDVA 2R1KA 3NURA 4UTKA 4U2YA 5GNZA 4BA0A 1G67A 4DBDA 4IMAA 3PSWA 2C7FA 2PGRA 2AQVA 2PCQA 3D46A 4U5KA 4Q8OA 3TSBA 3FOKA 1Q65A 3MMAB 4HA3A 4CNSA 1IXOA 1GQNA 2CLOA 2A7NA 4L5ZA 1GWJA 3KX6A 1F07A 3CPGA 1E5JA 3B9NA 3ZSSA 3WFZA 4QLJA 4IXXA 4YVPA 4LV4A 3R11A 5C9RA 4DHGA 1WNOA 1E6SM 3KLLA 4DWSB 2EBNA 4QE1A 3S5SA 4Y9MA 3DYPA 1BYBA 1GVOA 3GR7A 2WNWA 2C15A 4GZJA 2YA1A 4H7ZA 2P1FA 3PP7A 3PM6A 4KEVA 4LS1A 3ZR6A 3BVJA 1C7SA 5DRIA 4HNCA 2Y89A 1AK5A 2VTFA 2V3FA 1VFOA 4O18A 1UMLA 1YMYA 3B0HA 2Z7GA 1EH9A 2O56A 3CH9A 1AQFA 5CEWA 2QDHA 4E2DA 1LORA 1P0BA 4KMQA 1QW7A 2UY3A 5I79A 1EC9A 4PRRA 3AYRA 3MUAA 3IACA 1OSEA 4A8RA 2HWGA 3ZVHA 3LUTA 3G8EA 4UFLA 4E8DA 3ARRA 1TE1A 4IGHA 2I5GA 2VM8A 4ZO6A 2QJNA 3UESA 3VCNA 2FTYA 4LNCA 1XLJA 3FA3A 2OWXA 3WCZA 4UTTC 2Q8LA 3NPVA 4E38A 4DI8A 3W7PA 4IZGA 3LPGA 3AHTA 1JRBA 2ZZ3A 3W01A 3CV6A 2OWCA 1NP0A 1K8YA 4DIAA 2L5HA 2FB3A 3L0NA 4FR1A 3KTCA 3WNKA 5LIXX 1TJPA 1OFBA 4G8TA 1XH0A 5KINA 2ANUA 1H51A 4YL2A 2A21A 4RDYA 2JQXA 1GOKA 1M7XA 3NEHA 2GUYA 4LCRA 4Z2IA 4AFYA 3SIZA 3STFA 1A5KC 3SURA 2J74A 5FA5A 4XZWA 3M6YA 3GDBA 3V75A 1P1MA 1XQKA 2PDIA 3W7JA 4JY8A 2X1TA 1J0IA 4LPCA 2CIPA 1UWUA 1DHKA 1PS9A 3RRAA 1W9UA 3LCIA 5CBBA 4G56A 2HPIA 1E0TA 2O9PA 1OFQA 1ZAJA 1TSIA 1EZ2A 1XG4A 4FI4A 1RJPA 5CAHA 6XIMA 3QMRA 3DU0A 2Q02A 2H3BA 3W1LA 3KOWA 2Z1WA 5CG0A 5DMMA 2X0SA 4D8LA 2NUXA 2DJLA 2XH4A 4CCZA 3E2VA 4GYPA 2PGEA 4LUYA 4MJ2A 3E96A 3CB3A 4P7RA 1N7KA 3S5ZA 1R3VA 4US6A 3G0XA 1NSJA 2YIHA 1XIFA 3FIGA 3KOYA 4DO5A 3S5NA 2GVGA 4TTGA 3OZOA 3M5YA 4YU1A 3UR7A 4LYPA 4Z17A 1H11A 1ICPA 3TQKA 2X7WA 1XIMA 4UR8A 2V5CA 1JCJA 1OADA 3OO2A 5A6TC 1TTQA 3CT7A 4ES4A 4F2BA 1EKOA 3DENA 4ZENA 2R8WA 2VR4A 1K02A 1ZU8A 2XN1A 5I5RA 4ACZA 5ABFA 4JDBA 1I0DA 3TOPA 4A29A 4EPBC 4N9BA 2DQWA 4KRTA 4HHHA 2PD9A 1GTHA 1FWDC 1HGWA 3W28A 2DW7A 1GVIA 1XKJA 4NAEB 1OC5A 2WJEA 4X0VA 4MFEA 3VXGA 3UZZA 5A6AA 3CWHA 2Z25A 1GZGA 3KRSA 1EP1A 2C3ZA 4K7YA 1FH7A 5FKYA 3MBFA 1GKQA 3NTYA 3T55A 2X2GA 3EPMA 2IW0A 4MB1A 4DBUA 5HJYA 4PCFA 1IGSA 1EJWC 1TV3A 4Q8MA 1S5VA 4MMWA 1US2A 3DEQA 4EXQA 2Z00A 1YTEA 4P2VA 1YKWA 4P8WA 3W83A 4UTIA 3AJXA 3TP4A 2Z2UA 1LF1A 1DTUA 3LMYA 4AD2A 1JVNA 1XDMA 1B4KA 3SCOA 1OB0A 4FLRA 2C6QA 1CT5A 3VD3A 4TV5A 3UZWA 3QJAA 4MWAA 4BS0A 4DXKA 2VGFA 2DZPA 1UWRA 1M6JA 1UWQA 2TRSA 4KWVA 3V4BA 2VI0A 2A3HA 3LHVA 1SJAA 4JN6A 4M29A 3WFLA 1QVBA 4S38A 2EEXA 4JXCA 4UR7A 5E0FA 4L4MA 3W7LA 3HM7A 3BLIA 3N3TA 3M41A 2GSHA 1EA0A 3N04A 1YNPA 4PB3A 2PRLA 3V3WA 2I9EA 2X1IA 1Q13A 3PNUA 4O54A 2QCHA 1OT1A 1WXZA 2HV5A 1LWIA 1NOFA 3FAXA 5JIPA 2XVNA 1HUVA 4Q4KA 3AJ7A 2PZ0A 2V2CA 3BW3A 2UBPC 5EMYA 3GDMA 3KDOA 3GW3A 3VIJA 4IT1A 2I57A 1GHRA 1VP5A 2PLMA 2JGYA 2VCCA 1H3GA 1OQFA 4JTUA 2WK2A 2AGTA 2OZ8A 3UWUA 3MMBB 5JBFA 1L2UA 2YFOA 4UXDA 3AWNA 4Y9PA 1R2SA 1P4CA 3BOXA 6XIAA 5FL0A 3N4AA 1TR9A 2BS9A 1R86A 3U8GA 1OYAA 3DHFA 3NO3A 4RNHA 3H22A 3UPMA 3PULA 5C9XA 1R0MA 1K7FA 2J62A 2BBFA 3TU9A 2RGLA 4HK5A 4I6KA 5LNVA 4LB4A 4XBSA 4QX4A 1AJ2A 3MTWA 3TEVA 3UGRA 4ZOCA 1LL6A 1TA3B 1UBPC 2IQTA 3TSDA 3R8RA 1EX5A 3WLMA 2WWCA 5A8NA 4IMDA 1UBSA 3KVLA 3GU9A 3UWYA 3QV7A 4O1BA 8GEPA 1TIWA 2O55A 4HPXA 3IGXA 2OLAA 3M0KA 2DU2A 1TVNA 1VZWA 1OZQA 2HXUA 4J28A 4LUIA 3OIHA 3ZLGA 4YJ5A 1UH4A 4K39A 2B7PA 4JN8A 4PEKA 5CSRA 1EIXA 1S5TA 4K68A 4KERA 3EEGA 3VIGA 3ERPA 6TAAA 4GWEA 2Y7DA 4PB5A 4N9EA 1UJPA 3HO8A 5CGQA 5FF3A 1NFGA 3QRHA 5K9DA 2FVMA 1CYGA 3CQHA 3GTNA 4RE4A 1YNYA 5BXSA 3N6HA 5LSMA 3PZUA 3MMWA 5CPNA 4TVCA 1HJVA 1H5YA 1ECEA 1Q7MA 3B8UA 1HTIA 1JXJA 2FPVA 1US3A 3VKPA 2AKJA 3CL8A 5DT7A 1QNQA 2I56A 1J6PA 2AKMA 2VVNA 3S2JA 3GH7A 3TW7A 7REQA 1O1HA 1H4PA 1VFHA 1V6VA 2CLMA 4AXNA 4DZAA 4W84A 2I14A 1EUAA 3HN3A 3W7GA 4O12A 5M03A 3L0KA 3N2XA 4IQEA 2CBVA 1W0MA 2EHHA 4XBKA 3TYAA 1NF7A 3MMDA 1CX9A 2J24A 1EBGA 4G1NA 1W56A 3VDAA 1GQKA 2PC8A 1EO5A 2CBUA 4GYJA 1IZJA 1V0KA 4LVFA 2Q8ZA 4JTQA 1DP0A 2DZXA 1AVAA 1L6YA 3TONA 5DY2A 4AD4A 1ZENA 4NAFA 1H1ZA 4DJEC 1ZJ8A 2XN0A 4YLWA 3SJNA 4C65A 4PBEA 4CLMA 3PPHA 3OU8A 3ES7A 3PSVA 2DDXA 4YCPA 2C0AA 1E73M 2XVKA 3KTSA 2G50A 1XCWA 4YVXA 3G1FA 3AROA 3PG8A 2POZA 3AWOA 3VUSA 3P81A 1GONA 4D72A 4GUFA 5CJMA 1J8VA 4GC3A 5A6LA 3UWWA 3T0CA 7XIMA 3APYA 5D9OA 1B4EA 5BW6A 3TXZA 1G9HA 1CDGA 4GI8A 2YYTA 3DC8A 1OEPA 5DCEA 1YE4A 1U5VA 2BGQA 3THQA 2EO7A 3GIQA 3TH6A 1EBHA 3CUXA 4P8XA 3RR4A 1IR1A 2WLZA 1KM1A 3MUZ1 4CGTA 2J9YA 3T08A 2H3DA 3FGCA 3OHIA 4NKCA 4CCDA 5F4WA 1TZ9A 1LBFA 2PDKA 4QE5A 2DVUA 2CLIA 3T2PA 4MUZA 4LOCA 4NYUA 1VC4A 4C6MA 1XLBA 4KFOA 5I3DA 4B3ZA 5TF0A 3QV6A 4S3GA 2OT0A 3TTQA 3DFOA 4FHAA 4A3UA 2PUZA 6REQA 1J0ZA 3ZJ6A 1TUFA 5CC7A 3KL3A 4XD4A 1B3WA 2GJLA 1GVRA 2BXZA 5I3FA 5CBIA 4V15A 1TB3A 4D9PA 1EPVA 3B9AA 4IFKB 3IJ7A 3NQAA 4AZIA 2BNJA 2PS2A 2CETA 2A3AA 3FS2A 3UJEA 2YW4A 1EUNA 2CLFA 3SGZA 3WD0A 3BJTA 3F4CA 3UZXA 2CLKA 4M6PA 1UKOA 4DQWA 1U33A 1K9EA 5FJUA 5D04C 1NIUA 3GTFA 3NZPA 3C6CA 4LWWA 1F61A 3SFWA 2QMJA 3JZEA 4U31A 3PZOA 3PTQA 4ZXLA 3P2VA 2YSWA 1H49A 2IPFA 3AXXA 3RGTA 2CESA 2OX4A 3BDKA 3OYZA 4S23A 3ISIX 1W9VA 4JFUA 4ZB2A 5TIMA 2PPGA 4MNLA 4C6DA 4MYXA 3ORWA 2YJQA 2ZC1A 4UFIA 1R3WA 1YPFA 5TNVA 3B9DA 4YIWA 3BLLA 3RR1A 3CBWA 1JQXA 3G5EA 3QOKA 3MZNA 1G4EA 4B92A 5D37A 3N13A 4UTTA 1GPFA 2O9RA 5K7JA 4KGJA 4G9PA 3PK7A 4HCDA 1H7NA 4AAJA 3D5HA 4WK9A 3VE7A 1WP6A 1X6NA 4ZZ9A 2Z27A 1W3IA 4JNMA 2BV9A 3AAMA 3W86A 3R7MA 4EKJA 1ZAIA 1QPQA 3VKJA 4DAFA 1PKLA 1KTCA 1TPH1 4YNGA 5A2AA 3BG9A 3LENA 3T4WA 1DWHM 1TMHA 3GH5A 1UPMB 3W26A 2PAJA 4MIMA 2J7GA 2V0TA 1PEZA 1C9WA 2OODA 2IS7A 1TJ1A 2ZKMX 2YW3A 3M16A 3GHTA 3AIWA 1ZSXA 2FFCA 3UY7A 5CSSA 4K37A 4PUMA 5IDZA 4HBKA 4E3VA 3T1GA 2WSKA 2XIIA 1MUCA 5C7VA 2C19A 1O5RA 3A6OA 1XYCA 1EQPA 1UC4A 3SGUA 3G22A 1JZ7A 2ZRZA 5F4XA 1W9DM 3R4IA 3UJFA 4FXSA 3URBA 1IF2A 1J79A 8CGTA 2TSYA 4KRUA 4WHBA 1RD6A 3P74A 3WQDA 4R7WA 4ZQNA 4JYFA 3JRKA 4XG1A 3IVSA 4LYRA 3BCFA 1KCLA 2ZICA 4QBXA 5AVHA 4HB7A 3G0UA 2V2HA 4H9YA 4JICA 1EX1A 4ROQA 3UP8A 2KZHA 3N25A 5HUPA 2UY5A 1X96A 2VD9A 1W2VA 4GO8A 4B9ZA 1JI2A 3LHWA 3FCPA 2O7SA 4GKTA 3LEPA 1XR2A 3KAOA 3P7YA 4GI9A 3NL6A 1LTDA 1VQTA 3UU0A 2UY4A 4NRSA 3L2LA 2CZVA 1Y8BA 3DFTA 1B0IA 3HTWA 3WLNA 2Y5SA 4Y9OA 3QY6A 2Y4SA 3GXMA 1DIKA 3I10A 3VILA 2V5LA 4WJXA 3QC3A 3NGJA 2W3ZA 4ZVJA 4H9XA 2CZ5A 3CHVA 3IJ8A 5HNUA 3GG1A 4X2RA 3Q45A 3ONBA 3GVQA 3P0WA 4DUOA 3BICA 1QJWA 1RQHA 2EPLX 4PMZA 1XYBA 2H9AB 3CZGA 1DKWA 1OK6A 4A2SA 4E4FA 5C0QA 3BXWA 3WH9A 4LS2A 2VEPA 1H7XA 3M0IA 1NM9A 3MYPA 3MI2A 1XINA 3N15A 3TXVA 1A50A 1TPB1 3UETA 1PYFA 3ABOA 3V5OA 3B8VA 5CAKA 3UWQA 1ENUA 1F4AA 1QRQA 2PI6A 1RQEA 5EKYA 4BFAA 4D6FA 2F6XA 2O9TA 3DCPA 3ZLFA 3KLKA 3PZ9A 2CZEA 4U28A 3IPWA 3SCQA 2WZMA 1TWIA 1ITCA 4GQ0A 3FJNA 2D0GA 4DLFA 2FGZA 3QQ0A 2A0NA 5D30A 3NSMA 9XIAA 3HPFA 3P93A 4TV6A 1LRQA 3R79A 3R94A 5BYWA 3VKTA 5HR7A 1B9BA 1CIUA 3VDHA 3GVWA 5AC4A 3N34A 1QNPA 3LHTA 4CNTA 4A35A 4NNCA 6ALDA 4LC6A 4AVOA 2XN2A 3GTIA 4D6JA 1UP3A 5FEXA 4W9TA 5FSDC 3LRLA 3UR5A 4AX6A 1REQB 2WXDM 1XLGA 5LZLA 3QH2A 2FHFA 4FLSA 1V3JA 1TTJA 3PG9A 4P7QA 2G95A 2XISA 1JPDX 3SUWA 3PUGA 3BUVA 4GVHA 2BTMA 2XSJB 2AAAA 3OODA 4BEUA 4J7RA 4GD0A 3BSMA 2VWSA 1KRMA 2ABAA 4FA3A 3TN4A 2FZMA 3EA2A 4IGMA 2NQZA 1CGWA 1XDLA 1F9CA 4DO4A 5CJ5A 1DE5A 1T40A 1YTDA 1N55A 2DT2A 1N8WA 3FSUA 3LB0A 4QFUA 1JDDA 1ALDA 3SN0A 4PMRA 3RX2A 1PZ0A 1C8QA 2LLEA 1A0EA 2FH8A 3C0JA 2YA0A 3ZT7A 3MBDA 5BWFA 4JTCA 3FX4A 3RIKA 5G1MA 3UVAA 3NZ1A 5JBDA