4G9PA

Structure of the gcpe-mecpp (ispg) complex from thermus thermophilus
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
405
structure length
405
Chain Sequence
EGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the GcpE (IspG)-MEcPP complex from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 133
structure length 405
sequence length 405
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4g9pA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4g9pA02
4DJFA 4O1FA 4S3AA 3TR9A 3H2AA 3MM8A 3OR2B 2Y5JA 3AOPA 4DJED 3MMBA 3B0JA 2DZBA 3H2EA 4MWAD 3VM0A 4G39A 3V5OA 4NL1A 1TX2A 4DJEC 2BMBA 3BOLA 4S3DA 5GEPA 3H26A 1AD4A 3MMCA 2YCLB 3VM1A 2DQWA 3MM6A 4C1NB 6GEPA 3MCNA 1AJ0A 1Q8JA 7GEPA 3B0GA 3MM7A 3MMCB 3MCOA 3VKSA 3H2NA 3TZFA 4DB7A 1TWZA 4S3BA 3MM6B 1Q8AA 4DAIA 1TWWA 1AJ2A 2DZAA 3OR1B 5JQ9A 3TYUA 2AKJA 4DAFA 4DJEA 2YCIX 3H2OA 2AOPA 4NHVA 3H22A 4MWAA 8GEPA 1Q7QA 1TX0A 3MM8B 2GEPA 3TYCA 4MWAC 3B0HA 4AOPA 3OR2A 3MMBB 4S3FA 3B0MA 4NIRA 1Q7ZA 3H23A 4S3CA 3MM5A 4DJDD 4G38A 3B0NA 4S39A 4G9PA 2Y0FA 3VKQA 3GEOA 2Y5SA 3B0LA 4DJDC 3TYZA 3VKRA 3VKPA 3NOYA 2YCLA 4S38A 2E7FA 3VKTA 3H24A 3VLZA 4GEPA 5AOPA 1Q7MA 3H2MA 3MM5B 3MMAA 4S3EA 2OGYA 1AJZA 3H2FA 2H9AB 3MCMA 3MM7B 3TYEA 3MMAB 3TYBA 4D9PA 3TYDA 1EYEA 4C1NA 4CCZA 2H9AA 4PZVA 1AOPA 1ZJ9A 4HTRA 2VP8A 3MM9A 4DJDA 4D8AA 2YCJA 1AD1A 4DJFD 3MM9B 4DJFC 4O1EA 3H2CA 2V4JB 2XSJB 4D8ZA 1ZJ8A 4MWAE 4O0QA 4S23A 3VLYA 4HB7A 2YCKX 3OR1A 3TYAA 1TWSA 1Q85A 2VEGA 1F6YA 4NILA 3H21A 3K13A 2V4JA 2VEFA 2XSJA 3VLXA 3BOFA 3TZNA 4MWAB
chains in the Genus database with same CATH superfamily
3AJ7A 5KZEA 5AYZA 1VBUA 5T91A 3O16A 3WFAA 3ZSTA 2QUVA 4ROQA 4ML4A 2FGLA 2IW0A 4Q6XA 5CGTA 2GJLA 2VFFA 3NPUA 1I6NA 4AIBA 1AODA 5G4HC 1Q5MA 3PUGA 4DO6A 3PB0A 4HNOA 1GJPA 4NJKA 4NF7A 4AQLA 3PPHA 3P7YA 3W27A 3ABSA 4NUWA 1F4HA 4IIHA 1XF0A 3G8EA 4H83A 2FTYA 3UG4A 3VX1A 3WQGA 3N29A 2YIHA 4DWDA 1RA5A 4J27A 2ZRVA 1P6BA 2AGTA 3W1NA 3EB2A 4AXNA 3L4XA 1IT0A 4RCXA 3VC6A 4UCFA 2CZDA 3EWUA 3QGAC 2CYGA 5JBDA 1J93A 3DH7A 2PD5A 2KZHA 4XIAA 4CKQA 2D22A 5JIPA 2QEZA 4GUJA 4JYFA 1NFBA 1EBGA 3TMLA 4ZB2A 1OZMA 3GR4A 2MANA 4KFNA 3S5YA 1XS2A 2NW0A 4AC1X 3L9CA 3ZJ6A 4IX2A 2WVSA 1EYWA 1ZJ8A 1D3GA 4PTWA 4F9JA 4F0KA 1Z44A 4W85A 2WMIB 3LENA 1RJQA 1WB0A 4EXQA 1FWGC 3ABQA 2ACSA 3K1DA 1H1NA 4ACZB 3NQ8A 2W91A 1OGGA 2ZZ4A 4NZFA 1ZP4A 4E4FA 1Q6FA 1YIXA 2V69A 4L1WA 1AW5A 1TE1A 1J6PA 1FFRA 1F8MA 2R14A 3F2BA 3QBUA 4RZ5A 3CHFA 1IT7A 4GFIA 4MTVA 1CECA 1B9ZA 4R9XA 4IQJA 4HTBA 1RLDA 3EKGA 4Y9AA 4LX4A 3VI2A 1BAGA 5I09A 3PZNA 4OBTA 2RDXA 3SRHA 4DXVA 1OFRA 1XLGA 3CQJA 2GJXB 2PDNA 4MNLA 3MDWA 4U3AA 1FWJC 2QV5A 5CC5A 2GK1A 4Q3MA 5HJYA 4QX4A 2Y7DA 4GYPA 4IIFA 5ABHA 3EA1A 2QW5A 3GXMA 3RPMA 3MM8B 3GKAA 4QEHA 4IWWA 2D3LA 4JDBA 1OD8A 4JN7A 3SJ3A 1GG1A 3UXIA 1E15A 1OFEA 4FHAA 2J66A 1XXXA 4L1GA 3E5PA 3R43A 3ORWA 4NJHA 4O14A 4B90A 1Y5WA 3RX4A 1VFTA 4KETA 1UIPA 1B5TA 1LWIA 1X96A 4RZBA 3ME3A 1X1NA 1XBXA 3OQEA 3KFTA 2X0SA 3W88A 4BI5A 1R7AA 3A5VA 3IIOA 1FHDA 3MSDA 4WUIA 1RQEA 3OVGA 4LS2A 2R8WA 3INPA 4JQ1A 4KEZA 3C2OA 1KD0A 3WDHA 1V02E 1W3JA 4LVAA 2RDWA 4OUIA 2V8ZA 4JDYA 1B1YA 4GCAA 3DFTA 5LHFA 3FSTA 5D32A 4ZOCA 1NWRA 3JW7A 1XD1A 2TAAA 3GZAA 3KRUA 3CUZA 2WVVB 1Z32X 2CBUA 1CDGA 3LTYA 4K1WA 4EAYA 4HN4A 1WBJA 1NM9A 4WY0A 3WLPA 3J7HA 4N9EA 3CMJA 1WNOA 3EX1A 3OJGA 2WNNA 1US0A 3VKSA 3LBOA 4L6OA 3N3MA 5DANA 1DTUA 4CCEA 4JTTA 1NDVA 2WM1A 1LBLA 4J35A 3RM8A 4AHQA 1EF3A 3PUDA 5IXEA 4M81A 4KWVA 1RD5A 4NHVA 1NOUA 1E6XM 2CZEA 3JR2A 3KAOA 5TBOA 4FLSA 1J0JA 3M5VA 1U33A 1E5NA 3B0LA 3T0DA 4PGLA 3WUBA 4JHZA 2VEPA 3DOPA 1S38A 5A6LA 1JRBA 4GEPA 1WAUA 3ONCA 3GTNA 3B0PA 4XAFA 1CCWB 1MUWA 1OT1A 1PS9A 3CUIA 3M6YA 4GINA 1E0VA 4HCDA 1R6WA 3BLKA 3VOIA 4PUDA 4L80A 3S1WA 1HXJA 1GQJA 3P14A 1I9CB 3DIPA 4GVFA 3P8JA 1OX6A 3YPIA 2UY3A 3WCZA 3REQB 1V3HA 3H4WA 4UR9A 1IXQA 4JX5A 1LOSA 1KM6A 1EJWC 3U57A 4R33A 4C65A 4NL1A 1YDYA 4AX6A 1MRQA 1TVLA 1EWEA 3IGSA 4OV9A 1TREA 3LLXA 3STEA 4WIWA 1E0WA 1TV4A 4PUKA 5JH1A 3BZGA 2PTDA 3PZQA 2WLYA 1EA0A 3CQHA 3BQ5A 4H9ZA 1LQ0A 1Q13A 2GSEA 2XG9A 3CQIA 2RFGA 2I14A 1KKRA 3HPXA 3O07A 2I5QA 3BPWA 1W1YA 2HNHA 4GE8A 4MNMA 2XGZA 4C1KA 1IEXA 2YFOA 3OVRA 5EA9A 4AIOA 1C7SA 1ONRA 1MEWA 1UB3A 4DZAA 3N25A 1T96A 2OSXA 3U48A 3A23A 3AOFA 3TLLA 4ONVA 5F2MA 1EBHA 4EXBA 3RITA 5K9CA 1YTEA 1A80A 3VIGA 2HVOA 6TIMA 4DJFD 2BY0A 3MM9B 2RHGA 5IFTA 5E0FA 1BG4A 1EA9C 1ZP3A 1AQFA 4QR6A 3K5XA 2IQTA 3HGJA 2WYSA 2QJNA 1XV8A 1TR9A 4QNEA 1WXYA 1XDJA 3WD1A 4K8EA 4UMBA 4P5UA 1NFPA 3ANVA 4C60A 3GUWA 1TPDA 4TIMA 2ISSA 3QLDA 4LCQA 1SQ7A 1XSJA 5BMXA 4EVZA 5E70A 1XYBA 4YTRA 1NDWA 4AF0A 3HQNA 4PFMA 3UNTA 5DMLA 5CQ1A 3H53A 5ECVA 1S5TA 1G5AA 2XYLA 2QCEA 1U5HA 3P93A 4ZBCA 4L1XA 3OG2A 4N2YA 4L9ZA 2Q6ZA 1VR6A 4NSBA 4UOZA 7A3HA 4PEKA 3W72A 1TELA 1TTJA 1VRDA 3WMCA 1PZ3A 3KTSA 3L5MA 3AZSA 4TX6A 3KZSA 3OBAA 2IPJA 1KRCC 1OQFA 4HTYA 4JR5A 3VFCA 2PTXA 3AS2A 3LXAA 5AC6A 1QHZA 3BQ6A 1N8FA 4XTIA 3MPGA 4UQDA 3IVTA 1KWGA 3N13A 3NG3A 1FH8A 4W8LA 4DJFC 1GORA 2BX7A 1AZ1A 4O1AA 4J3ZA 5LA0A 1W31A 4CLMA 3AJXA 5FSEC 4C7DA 5I3GA 1XRTA 1FWFC 2XFWA 4JICA 4R88A 4NNCA 3MC5A 2YA0A 2NVDA 4DZHA 2DGAA 1IR1A 2B7PA 3FIGA 4DPQA 5L9FA 4QG8A 3PP7A 3E3HA 4AWUA 3NZRA 3PJXA 2Q8LA 3A3WA 2YDQA 1BWLA 1FCVA 4MVAA 2QR6A 2W61A 4EIVA 4KW2A 4DJEC 4UOJA 4JS3A 2PWDA 3E0WA 3OHMB 3I4KA 1PV8A 3UY8A 4J3UA 1D9EA 1SZNA 3WUEA 2CU0A 3DHPA 1O4UA 3GX9A 6XIMA 4B3ZA 1G6CA 5EKYA 4DELA 5I02A 1XBVA 3M0JA 3P67A 3PTQA 1N82A 1Z69A 1ZUAX 2J9XA 3B0YA 3GTHA 2FYMA 3UG3A 1RXOB 3UZXA 3PBMA 1QI4A 2BOFX 4V27A 5LSMA 4LBRA 5J5DA 3VO0A 2P53A 2WWCA 2OEKA 4U31A 5CKSA 3T8QA 1POKA 1KXTA 3KOYA 1DYSA 1O68A 3MMAA 4C6NA 1IR2A 2XZ7A 2ICSA 1SZGA 5HMDA 1BLIA 3URAA 2OYLA 3W7PA 4AHOA 2CZVA 4IMGA 4O57A 1OF6A 4FALA 1XBYA 1V0LA 3V0SA 3GW0A 2NWRA 3NQVA 1IGWA 1KCLA 4QJ5B 1ZL1A 4NYUA 3H70A 3GRIA 3RMEA 1QNSA 4QEEA 5HPCA 1F7BA 2VCAA 5F4SA 1Y65A 3EWBX 3S1XA 3RG6A 3TAOA 2J88A 4ERIA 2VZTA 3N17A 2PWGA 4A8LA 4RDVA 2PDXA 1TMQA 1EIXA 2PC4A 5CPLA 2ZX6A 4WJEA 1SGJA 4PCTA 1O60A 4GHRA 3PUEA 1NOFA 5FOOA 2LLEA 6CGTA 3SCVA 1VFFA 1P5BA 5D04C 2WM0A 4XUGA 3TCEA 4CQBA 3GYEA 3BLOA 2JBMA 4D1JA 3AC0A 3LPFA 3WQ6A 4FPSA 4MWAA 5U4NA 3OR2A 3SADA 1E6ZA 3BANA 1SM9A 1LP6A 1GONA 4LNYA 2E7FA 3VOCA 4A8RA 1QNVA 5MKGA 3WLSA 5JU6A 1LOLA 4GLEA 1E71M 1BSLA 1V4YA 3SY8A 4JTAA 3SBFA 1XIMA 2PI6A 3N3TA 4DUWA 3UYIA 1W9UA 3P8IA 3IV3A 4J5NA 1ICSA 3EOUA 3O6YX 3QR0A 3A3XA 1AZ2A 5AC8A 1IT8A 3OR1A 5FKYA 8A3HA 3S1UA 2F7FA 4PMZA 5IRPA 4YIWA 3N34A 3UF9A 1KFEA 1QVBA 4GQ0A 4F79A 1TV5A 2YXOA 4IPJA 3MMBA 2EQDA 3CUGA 1YE4A 5ABGA 3KEHA 1QATA 3SN4A 3W7EA 3JUGA 4GRSA 3PZGA 2J77A 3F2DA 1WP6A 4HNCA 4OFCA 3RU8X 3RXZA 3NDZA 3L21A 2NUXA 3MHGA 1L2UA 3TNOA 1RSCA 3SN0A 4Y9MA 1G94A 3GXTA 3W73A 2EGZA 3THAA 3O05A 2IS7A 3VMNA 4P7QA 3WLOA 1E4NA 1H1ZA 4FNRA 5AVHA 4QSFA 2CLEA 4RZ6A 1SO5A 2D1ZA 2WANA 5BOEA 4CD7A 2E4TA 1PTAA 1YKWA 1EKOA 3AHYA 1S2UA 1DBTA 2F84A 2JQXA 1GG0A 2XIQA 3H2FA 4JL1A 3GXNA 1SJCA 4XBSA 6XIAA 2P10A 2R6OA 4GC3A 3T7VA 1SMAA 3W7NA 4F9DA 3W87A 2NQ5A 2XSJB 5D33A 1YBQB 3LMYA 4HYRA 3SCWA 4ATDA 1E9YB 4C6OA 1LLZA 1UQYA 2IPWA 4PBFA 2GJRA 4Q22A 4D2JA 4LUTA 3CUXA 4JY8A 1AH4A 1WDRA 4GIAA 3GW3A 1GYLA 2QCDA 2I16A 1M04A 3BG3A 1EOMA 1A4LA 2FMNA 4PE8A 1DPMA 1EP2A 1WE5A 3V7PA 4NKCA 3OIXA 4XV0A 3MM6A 3CL7A 3FY1A 2QCFA 2CKRA 2PLMA 1P1MA 4S1FA 5HNTA 2DZUA 4C1LA 2HCVA 3AXKA 4GJJA 3OGVA 4Z2HA 2F2HA 5CPSA 5HULA 1H61A 1H51A 5K3VA 4YVPA 1HW6A 3NZQA 3CMFA 4Q33A 4ORMA 2YZRA 4Q4RA 1LF1A 1VH7A 1BKSA 2X09A 3W3OA 2A4AA 4GBUA 4F2TA 5A3HA 2WC3A 1J10A 1CXHA 1DJYA 1JPIA 5FEZA 4Q8TA 3LCWA 1W1PA 3S83A 4HMNA 2VC9A 3PFMA 4CVUA 5CG7A 3G1VA 1LROA 2Q3OA 4NXSA 3GXIA 2A21A 3GKFA 5FJUA 4QLJA 4ZR8A 1CGWA 4OGZA 4EF9A 1F6PA 1X6NA 1SSDA 3S2JA 4DO5A 3WDIA 2ZA3A 3STFA 4FNUA 3VKDA 4PBEA 3E0LA 3ABZA 1NOWA 3GNNA 1E9IA 3S5SA 3MSRA 5AHNA 4BHYA 2CLMA 1NWSA 1PCKA 2IPFA 2FH6A 4L56A 5AY7A 2FVLA 4MUZA 1Q45A 1VJIA 2QCGA 1TTIA 3OPSA 3W2MA 3PB2A 4RKAA 4GXPA 4MADA 5LHEA 1B54A 1GVIA 4DNMA 4ZSUA 4ZB0A 2R94A 4W5UA 1NH6A 3UGRA 5DY3A 1YDNA 1LJYA 2HDJA 4I90A 4X22A 4Q4OA 4LCRA 1UOKA 2WZHA 4A21A 4PBGA 1UZDA 3AZTA 4RNIA 4J3WA 3POCA 5AB3A 1FHLA 1EF2A 2O9PA 4IJCA 2G3JA 1NVMA 3W1RA 4ZEPA 3CASA 3OZMA 3EB3A 2XGBA 3PK7A 4UFIA 2YL9A 4HA1A 3H2MA 1KTCA 3R10A 3CT2A 4MB3A 1VFSA 4N9BA 1NFGA 1FVPA 3SO7A 3T0AA 3IIPA 3QGKC 2ACUA 3KVJA 1NARA 5HJLA 1MDRA 3B05A 2CC0A 3V0TA 3WBYA 1Z41A 2YLLA 1P0DA 1K7XA 4NAFB 4ZTXA 2JKEA 4Q4PA 1UR2A 4I9JA 4H7VA 5EU9A 3GH4A 1PKYA 2PPGA 2YXXA 3LBMA 1MZRA 3KDNA 4MMWA 3S2NA 1KM4A 2EPHA 3VPLA 3ZWTA 3TP4A 3B9EA 4M24A 3UXDA 2DZXA 5LNSA 1W5OA 1RVKA 3NWRA 4QDMA 5GEPA 4K8HA 3VMPA 1EJRC 3FS2A 4B15A 1JI1A 3NCOA 3RCMA 1QPNA 3MYOA 1W3KA 3KOZA 3WH6A 1W5NA 1OY0A 1CENA 4PMUA 2H8ZA 3BURA 4WD0A 3SCSA 4BF5A 2FZ9A 3W74A 3S3GA 3HPAA 4KCVA 4JTDA 1UR4A 3NQBA 3WN6A 4HMCA 3SECA 1W17A 3A12A 5AYIA 3WX7A 3WJZA 5HANA 3DHUA 2BS9A 4UQAA 4XD5A 2GQ8A 1LZOA 3G6LA 2QV4A 3AWOA 4GY0A 3FCPA 1J11A 5I00A 3TE9A 5JH2A 1OIMA 3R8GA 2OEMA 2DZPA 1RLCL 1XLAA 1OBAA 3CWNA 4BJHA 1JQVA 1FTXA 2INFA 3BW3A 1NQKA 4JQ2A 3VCCA 3COTA 3MO4A 1P4CA 4I9MA 4KFPA 1W2PA 3W7GA 5M5DA 1EC7A 4DLFA 5D03A 2ZRZA 3KBSA 3QKZA 3G1AA 3FHAA 4W7WA 4IXHA 4AWTA 1L8PA 4ZO7A 1VEPA 3PJWA 1PWMA 4V15A 3FEMA 3N6QA 4FNPA 2QJJA 3LCLA 2J6XA 4JEQA 3VNKA 4HZ8A 3RHGA 4H6EA 3ZR6A 3HMJG 1MQPA 1MEIA 1EJVC 2F38A 1KM2A 2WSRA 2P50A 1DWGM 4QJ3B 4HNVA 1FUYA 5IDZA 2PLKA 5CEWA 1OG0A 3MM7A 2BY3A 3P80A 3VGDA 3IJLA 1C93A 5BRQA 3TWBA 2E5DA 3LXCA 1C9WA 4MFEA 3FVDA 1HJSA 3GFXA 1CXIA 3UWUA 3I7SA 2FPTA 3RIKA 4ML9A 4W8BA 4Y8FA 2JK2A 4A22A 4DYEA 1PX3A 1UG6A 4S3FA 1HZYA 1DIOA 3N73A 3VKQA 2ZDSA 4PL1A 4BWLC 3MANA 4ORIA 1K6AA 3CZ8A 1W2VA 1DE5A 3TC6A 3UGVA 1KFCA 4PRWA 1WXJA 4AZHA 4PCSA 4NVTA 1BXCA 1QWKA 2WMJA 2Y7GA 2E5CA 2VCCA 4H9MA 4ZOBA 4M3PA 1T6MA 4QQUA 1ISVA 1I75A 4CQCA 1K4HA 4F4RA 4KF1A 3OP2A 3B8UA 3GU1A 4K7YA 4IPPA 3CXOA 1J0ZA 1IXNA 4RE4A 4QE1A 3B8TA 4PA8A 3SJNA 4O19A 1R30A 4JNMA 4U5IA 5CPQA 4TVUA 4B3KA 1A5NC 3A9BA 1XIFA 4LAUA 5F7UA 2Y7EA 1MO0A 1RK5A 3B97A 3KS6A 1TIMA 2DORA 3VYLA 4WKHA 3WLNA 4FOKA 1VEMA 3W22A 1ZPTA 1F05A 3USZA 3CZKA 3M6DA 4JTGA 3ZSSA 2VELA 3UXLA 4EPKA 2PU0A 3WH9A 2F6UA 3R94A 3QQ0A 4QFUA 1KGWA 1NTHA 1B3XA 2A1YA 4I3GA 3D3FA 4NNBA 2GQ3A 4UTWA 4J2MA 1WZKA 2WAGA 5HATA 3TV8A 3H4GA 4Y9OA 1Q7ZA 3PZMA 2ZTKA 2D2JA 1CXEA 2VZVA 4C6BA 3QHMA 3Q58A 1PKNA 3CMGA 1CLXA 3QH2A 1YPIA 1H7PA 3ZQ9A 1H5YA 2W92A 3MMAB 4A3HA 2XIMA 2GJXA 4BZYA 3MM9A 1E4MM 2X8RA 2XUCA 2J7HA 3NVTA 3BG9A 3DN5A 5CBJA 1RCXB 2GUUA 5REQA 3VOJA 1O7AA 4HZ6A 4LBSA 4MFDA 3TMQA 1UHVA 3BWWA 3FJLA 2YA1A 2FPVA 2J8FA 5I3KA 4Z1BA 5FSDC 3MV01 3MVIA 2PLCA 1ZAIA 3REQA 2QAPA 1A0CA 1HJQA 2PWEA 3E1F1 4OV4A 2F6KA 3F1QA 4LF1A 1NY1A 2V5DA 2VX5A 1E3ZA 2NSXA 1HNYA 4QM1A 1G7UA 1M68A 3UWWA 3UESA 2BHYA 4NASA 1ELSA 1ODUA 3VDAA 3ICJA 3WQPA 3M5YA 5A6BD 3EWZA 3WNKA 1JAEA 3OLEA 4P7NA 3C52A 4AAJA 3GLCA 2AMXA 3L0KA 2WK2A 3LV6A 4QLLA 4G38A 2ZCGA 3T81A 2X0YA 1F61A 4FR6A 3WD3A 5A95A 4Z2IA 1V6VA 3UWVA 1CGUA 5G2HA 1FWRA 1PL9A 5CZKA 3DDMA 1XIGA 1DWAM 1E55A 1O5XA 2PAJA 2G3MA 1S3HA 2X1SA 2PDGA 5BYWA 1M6JA 2YL8A 2FZ8A 1ISZA 2HV5A 5HMSA 4C6KA 4I6VA 3EWDA 5A6BA 2ZUTA 2WQDA 3N6JA 2D0GA 4TV5A 4JFSA 3V5CA 1XP3A 1F6YA 3WLRA 3EMQA 3N4FA 3AMDA 1J18A 3ANUA 4NZCA 5C7VA 2VWSA 3CUHA 1RCOB 3TQKA 1KR0A 1OHLA 4M6VA 5CJNA 2MUCA 1S5NA 3WQ4A 4TOQA 3WBEA 2EPNA 2YYTA 4CN1A 3UJFA 3SUSA 1IIHA 1UUOA 4D6DA 1OFPA 7PTDA 3AXHA 3OVPA 3W7CA 5KINA 3W76A 3XIMA 1XC6A 2YJQA 5FEPA 3LPOA 1EUAA 3SQMA 5A6JA 1VQTA 2V3GA 1OGSA 3H2NA 1SO3A 2HK1A 2E6DA 1R3VA 2E09A 2EG6A 1JZ6A 3UW6A 4DUOA 1EO7A 3IRDA 1UWUA 3CV1A 1E73M 3UWEA 1J8VA 1LL7A 1VGAA 1WBHA 3B40A 3CYJA 1DJWA 1Q4WA 1X38A 3ABRA 3SFKA 3LHWA 1K02A 4Z08A 1RBAA 4IX0A 3E5BA 1PAMA 3WLJA 3PBUA 2XISA 3IUIA 4A6GA 4IP5A 1ZJ9A 1V3LA 4Y90A 1L6WA 1Z8AA 3DBNA 3WF0A 4J28A 4JAWA 4CD4A 2PDJA 4GIYA 4ADSA 4BQ4A 2BBFA 1OCJA 4JIHA 3CH9A 1BFNA 1FP9A 3OQ8A 4YS1A 2XH7A 3AAMA 2PCEA 1HP4A 3IS4A 3B0JA 1B4KA 1H11A 3FJ4A 5L6UA 2DY3A 4J9JA 2QCCA 1RZMA 4GY7A 4M7SA 4WXZA 4JY9A 3EAUA 4FLRA 2P0OA 3GVGA 2W67A 1UCWA 2HK0A 2VDGA 1QFEA 3GR7A 3V4BA 8CGTA 4ADUA 3F7JA 1KXQA 3GG0A 1G0CA 3M1ZA 1HX0A 1EPVA 3P2VA 1JRCA 1QPKA 4O1BA 3WZ0E 1XLEA 2PE4A 3R8HA 2OX1A 3PHAA 2RKXA 2R1PA 4RE2A 3PZTA 1KBLA 4Q7BA 4XD6A 1HJVA 4B16A 4Z1AA 5CGMA 2Z27A 4KKXA 3MSYA 2PURA 3MBFA 5KMYA 2VQUA 3FAWA 4M8UA 1BXBA 2X2YA 3CM4A 1XCFA 5A2CA 1D3HA 2OVLA 4XZLX 2EBNA 4P7OA 3TTSA 4FA3A 4HHMA 2E8ZA 3G8RA 4S3KA 1W9XA 4EP8C 5A8PA 2EJAA 3HB9A 2EPKX 4JKMA 3SCQA 2VEGA 3W26A 1YXDA 3M7SA 1CXFA 4LOCA 3M0XA 4LF2A 3MM8A 4GFSA 4IPIA 1M01A 3VM7A 2BGQA 4LY8A 3TOPA 5LGXA 3ERPA 4UTWC 4JQAA 3WENA 3G18A 2ODOA 4A3RA 2NLYA 3KVKA 3BGAA 2WKGA 4RJEA 4PCPA 3MMCA 3O7UA 2IXUA 4R34A 1CW2A 1T40A 1AMKA 1IIGA 3FK4A 3G77A 4DB7A 2JGQA 1EQPA 3WJYA 4K68A 4HP5A 3DFHA 1KM0A 1DHPA 4G7EA 3U6WA 1AQMA 1U1JA 2G37A 3VDBA 4LGXA 5T9CE 3NR0A 1EDTA 3N6HA 3M0HA 2DPEA 1X8CA 3WQWA 3E38A 3WMSA 2E6AA 7REQA 1GVRA 3A4AA 1EO5A 1JI2A 3AHVA 4JEJA 4LYPA 1YXYA 2XTKA 3CZEA 3NFUA 2Z24A 1HJUA 3PZUA 3QC3A 1KKOA 2ZC1A 1IHIA 1EJSC 1XLHA 4B4HA 5EPDA 3SCNA 3SY5A 2WCSA 3FJ6A 4FOJA 5D37A 4OBSA 3LQGA 4HPJA 2DUZA 1XM3A 1XH2A 4PTNA 1QI2A 2BGNE 3MO7A 1QPOA 3HPSA 4FS9A 3HM7A 3UCDA 2PDCA 4IGMA 4KGLA 3RUBL 1A5AA 3WLMA 2YCLB 2V2HA 2J7CA 2NSOA 2FVKA 5JXQA 4XAGA 4AY7A 2IKJA 3ABXA 3T2OA 2E68A 3GTXA 2XH0A 4UFHA 3FLUA 1J5SA 3BCDA 3FYYA 4V28A 1V6XA 5GJNA 1B57A 2QGHA 2DW6A 1KCXA 3HO8A 3PZOA 3VK5A 1AUSL 4MNKA 5ABFA 4NU7A 4LVDA 3ITLA 2A3EA 4KIRA 1ZS2A 3TYCA 3B9DA 3AMLA 2BWGA 3V16A 3BMWA 1PIFA 1SVDA 2FIQA 3IJ6A 3VZYA 2WCAA 1EQCA 1MDLA 2JIEA 1OWQA 5EYWA 4GNJA 2ZVIA 4RXGA 3F2CA 5G5IA 3QZAA 5DMMA 4BY3A 2E6FA 2ADAA 2YCJA 1TQJA 1GGOA 1A53A 3LHVA 4H9TA 1MQQA 3DI1A 1GKPA 2PGWA 1E70M 1QI5A 1SFSA 4RDWA 4F0RA 3W00A 4ECLA 2QDGA 3I3DA 2Y4SA 3IK2A 3BJSA 1H0IA 2PDPA 1LT7A 2X7VA 1IXOA 4EK7A 5D02A 2ESCA 3M44A 4YYFA 3O2LA 4R7JA 3SCRA 3SSZA 1SU5A 4D6HA 4QJ1A 1RQHA 2DSKA 1XW8A 1UD4A 4AU0A 1GKQA 1I8JA 2W62A 3N18A 5LKYA 2YYUA 7TAAA 3HGRA 1S39A 2DJXA 2AQOA 1IXPA 1K8YA 3KTXA 3EZ4A 3F5JA 4HYWA 1A50A 4P2VA 4RUBA 3M07A 4P8UA 1V03A 4DAFA 3U3HA 3JVAA 4MUPA 4PMRA 1MW2A 4JIIX 3VIJA 2YX0A 1US2A 3FYOA 4RK8A 2DT3A 3LD5A 3P84A 1G4SA 3N2OA 3OO2A 3B9OA 2QJHA 2DSWA 3NL6A 1AFSA 3AS3A 4JFUA 2I56A 1B3VA 4J2PA 2DSZA 2DH3A 1VBHA 3EPMA 3MZNA 1YNPA 3B8SA 3W2NA 1YEYA 2X30A 2PZ0A 5LIYX 4ZQOA 3HURA 1F8IA 1UKOA 4EKJA 1F73A 1T99A 5C8BB 4GGBA 2VGGA 3OIHA 3UJRA 2A7PA 1UH3A 1XG4A 3NEVA 1UQZA 5LNRA 5ENLA 1V51A 1EP1A 4NG3A 1JZ8A 1MSSA 3AU6A 3LM3A 3NZ1A 4HNUA 4JX6A 3HIJA 3LHYA 3K13A 1BQCA 4GO8A 3WF4A 1V6UA 3BLFA 3WH5A 3VX0A 2I57A 2NX9A 3GHTA 4AZ7A 1JYVA 3CHVA 1XRVA 1K4GA 5BXTA 4KS0A 3H2EA 1W3NA 2XVGA 3KOWA 3RNDA 1P0KA 1JYXA 1XH1A 3KP1A 2QPSA 1BWKA 2V3DA 3LX9A 1E6NA 2BB0A 1FBAA 4N0RA 2F9RA 1P0NA 3E2SA 1S2CA 4LUJA 2NX1A 4GUHA 1PO9A 4N6FA 3S42A 3PUOA 1VFMA 1IEWA 5A8QA 1I2QA 3TJ4A 3W7JA 4IHCA 1H7XA 4C6FA 3W7LA 1JFXA 3W85A 5A8OA 4XKYB 3BTNA 1TCMA 4PTMA 3FGCA 3GXPA 2B31A 3W29A 4IG2B 2H90A 1TJ2A 1LRNA 1JNEA 4HT3A 4UTJA 1JDFA 5TQLA 3KBJA 2XWEA 1O66A 3H24A 3UPMA 4U2YA 5E0CA 2X0HA 4L9YA 3N2BA 4P7LA 3U8GA 4HTRA 5C2CA 4CN6A 4GX9A 4GPNA 4F2BA 3GYCA 2A85A 1CGTA 4URIA 4MY9A 5I0DA 5I07A 3T9PA 1OYCA 2X05A 3SCTA 1F4AA 2J78A 4DJFA 4M5PA 3FV9A 4WDWA 1HGYA 3N12A 1RPXA 4WF7A 3I6RA 1PCWA 3DZ1A 3NO3A 1P6WA 1AMYA 3V0UA 4D6IA 3W28A 3AHXA 1W9DM 2E9MA 4ZTYA 3WQEA 1UH2A 4A3QA 4C6CA 4I5RA 2YGYA 1PKMA 2XPKA 3CT7A 4GZJA 4OVXA 1ITCA 1NF7A 3W0KA 3W81A 2EEXA 3MDUA 1I0BA 1OM0A 2HWGA 2DZAA 1XD0A 3FDGA 1F6KA 3F4VA 4H8UA 4QG9A 5DT7A 3H22A 2V81A 1YQ2A 1WO2A 4NY2A 4NT0A 2VR4A 1DP0A 4IMCA 4H9VA 3BAIA 2ZE3A 3G22A 4KH2A 1GPWA 3TYZA 3FKKA 3F4DA 5GNZA 1GVFA 4IICA 1CB2A 1UWTA 1J0HA 4FXRA 1HVQA 1FFQA 1TWIA 3M5XA 4CEXC 1Y7VA 5F1UA 5HQMA 3WEOA 3CAKA 3LCIA 4PN2A 1T8QA 1HO1A 3F4NA 3VD5A 3BAWA 3A4JA 1EGMA 3O0KA 3QFEA 3ZYZA 4QAWA 2G3NA 1XIHA 4ZE5A 4D6CA 1HGWA 2V4JA 1ITUA 3FGCB 3HJEA 3H6OA 4MY1A 4MWAB 3WBWA 3HG2A 4HSNA 1OCNA 4NI3A 5XINA 5GJPA 4MKNA 4TQTA 3L4YA 4F66A 4REQB 2V9DA 3S1GA 4MYAA 2ZUMA 4KEUA 4ICCX 3I3EA 4ICNA 4CU6A 4Q7NA 4ZGYA 3LI0A 4PCNA 1P6CA 3CC1A 3BL3A 2X1UA 5LIUX 3TNBA 1XCWA 1X39A 4AFYA 3N2MA 3UZ5A 3VC5A 1Q8AA 2HZGA 3OR1B 3U2CA 4MYXA 1VS1A 3WNMA 3H54A 1V6WA 2POTA 1HKIA 1EEXA 4DF2A 4MZ1A 2BDQA 3MBDA 2AQVA 2YCEA 4GUFA 3LZ3A 3A22A 3G2GA 1PDYA 1M7PA 4M6QA 4PCFA 1TE6A 3R4IA 3HOJA 2VCBA 1OYBA 4OZOA 4DVOA 3MP4A 3KOFA 2VD8A 1KA9F 4BS0A 1T7LA 4YTUA 4D8AA 1YDOA 1WZLA 3OU8A 2TODA 2Y6ZA 2R1NA 1WDDA 3M0LA 1OCQA 3W7HA 6ALDA 4W7VA 2XZ9A 2GOKA 1LUCB 4KT2A 4V1XA 3ZJKA 2QDEA 5K9XA 1KO0A 4H9XA 3QM3A 1QR7A 3LK6A 2WHMA 4IF2A 4S3GA 3T8LA 4GQRA 1RK6A 4FOUA 1Q6QA 2HS6A 3PNUA 2ISFA 4HSOA 4MHBA 4AVOA 3M4HA 1XDLA 5TD4A 2PD9A 1R47A 1XRSA 4P8VA 4XSLA 3CHCA 1M3UA 4ZO6A 4HSHA 2WZIA 3GIYA 2WZTA 4JX4A 4DI8A 1JG9A 4PMJA 5AHEA 1GOQA 3UG8A 3URBA 1H2JA 2FKPA 3TW6A 4H9UA 1QNPA 5KSWA 3POHA 3GR8A 3W84A 3SUUA 3AUJA 1U83A 3QMSA 3AS0A 3GTIA 1BQGA 3LDVA 1UUQA 3HPZA 1RQBA 5XIMA 3OYZA 3NQAA 1Q63A 2WV8A 4DHGA 3LSCA 1N7KA 4LB4A 4DQWA 3P0WA 1QO5A 3OBKA 3SURA 2ANUA 3MHFA 3ITCA 4PTXA 4DPPA 3K2GA 4K2SA 4S3EA 3DC8A 1R85A 3HTWA 1UROA 2WPBA 4BCEA 2VEKA 1YNYA 4IZGA 2XN2A 2O0TA 4HU8A 5K9DA 3R89A 2OLSA 1BYDA 3V1HA 1U2YA 1REQA 5A6AA 3ZT7A 4HOWA 2BODX 2QIIA 3W71A 2CNCA 4XAYA 3RLHA 2AOSA 4CQ9A 2VEFA 2OPJA 1IE7C 3BAXA 1KTBA 4KBXA 2NVAA 4ZFMA 1EX5A 4KFOA 4PRRA 3HFYA 3OBEA 3MI2A 3V35A 4JPGA 4S3JA 1ENUA 4J7RA 3VUPA 4LFYA 4DNHA 1DJZA 1OFQA 3EWYA 2W66A 5G1YA 2IUZA 3A13A 4WOQA 1QK2A 3OVQA 3TONA 1DXIA 4M29A 4NI8A 3RGTA 3UZZA 4Z42C 2BOGX 8RUCA 2NQLA 2WKLA 1SO4A 3UPBA 3VIPA 2DT2A 1JXJA 3PG9A 1RPKA 4OECA 3WY1A 4W87A 1YXCA 2RGMA 1TV3A 4R7WA 2GUYA 4CQAA 4DJEA 3LUTA 4WXYA 3DC0A 2HE5A 3BGJA 3M16A 2C91A 1YX1A 3VCNA 1J12A 3G6MA 4U3CA 2QPUA 2C14A 4RDYA 3A5FA 4PH6A 1SFLA 1FXPA 5EMJA 4JYEA 4RX0A 1JR1A 3LHUA 1BTMA 3WK2A 4Q8WA 1V7AA 1UKPA 5CZSA 1XSIA 5DCDA 7REQB 1X98A 3AYTA 2OELA 3NQ7A 4U28A 1A4MA 4UIOA 1V08A 2PWFA 5E6YA 4CNOA 2Y88A 5FL0A 1KBKA 2Y70A 1H5VA 3EDEA 4MIMA 5G2IA 1RH9A 1YHTA 1VFHA 3ZLFA 3WD0A 5MHBA 3H12A 1O1ZA 4QSHA 4UQCA 3WUFA 2FLIA 2GZXA 5LIKX 1DVJA 2OT0A 2OWCA 1JPHA 4AZBA 4XISA 1CX9A 2IPGA 5I3HA 1BD0A 4UTMA 2J25A 4JTKA 1OX5A 3OHIA 4XZMX 2FQIA 4TTUA 1L6SA 3CO8A 1A0DA 4ZSTA 2Z1KA 3M0ZA 1QNQA 2P8CA 1YYAA 2O4MA 3OA3A 3VOHA 2ZIDA 3HGSA 3UEQA 3KXQA 1X1OA 3W1PA 2UZ9A 1P0BA 3ABOA 5H8PA 4S3BA 2PDYA 4OJYA 3LQLA 1ZALA 5D9OA 3I65A 3CU2A 3H2OA 5CC6A 5D38A 1JGIA 2OZ0A 1V5XA 4MAZA 5CBIA 3HMCA 4H8VA 3MKCA 4US5D 2Q8ZA 2ALRA 3THUA 1DIDA 5BWFA 4GUIA 3TN6A 3UR2A 3T09A 1B3YA 1GQKA 3TUUA 2YL6A 3CTLA 4FK9A 4O13A 3GG8A 3MTWA 4AZCB 2PDWA 1V3MA 4C91A 3SCOA 4OUEA 3C86A 1R3YA 3N1AA 2GUBA 1QPRA 3CEUA 2O4QA 1ZQ5A 2J6VA 3RDKA 5HR7A 3DAQA 4XZWA 1M1BA 4HD5A 1W9VA 1QAPA 2HISA 4O1FA 1Q6GA 2WC7A 3NIYA 2HVMA 4E8GA 2Z7KA 4BQ5A 4M0XA 1KRAC 4KWWA 2JKAA 3KRZA 4DYJA 3SCUA 5FF7A 3SM0A 4B91A 3KBMA 3ALFA 4HKPA 4XKYA 2R24A 5HDRA 2Z1VA 2VYOA 3KHDA 3CAQA 3TQ0A 3BV4A 3GIPA 4I7WA 4IMEA 3N9RA 1XQKA 3TYUA 3VZXA 5A8MA 2XDFA 3AIRA 3LG3A 1HO4A 1U1UA 2W6RA 3T0CA 2VZUA 2HSAA 1S5WA 3ZR5A 3W2JA 3MHUA 2XH4A 4S3CA 2ZRUA 3CIWA 4KWSA 4RNFA 4XUYA 3GDMA 4IFKB 1R46A 1SW0A 4HJWA 2BNJA 4RE0A 4JFTA 5A5WA 1E6RA 2YDAA 2WMGA 4AIUA 3W86A 3NPXA 5FA5A 1MMFA 3N9KA 4MGGA 1OC5A 5BOFA 1DHKA 4RW3A 3EPOA 2ZKMX 3RR4A 3A21A 3VNDA 1VZWA 5C9XA 3UR5A 4GX8A 5E0KA 3ITYA 1P7TB 4W5ZA 4PUMA 3MJYA 4HNLA 3IJ7A 1OG6A 1WAWA 2XSJA 3MWAA 4E38A 4P61A 4E2VA 3TR9A 2D3NA 3AOPA 1QW9A 1DJGA 2MNRA 1QT1A 3MS8A 5DF0A 3VINA 4MLRA 4L4OA 1IWBA 4HPXA 2NV9A 2E9BA 2FVMA 3MMUA 4RZ4A 2P1FA 1CZ1A 1QBBA 4HBKA 3O06A 4J40A 3WQOA 3CPGA 5AC4A 1GQNA 2JE8A 4DEFA 4OOUA 1QJWA 1Q8JA 1Q2RA 1ICQA 1JCJA 1UA3A 2QMKA 3QMRA 2Y8VA 3DHFA 5DRCA 1GW1A 4UTUA 5HWJA 4LYQA 3MM6B 4Z1CA 3ITXA 1I1WA 1KM5A 2DH2A 2TMDA 1OX4A 4XZHA 4H19A 2OWWA 4I7UA 1MI3A 2CKSA 2BXVA 3HQOA 1ZENA 1NP2A 5LIXX 4NIRA 2ATSA 4UFMA 3TH6A 1JXKA 1TMHA 2V82A 3AMCA 4X2PA 3GM8A 1WX0A 3QV6A 1A5OC 1MQRA 3BVJA 3GSMA 1CEOA 4H3DA 2REQB 5IBXA 4L65A 3P5YA 2RH9A 3LGEA 3G1SA 1H1YA 5BMWA 4ZOAA 2BGSA 3FKRA 1QHOA 1UP0A 2A7RA 1GJWA 2QPXA 2R91A 2L5HA 3PAJA 1XINA 4W84A 4GYJA 1QNRA 5IM51 1WDSA 4FLOA 1J9YA 2PUZA 2XH2A 4JTCA 1IGSA 3QHOA 4F0HA 3N19B 4YJ5A 4LYKA 3E49A 1JJKA 1F3TA 1S2VA 3CZJA 3GAYA 4MJ2A 3BAKA 5CPOA 1A5CA 4DWSD 3A47A 2VFHA 1XI3A 1OIFA 4IIEA 2WMHA 1KR1A 3N15A 1UA7A 4Q8MA 5I3DA 1ALDA 4KRUA 4AX7A 3N14A 3V36A 5T8GA 1BRLA 4DAIA 1TWWA 1EUNA 3IUDA 3NQMA 3UNDA 4B5NA 1ZSXA 4LNCA 1F9CA 4PMNA 3VKKA 1N55A 1TZ9A 3VIFA 4LAMA 4BQ2A 4NP7A 3NUKA 3I6TA 3BO9A 1AQHA 3U5UA 2YBUA 4ROPA 1VCVA 2QQ6A 1VLWA 5DX7A 3HQPA 2AKZA 4CU8A 3THDA 2AL2B 2AMGA 1J0IA 3QV7A 1UWRA 3EX6A 2IMRA 1J0YA 4UQEA 2VRKA 4C6DA 1HG3A 4DXXA 4G7FA 1XGDA 4XAPA 4D6EA 4KIEA 1HTIA 4YYCA 3U5YA 1G4TA 4G5DA 1DJHA 3M0MA 4HMDA 4KPLA 1A5MC 3K4AA 1JZ7A 2I9EA 4FNSA 3W7MA 4B5SA 4KRTA 5EFDA 4DIAA 1ADDA 2RDTA 1CWYA 4NXKA 3GIQA 1QMLA 1ZLPA 5B80A 3TSBA 1Z3NA 3T07A 2PGFA 6TAAA 2PDLA 1ZNNA 2P88A 3HG3A 2DV0A 2Q02A 4O8RA 2J27A 3G24A 5EMYA 4ZQMA 1JQXA 1XGZA 1UWSA 3A9IA 3E0VA 3LU2A 4XG1A 4C6EA 4L5ZA 4ENLA 1VC4A 2GL5A 3W1QA 2Q09A 2PBGA 3PWIA 3Q94A 4ATLA 2SFPA 1Q7QA 2C6QA 2WWDA 3C4UA 3ZIZA 2PP1A 1HL9A 4ZMGA 5B7ZA 1TPFA 3QSTA 1DQUA 2YCLA 3WLQA 3NPWA 1UD8A 3L2IA 3C6CA 3TCSA 3RX3A 3BW2A 4H7ZA 1KQZA 3BCJA 1EH9A 1UWIA 1QCWA 3R12A 3NQCA 1ESWA 2OODA 2ZZ5A 3SFWA 4PODA 3CBWA 3CV6A 1TPUA 2I5IA 2V5LA 3C8FA 5FAGA 3C5QA 1EOKA 4UTTC 4EXAA 2DZWA 1E1CA 1LLWA 1J4EA 1OADA 4L4MA 5H91A 3MB9A 3BOXA 1DOSA 1T8XA 3AXIA 1QOPA 1U5JA 1A3WA 3ITTA 4QXIA 3PZVA 4UFJA 1GOXA 5I79A 1OCBA 4GI8A 4J3SA 5F2IA 1VFLA 4UTIA 3ITOA 2GVGA 3HZ3A 4IIDA 1TO3A 4AIEA 4A8IA 4FF7A 2PRLA 1E0UA 2DZTA 1KB3A 2C1GA 4Y7EA 2C15A 2V0TA 2C13A 3VAVA 3BXWA 5HQLA 2HXUA 3ZT5A 2CETA 1ISXA 3MA8A 4Q8PA 3SIZA 1XR2A 2BY2A 1M03A 6A3HA 2QZRA 1V7YA 4LV4A 5DY2A 5AYXA 3TN5A 2Y0FA 4I5UA 2WVVA 1BG9A 2PP0A 5JMUA 1SW3A 5DEZA 3NO5A 3VOFA 2FFCA 2YDSA 3TA6A 1TRDA 1UR9A 2RAGA 1AJZA 1TPB1 1GVQA 4C6QA 1E6PA 2WNWA 1WUFA 3K4WA 3SGZA 3SGGA 3W01A 3D6NA 4QTGA 4Q8NA 4Q8QA 4POCA 1SFJA 3TYAA 4GD0A 2DFAA 3H55A 1KCKA 3ANYA 4MPQA 9XIAA 1JZ2A 4AVNA 3QZ6A 2PSNA 1UKTA 3DGRA 2J47A 3MUAA 2POZA 1HL2A 2O9TA 4WJ8A 4ASTA 5ABFB 1B3ZA 5AFDA 1EPXA 1TZ7A 1RUSA 1EL3A 4M1RA 2Z1BA 5EBUA 4B92A 1P48A 2J62A 1YTKA 4U2ZA 3TA9A 2PRHA 1VHCA 4XVDA 4LCSA 3ZJ7A 3VU2A 2WC4A 2PDBA 3KW3A 2VGBA 3WYZA 2BHUA 5KTLA 3EOSA 4IPLA 5HPOA 2X1IA 2AKJA 1SMDA 3P74A 1UOZA 2AOPA 1D2KA 3QV9A 2VHLA 2XSAA 1JAKA 4N9CA 2Z2UA 1K8XA 3IWPA 2BTMA 3P82A 3S2MA 1VD6A 1ISYA 2VT0A 3JRKA 4U4MA 1DJNA 3L5AA 3UJ2A 1LG2A 3CZLA 2OXNA 3H4XA 1QUMA 1AOPA 5I2UA 3MP3A 4TMCA 2CIPA 1M5WA 2KAUC 3ISIX 4Z17A 4HJFA 4IMFA 1OEPA 3QKEA 1IYXA 3BGGA 4QQ3A 4WDTA 3TU9A 1AW2A 4ZO9A 3TX9A 4G7EB 1CGYA 3IAQA 2B4GA 4MZ8A 1UH4A 4MOZA 1UD5A 1ZJIA 3H7RA 3U7VA 4IM4A 5D9PA 4B2DD 2HS8A 4ZFCA 2CXEA 4WSHA 1GVYA 3G1XA 4AEOA 2HVNA 3OEXA 1F07A 1GUVA 5CGQA 2CCRA 1J2WA 3MT1A 1K9FA 2A5HA 4C6JA 1S5VA 2PDFA 4LSBA 1X7IA 3NSXA 1H4PA 4XD4A 2Z00A 1XG3A 3DFNA 1BEUA 1VYRA 5FIPA 4MJ4A 5AYYA 2B0MA 2OT1A 1BXNA 2O55A 1MEHA 2WLZA 4TUFA 1Y5VA 3AXMA 1PHWA 2Y63A 2ZA2A 4HA3A 1JCLA 1TTQA 4UTTA 1V0KA 1XLBA 4GJIA 3WDJA 1YNQA 2QKFA 4LU0A 5I77A 1M41A 2E77A 1XYAA 3AXXA 3UETA 4JTEA 1L2QA 2OOFA 1LQ2A 3S6DA 2QXWA 1AK5A 3ZLGA 4NJIA 9XIMA 4YNGA 4HCLA 3IUHA 3UQNA 4BEQA 5T26A 1GVOA 2VDIA 3ZFHA 4HB7A 3ZM8A 4ZZ9A 1SZEA 4HA4A 5CC7A 1IZJA 3NGJA 3R0UA 1PKLA 2UWFA 3IEBA 3H2AA 1BWVA 3OR2B 4XVEA 3C56A 2ATMA 5T9BG 4A35A 1PDZA 3VD3A 2C1IA 4MWAD 1KFLA 1C92A 2TYSA 2A3LA 2EXOA 1OVDA 3HG4A 1A5BA 1QI3A 1TKKA 4LANA 1X6LA 3ZR4A 1C91A 1B31A 4ILSA 1FDYA 2ABAA 5D05A 2WMFA 3MUZ1 5LXEA 3W02A 1WKFA 3P60A 4ZVJA 4M1BA 4HNTA 1LOQA 4J1OA 2PTWA 3AI0A 4ICMA 4GGHA 3M47A 1W91A 2F2KA 2ZQ0A 2EKCA 1E1FA 4MKSA 2FZBA 4NZ1A 3VGHA 2DJLA 3QTPA 4HPHA 2YFNA 3MMBB 2NQ9A 1AG1O 1P0EA 1MUCA 3BK0A 1GYNA 4AD3A 1RV8A 4X2RA 1VF8A 2FZNA 1K70A 5BXPA 2OZ3A 2PRMA 5AVNA 1TV7A 1XIEA 3ARZA 1L0PA 1R3RA 1D8WA 1EJUC 4I7VA 4Y9PA 4O50A 3NQEA 2FZMA 4I8YA 4HZ7A 3PC0A 1LBMA 2DIJA 3LTPA 4Q4MA 2OJPA 3IJIA 3VE7A 5JIWA 3ID7A 2CPUA 2A3CA 4O4WA 1UKQA 2BVWA 1OINA 1YRRA 1WXZA 1ICPA 5M17A 4Y6GA 5H8MA 4AVFA 3W9ZA 4DWSC 2A3AA 5DT5A 4WKAA 7TIMA 1U22A 3UZYA 1QNOA 2E5BA 2ON3A 3HV8A 3CH0A 3NSNA 2VURA 5AKQA 3NQGA 3FA3A 2UBPC 2YBVA 3L68A 1PB0A 1RR2A 4PSRA 3IAPA 3UZWA 7GEPA 3H7UA 2OG9A 4EX4A 1PBGA 4XB3A 1WPCA 1X6UA 2ACRA 3NQDA 4LH8A 3PBGA 1GHRA 1Z89A 2VC7A 2VX6A 3E96A 4H01A 1O1HA 2OQLA 3BCFA 4K39A 3UJEA 1FKWA 5I23A 4H4IA 4QS5A 3UA3A 3AICA 3H23A 2QVNA 3C2RA 4GMEA 1DL3A 5AHMA 3GDRA 2Y5SA 2G50A 3VGFA 3BG5A 2DEPA 6ENLA 1B4EA 3AMGA 4NJGA 4REQA 3GC5A 4LRTA 2GOUA 4DZIA 4XQ6A 2O7SA 1AVAA 3IARA 4M6PA 1CGVA 1TJ0A 3FW6A 3IK4A 4DF0A 5CG0A 4Y96A 1A5UA 1VJZA 1W3TA 5IBXC 3EA3A 1LRQA 3SUVA 4DBWA 4JL2A 3QOMA 3ITVA 1S2TA 3NZGA 4JIRA 5E93A 2QT3A 1KM3A 2BVDA 3E0FA 1WKEA 3EEGA 5H6HA 3WH7A 4IGHA 4TR9A 4AWSA 3SUTA 5BOOA 4QBXA 4O1CA 5I6SA 2V63A 1OK4A 4AC7C 2G4FA 1DWJM 1EJ7L 1FCQA 5M2FX 1TFVA 4AD4A 4DZ5A 1SFTA 3DU0A 3F4WA 5C2XA 1EIBA 4WGXA 3T05A 1Q4NX 3MMCB 4E2OA 3ARYA 3L5LA 3BZJA 1D7FA 1PE1A 1K77A 5EBAA 5D2TA 1DE6A 1ADOA 3TC3A 3K1GA 4L6DA 3FOKA 4NZ5A 3ZJ8A 5D30A 1LUCA 3GB6A 5B7YA 4HK6A 4AYSA 3B0MA 2OSYA 3SSJA 1XC4A 2NQZA 1FWWA 2RDUA 4AZGA 5E5CA 1TIWA 2CZ5A 2GGEA 1R86A 3KCOA 1TR1A 2G96A 1Q6CA 3ZWSA 4O11A 2P0IA 3IIXA 1LG1A 2PS2A 4H04A 2GLKA 3B9AA 4XX6A 4DN1A 3W1TA 1KBJA 5JBEA 3T78A 4FXFA 1LYXA 3OLGA 4AD1A 1X1ZA 3H2CA 4XTDA 4MWAE 1C9DA 1ONXA 5E09A 3RILA 3C2EA 3TXVA 2BY1A 3CWHA 2XIIA 4YLWA 5IHRA 4NILA 4O0ZA 3M46A 3L4WA 1IZKA 1OZQA 3R13A 3QYQA 4IXXA 3E12A 3T2PA 4I5XA 4W4QA 5GVJA 1S2AA 1F76A 1MNZA 1W1VA 4IFKA 2CW6A 4ZCWA 1U30A 2YL5A 1JGMA 2VI0A 1RD6A 2VGIA 1EGZA 3KLLA 3V75A 5C5YA 1OFOA 1SO6A 4MKVA 1FWBC 1TWZA 3ARRA 3TTYA 1WDPA 5BWAA 2VC6A 2FTWA 1PVNA 2GSHA 5BCAA 4PYSA 3GWQA 1PUDA 3DFSA 2ISVA 3DXIA 2QCDB 1BHGA 3R79A 1TYGA 3PBYA 1Q2SA 3LRKA 1SW7A 2FH8A 3VM5A 4JIEA 5DBTA 3MJMA 2GJPA 3IGHX 1FQ0A 4JBRA 1VEOA 4PL2A 1ZBKA 3QFWA 2TRSA 3QQWA 3TAKA 2X42A 2ZYFA 3S5NA 4JIQA 4WCJA 4D8LA 1ZBCA 1OT2A 2EG7A 1K7FA 2ZUNA 5BU9A 1GEQA 3PPCA 5LA2A 1PZ2A 4JN6A 2P5NA 2ZZ6A 1TPWA 1KM1A 1V6YA 2DZVA 4DXKA 1H7NA 3SDOA 4GK8A 3NTYA 5A6MA 3B3DA 3KS5A 5IHSA 2DZBA 4F48A 3G0UA 5E9XA 5DN1A 2Z7GA 4DBEA 2OLHA 2ZADA 3L65A 3H26A 4DI9A 4EE9A 1WQ5A 1UMYA 3STPA 3APTA 2DVTA 3WDRA 1XX1A 1W1IE 1J2BA 1WDQA 2X2GA 4C6PA 3B0GA 1FCBA 3ES7A 3MUCA 2WW5A 1L6GA 2INZA 2HBXA 3GDKA 1SSGA 3S4TA 2Q71A 3W53A 3VD4A 2YCIX 1E43A 1XIJA 2GPTA 1R3QA 3P62A 3LEPA 1FWIC 1H3GA 3SR7A 2ONEA 3EPNA 3T42A 2E3ZA 1THFD 2NT1A 1ISWA 4F3HA 1AL8A 5BRPA 3KVLA 3NOYA 1EHNA 4JN8A 5HUOA 2VVSA 3D5HA 1D8CA 3RFAA 1XYLA 3L67A 3ARQA 3MMWA 5HNRA 4ZQNA 1ZGDA 2OGYA 3M0VA 5FAJA 3L4UA 3BMVA 1TPVA 1OFDA 1SUXA 5KETA 4LUSA 1RBLA 2H8XA 3R0KA 1XLIA 4PUWA 4UZUA 4D72A 4RV3A 1U1HA 1JZ3A 3GDBA 1KGUA 3B8VA 1TPC1 1PX8A 2OMAA 1KQYA 3WFZA 4UTKA 5AZ1A 4J3VA 3QW3A 5AHFA 3KL3A 3WK0A 1JCMP 2EF9A 3NL5A 3NPVA 1JZ4A 1PIGA 1RA0A 4Z2KA 4RPQA 4XBKA 4RL3A 2YA2A 2EPOA 3M0IA 1KFBA 2AL2A 4YTTA 4BI7A 2CHRA 1K7EA 3GFYA 4A2RA 7ENLA 1BF6A 4DWSA 2DUAA 4NJJA 4J3XA 3M43A 5CC3A 3WLHA 1OK6A 5FF3A 4YPJA 3GE7A 1VCFA 4CD5A 4E2BA 2Y61A 1FH7A 3KX6A 2ABBA 1FA2A 2BVTA 4AG0A 2JEQA 5EGRA 1BYAA 4AXKA 4IMAA 3BLPX 2HE8A 5CSRA 3NL2A 4QG6A 2INEA 4DJDD 1UJPA 3F4CA 4DM1A 3A6OA 1EJXC 1V02A 1UP2A 1UD6A 5HQEA 3KDOA 1PHQA 4FSAA 3MCMA 1AL7A 5HMFA 2FJKA 5CAHA 1EYEA 4TTGA 1HF6A 2QS8A 1QPQA 3DCPA 4CUCA 3IGUA 2WQPA 4GWEA 2YXGA 1NELA 2J9ZA 3SCPA 2OKOA 5LYRA 2HPIA 2HEJA 1FDZA 3DUGA 4I6KA 1X8FA 2CLIA 2GK1B 5E9AA 5A8GA 3QSRA 2ZVRA 3W38A 2DT1A 2VVNA 3TQPA 2Y1HA 3V5OA 2PLJA 3TXZA 3K4DA 4X61A 4AY1A 1XLMA 3GHSA 1BGGA 2PU1A 2V5KA 3L4TA 4R85A 1ODZA 4XZBA 4L6HA 3TKFA 1JZ5A 4EACA 3NYZA 3NNTA 2V6AA 5AYBA 3KL0A 4W93A 1XLFA 1UR0A 1QASA 4PUEA 1Y5XA 5D4YA 1WZAA 6PTDA 2DZSA 2GJNA 1EGVA 4ERAA 3VCRA 1ZFJA 1V8EA 1VP5A 4YN5A 2PC8A 3T0TA 8GEPA 3QYSA 3QF0A 3GO2A 3VKPA 3UP8A 1ZJHA 3RLUA 3AIVA 3WMBA 2QAFA 4EPBC 5CLWA 1C8VA 2R82A 3HN3A 4LC6A 4DYKA 1ECQA 3B0VC 4H1ZA 2IKHA 3UG5A 4YWIA 1L8NA 3G3DA 3CJPA 3NDYA 5JVLA 3PZ9A 3QPEA 3NURA 3VTRA 2YPIA 3O63A 4V1YA 4JD4A 4H2HA 4JTJA 1BRLB 3JZUA 3RF9A 3PZIA 4PUNA 2XJ7A 3AFBA 3S2CA 1PSCA 4D8ZA 3DG3A 3WNLA 3L2LA 4HPNA 4CNPA 1VENA 2NV1A 1N2VA 3LPPA 3GNDA 4X9YA 4F0MA 5FESA 1R2SA 1DJQA 2ISWA 4X60A 4KGJA 4MM1A 4B9YA 4K8GA 4NZJA 1JDDA 2CBVA 4JZ5A 4WJXA 3LSBA 4GNVA 5CH9A 3E02A 2FZDA 2VFGA 5GQBA 1DEDA 3NXLA 2W9MA 1W9BM 3MKKA 3TJXA 5I3IA 1PEZA 5IDIA 4AD2A 4CNNA 1BTCA 2YBTA 1IZCA 4RNJA 4AZCA 1OGBA 3LHZA 3DENA 5HK4A 4BK9A 2PTZA 3CUJA 1NWTA 4AZIA 3VIIA 1VJSA 1E40A 4RPPA 3MYPA 1H41A 3GU2A 4YHGA 2A2IA 4P8XA 4KCTA 2WMIA 3GXFA 1ONEA 5CLTA 4U5KA 3WNPA 4AOPA 2B7NA 5LZLA 2DIKA 4L4LA 3FSUA 3MU7A 1K03A 3I6EA 4GUGA 2WZEA 4JQ4A 4ES4A 4AUBA 2ZFAA 4O15A 1NU5A 3A4XA 3GC4A 3KTCA 3N2XA 2VP8A 2QYGA 1TB3A 5HXMA 4WY0F 4JTLA 3BW4A 4YVVA 3T2QA 2Z26A 2D20A 3UWYA 4O0KA 2J4GA 4AB4A 1CXKA 3BMXA 2RGLA 1QI0A 1R8LA 4RNHA 1M65A 4N4QA 4FX7A 4NX0A 3RJYA 3W1MA 1DWHM 1DQWA 1GOWA 3EKLA 2PDUA 3LPGA 4GI9A 3I7RA 4LRSA 1NAL1 3MW7A 3ZZ1A 4JCLA 4PC8A 4INFA 2V5CA 2CBJA 2WNZA 4FNQA 5D9NA 4WDUA 1TV2A 1HN1A 1MZHA 1IF2A 1I2NA 3THQA 2P3ZA 4Y8EA 3QHNA 4NAEB 3VUSA 1YW1A 5CSSA 5EB8A 5REQB 4IIGA 1TPEA 1UMLA 2X1TA 5I06A 3HA1A 1TA3B 2Y5EA 3NQ2A 5A6SA 3R58A 3W7DA 3N11A 3LCHA 1E0TA 2OWXA 3CLMA 1XQLA 2QGYA 4MWAC 4DUVA 4TO8A 4D1IA 3TJIA 4Q8OA 4B2DA 1JYWA 2WB5A 1LL4A 3GEOA 3QN3A 4Z0SA 3C3NA 3R1ZA 4PMDA 1E4IA 1JDAA 3GG1A 1GT8A 4KCUA 3CGTA 3E9AA 2YB1A 4XAZA 2WOQA 3W23A 2NQHA 3MI3A 4MY8A 5FI8A 1BPLB 2JFEX 4F0SA 3CZGA 4N42A 2FJUB 1V77A 4WY0B 1N8IA 4GIRA 4LS0A 3AHZA 5HNUA 4H6KA 1Q6DA 3FYPA 3PF3A 4LS1A 4B4FA 1JPDX 1CBGA 3VD7A 3MMTA 3EB4A 3QY6A 3ARWA 5GPRA 3TEVA 5DCBA 3CL6A 3T6CA 2EG8A 1H7WA 2G95A 4HGXA 3CQ0A 2XU2A 3ARVA 5BW6A 1XH0A 2DDXA 2VOMA 4CCCA 1JNDA 4WK9A 1GOKA 5RUBA 1DV7A 3PR2A 3WBXA 1GTHA 3S5ZA 3XINA 2X40A 2HNEA 4JTQA 3MQTA 3TK7A 2G8ZA 1VYPX 1H49A 1NDYA 2VX7A 5GNYA 1A3XA 2EKGA 3TSMA 2Z0IA 3KCLA 4IMDA 3T44A 3II1A 3AWNA 3G1YA 4I8DA 1HJXA 1TRIA 3W1XA 3FFSA 3O6AA 1G1YA 4V33A 1VB9A 1GYMA 3RR1A 4UFLA 4WDXA 2C0AA 1VKFA 1GZJA 1KXVA 3QXBA 3VVGA 3W1LA 2VXNA 1R3WA 3FAXA 4UFKA 4BF9A 1NQ6A 4IQEA 4PTVA 3I3BA 3GC2A 3FXGA 2PCQA 3WD2A 3KLKA 4IISA 2QF8A 4YHEA 3U4FA 2W79A 3MP5A 3K8KA 3PJUA 5F2LA 1XKYA 5HMEA 1Q3NA 4WX2A 1AA1B 5TIMA 3M64A 4NAEA 3RCNA 1C29A 3W7QA 4KESA 2A6LA 2YB4A 4JHMA 5DQPA 4W89A 1FHUA 3GFZA 3KUMA 3R6IA 4TXEA 3IIVA 1HL8A 1GZ1A 3AROA 1MXGA 1VHNA 1R9XA 4DO7A 1VPQA 5E6ZA 4TX9A 1NP0A 3NXFA 4JCMA 4OE7A 1LWHA 2GDVA 3OW1A 1TZZA 1EZWA 1T5AA 2ZUSA 2PDMA 4Z1YA 5DRIA 2HROA 1LTDA 5FJTA 1XL9A 4IFRA 3K8LA 4E4UA 5LA1A 1EDGA 3CNYA 3S1VA 2WJZA 3RX2A 1PZ0A 1FWHC 1ME9A 5CJMA 1KC7A 1WKDA 1XISA 2QCHA 2YDRA 4IUGA 5K4ZA 3DFPA 4Q7IA 2QUNA 2RJGA 2R1MA 2BASA 4FF5A 1LT8A 4DY1A 2HPMA 3QJAA 3VKAA 2G3FA 2VEIA 4MNJA 1JULA 2UY5A 4HOZA 3CHEA 4ACYA 3S2LA 4ATWA 3VXGA 3L23A 2VO5A 1MYRA 4JKLA 1Z7AA 2XFRA 1MW3A 4LUYA 1MW0A 1W0MA 4E8DA 2QUUA 2OB3A 3R7MA 3SW6A 1GQLA 2WBGA 3GAKA 3IANA 5KZMA 2QDHA 4US6A 3SUWA 3C61A 2E1DA 3DBPA 1XKJA 4FZIA 1IEQA 3VLXA 1Q66A 4MDOA 2NT0A 3CB8A 1NF0A 3WQ5A 4QJ4B 1QO2A 3T4WA 2BXZA 5I24A 3VFLA 4OQVA 3GHRA 2WBKA 2Z28A 3MUY1 4ZQRA 4GXMA 4AW7A 3KRSA 2KX9A 3RK8A 1V3JA 4UZSA 3V5FA 3R5EA 2XSXA 5AHIA 3ECQA 3RN6A 4US5A 3VDHA 4LAOA 3PY2A 2B7QA 2V30A 5TNVA 5GNXA 4HA0A 3FVMA 4L61A 4QROA 2VR2A 1XRFA 5EFFA 2GEPA 3WNNA 3B0HA 2P3EA 3APGA 1W1A1 2GGHA 1BYCA 4E4PA 3SI9A 3WQFA 3BLIA 3CAWA 4AMAA 3RRXA 1WZMA 3VKTA 1W5QA 5H2ZA 5CPNA 3C2FA 2VFIA 4W7UA 1JF5A 2ZUUA 4HCHA 3SQLA 2J79A 3O15A 1QRQA 3G5EA 2W0UA 4M19A 3HU7A 3GHUA 4IOTA 4OT7A 2XIOA 2BOEX 3PPGA 1MXDA 1VPYA 2XGIA 1A5LC 3USBA 1FWCC 1I2PA 4YU1A 3H7VA 2P76A 4Y2WA 3GVVA 3W7IA 3NGFA 3I7QA 1SPQA 1YPXA 2A3BA 4F2UA 2CXGA 3P6LA 3GNPA 2NXIA 5EMMA 5ABTA 1GNXA 3NO1A 4OU1A 1V0MA 2O9OA 4AYGA 3D47A 4HNNA 4WQ6A 1TMLA 3WEZA 2GVEA 5FL1A 2P8BA 4BFAA 1IWAA 3B4YA 4PMYA 5E1QA 4D71A 4Z2JA 4Z0JA 3QLLA 3SAZA 3WKZA 4LALA 5HR6A 5TF0A 2OZTA 1BVNP 1ZJBA 1JDCA 4O17A 9CGTA 1OFBA 1RJRA 4Q4SA 5A8NA 1TX0A 4LAKA 4LUTB 3EWWA 2ZZ3A 1K1DA 4DM2A 1ZAHA 3VIMA 3L2MA 4WGHA 3OLIA 3TTEA 4O1DA 3A64A 2IKIA 3WF1A 3EA2A 4BKNA 3NQ6A 4C1NA 3U7BA 3WK3A 3HV9A 4OIFA 4WLCA 3RM4A 2J7FA 4Q4QA 3RRAA 2PGEA 5M03A 4GI4A 6REQA 3ATYA 4O0QA 3VLYA 1E6QM 3PBVA 4C6IA 1HKMA 1A49A 1CLKA 1XFBA 2V68A 4QE4A 3KM8A 4I9TA 3RLGA 4FMVA 1BF2A 3VGEA 4AEEA 3AYVA 3GS6A 4UMCA 4WR3A 2ZWZA 4PB4A 3PSVA 3UXAA 3BV7A 3LOTA 3LRLA 5K7JA 5I03A 5F4WA 3W75A 1KNWA 1I60A 2BMBA 2WVUA 1L9WA 3VABA 4PMOA 2DQWA 2Z6JA 5AHLA 4M82A 3VMOA 5DO8A 3O6CA 1KV8A 1ECEA 4CEUC 3ARSA 2WSQA 2AQWA 7ODCA 1PIIA 1UR3M 1H7OA 3TN4A 3U4AA 2FDSA 1RALA 3HGOA 1UPPA 3LNMA 1C90A 2Z4GA 2GDQA 4QITA 4K36A 1NEYA 2FPYA 4ZE4A 1TJ1A 1JEZA 4DJDC 2ZX8A 3DX5A 1FY6A 2V38A 3W2UA 1SZFA 2QLYA 3QMTA 3N4EA 3Q2DA 5J5RA 4AMCA 3M7WA 4Q4KA 3W6MA 1E1EA 1POJA 2OQHA 3DG7A 1GCYA 1GKRA 4R3UA 2VNCA 3QQ1A 2BG5A 1K3UA 4U10A 3W07A 1S2WA 2QDDA 1C3FA 2O9RA 3LERA 3B0UX 1J96A 3LMZA 4YWSA 4L64A 3BDKA 2J9YA 4MPKA 1MFUA 2VFDA 3W83A 1JCTA 2ZE0A 1QXLA 4B5XA 4S2BA 4GNKB 1GTEA 1VFOA 4XZIA 3WD4A 1PYFA 2HJPA 4FX6M 3LV5A 4HU4A 4YTQA 5EMKA 4C5YA 3GNRA 3KBVA 4MB1A 1W3LA 4IP4A 4OOZA 1WDWA 1JUEA 4EOUA 2CLKA 3I10A 2ZUWA 3LBCA 1AD4A 2CERA 4NX5A 3GH5A 1NSJA 1HT6A 4C1NB 3DYMA 2RUSA 2VMFA 2FB2A 4PULA 2IQDA 3UR7A 3U0HA 1AH0A 4K6AA 4C90A 1Q6LA 3EDFA 4WRHA 5A94A 1XLDA 4M6UA 1H62A 3E6EA 4H8NA 4O16A 2D2OA 2DVXA 3F03K 3PFRA 5C71A 4K37A 5HWMA 1IV8A 3QRHA 4NAFA 4WSKA 1HKJA 1QW8A 2BXYA 5FEXA 1OABA 3NYDA 1VIZA 1DJIA 2QF7A 4QS6A 5LXXA 2V2DA 3NL3A 4M56A 4X0VA 1R9YA 2YW3A 4KWUA 5XIAA 5CZJA 1JCXA 3G3MA 5BXSA 1G7VA 4LUIA 3CPUA 3MM7B 3OOQA 3MUIA 1OC6A 1XIIA 4KEVA 2XVNA 2WO5A 4GQQA 3T4CA 1CI1A 5A6TC 2PWUA 4ACZA 3FEQA 2A6NA 1Z6KA 2JKPA 3FN9A 4GXWA 1MNSA 5D2WA 1JPMA 4X9SA 3H21A 4H9YA 3NDOA 2B7OA 3UR8A 1E9LA 3UCQA 3C0JA 3WJXA 1F74A 1TQXA 3GDTA 3BLEA 1O12A 3EMCA 3BSMA 2WMKA 3TROA 1XWYA 4S3DA 4A8NA 1FWTA 3K8MA 4TU1A 2G4JA 3DESA 1XLJA 3ATZA 1KFWA 4QAIA 2E25A 2JEPA 2XSBA 3DEQA 1TTPA 3DKJA 4W9TA 4JQ3A 3VZZA 3W82A 1DKWA 3VD9A 1VLIA 1KW1A 3U9IA 2OO0A 1P1XA 4RXFA 2E8YA 2HTMA 4WHBA 4LC8A 3B03A 3EXRA 4L7ZA 3S46A 1KTNA 3BUVA 3O3RA 2GGIA 1TA3A 4HPGA 3LS9A 2H3BA 3OGSA 4FX8A 3OLDA 1V93A 4O54A 4G9PA 3CPRA 3WQDA 2PF0A 1X97A 4X63A 2BSLA 4MSSA 3GBDA 2I7GA 4QRNA 3LN3A 3NZPA 3RO6A 3CK5A 4B5VA 2OOGA 2H9AA 3WLTA 1JCYA 3BICA 4MF4A 1SYTA 3CUFA 2GQ9A 3W1AA 3IVSA 5D2YA 4K1GA 4LQ1A 1EXBA 1GVSA 3VNIA 3PTDA 4ZXLA 2YCKX 2VR5A 5HUPA 4JTHA 4MB5A 3QVQA 3QR3A 4E2DA 3VGBA 3DFYA 3AIWA 3GH7A 5CZTA 1K9DA 3WSUA 2QCLA 5FF2A 2ZRXA 3VNMA 3ZVIA 5KZDA 1CTNA 1Z9AA 1V79A 5G1TA 2V67A 1ITXA 2I17A 2CLOA 1UC4A 1G69A 2J75A 1SR9A 2E40A 3S8HA 3ZXWA 3MWCA 4CNUA 3DECA 4M51A 3PWGA 5LGZA 3ALGA 4KWOA 1S1RA 3GZ3A 1GZGA 1W32A 1K8ZA 3SZ8A 2DW7A 5C2GA 3SGUA 1S3TC 1SJAA 3TLQA 1KCZA 5DMNA 2Y2WA 1H7RA 2OGJA 5M3WA 4GVIA 3Q65A 2PWHA 2YZ5A 2VFEA 2Z2AA 1CYGA 3LA4A 2XFYA 3A24A 4UXDA 2GWNA 2VGFA 2G97A 4ALDA 3UU0A 3IGXA 1FKXA 2EO7A 4MJMA 4F8XA 4CNSA 3B8WA 4AWEA 4CCZA 1LORA 2WSPA 2J8TA 5HA7A 4BR1A 3FA4A 5C54A 1B9BA 2VUYA 5KEZA 3STGA 2DVUA 2J24A 2W4XA 2W27A 5DXXA 2IXVA 4BWLA 2D0FA 4AD5A 1UW9A 4OTKA 2VZSA 4HVXA 1ONWA 5AN7A 4UTLA 2Y5JA 3TW7A 3SQSA 2A7NA 4HU0A 3CL8A 1FOBA 1UP3A 1UZHA 3MMDA 3VM0A 2AAMA 2PB1A 3BOLA 3Q37A 3RAOA 3PPFA 4UTFA 2PDKA 4IH3A 3URQA 3W4RA 2H6RA 4N4PA 1HP5A 1FWNA 3ES8A 1KV5A 1LBFA 2NZLA 3O8AA 1M53A 4JFWA 4MB4A 4PMQA 1HKVA 1KRMA 4UQ9A 1I0DA 5DBUA 1FWAC 2PDQA 1Q6EA 1FCUA 4LUSB 1SJDA 4O10A 2AL1A 5D9MA 2DP3A 4LTSA 1LLOA 2HXTA 4GI6A 1LRTA 3WELA 3WO8A 3OG3A 3VNYA 1B0IA 3S6OA 3NA8A 2ALDA 3W37A 5U7SA 1ZBVA 3C3UA 5MF5A 3NQFA 1RHCA 3ZLHA 1W6TA 5AC7A 1RBOB 2WJFA 3QGVA 2NV2A 3TYDA 4NZ3A 1JVNA 2PZNA 4JFVA 1YE6A 4FXSA 3W25A 3MZ2A 3S5OA 2C1HA 3GXDA 5EMLA 5EMUA 1ZY9A 3W6YA 1QDSA 3VNJA 2PDHA 1M7JA 1F3XA 5JUVA 1DXEA 5HOSA 2E1WA 3AQUA 1QK0A 1E4LA 4UMAA 4BA0A 3UVIA 4MG4A 1H63A 2FGBA 3TJLA 5HBFA 3DYPA 1MUMA 3BH4A 1X7FA 2B81A 2PEVA 1KGXA 3P0XA 1I2RA 5DELA 2J7BA 4XSMA 2ZBTA 1FWEC 2R9RA 4O53A 3EOEA 3KZPA 2Z6IA 3BLDA 1A5SA 4EPEC 2XM1A 2NWSA 2ZDRA 3CYVA 3QR1A 4ZA0A 3G0SA 1ZHAA 4IFOA 3WL0A 1DIEA 3LM7A 4JNYA 4KRZA 2VRJA 3E2QA 3T08A 1XHGA 3QY7A 5IOBA 3FJNA 4C5ZA 2PODA 1KRBC 1V0NA 5FJRA 5CXPA 4U33A 3WF2A 2C79A 3VLZA 2E0PA 3EXTA 2YR1A 5FJIA 4A2SA 3UWZA 1FP8A 2F6XA 2VX4A 2X1RA 3RMJA 3O1NA 3AIBA 2C0HA 2PA6A 1G9HA 2FTPA 2GGGA 3L0NA 3KWXA 4X0NA 3ZMRA 3WFLA 1ZBWA 3SRDA 3KBWA 3W7RA 4YXGA 4Z1DA 2V4JB 4DBDA 3PSWA 5M1TA 4BF7A 4B5UA 1VIWA 2NUYA 3Q45A 1TVPA 2Q01A 4G2DA 4H6RA 1XFCA 2AKMA 2YKKA 3TZNA 3RU6A 3LHTA 1UIOA 4ZO8A 3TVAA 4DUXA 1DXFA 3C2VA 4G39A 1H60A 4GOAA 2VD9A 3WDQA 3TFXA 3NVDA 2GVYA 3LB0A 3ONBA 3LRMA 5AC5A 3S6TA 4HIBA 1AQ0A 1ML1A 4DRSA 3R0DA 3T55A 4FB7A 3PNZA 4GYKA 1XDMA 2IQ0A 3S9IA 3G1HA 3O9NA 3MCNA 4O8AA 1LM1A 5BZAA 1WKYA 4JNZA 1W54A 1PX4A 4IGSA 1O5RA 3DFQA 2VRQA 2Q3RA 4PSPA 4AHPA 4Q8VA 3JZEA 2GFTA 4DX3A 3MM5A 3ZVHA 4AZ5A 1GOMA 1FWDC 3VDGA 3E74A 2PF8A 3VOGA 2WCGA 3KWSA 1VAHA 5LIWX 3PAOA 1CGXA 5AOPA 1TVNA 5IFPA 4IJBA 3D0CA 1B90A 1F3WA 1ZTVA 5A69A 3CTTA 1QWGA 1UC5A 1SZRA 1UBSA 3L66A 4C7GA 1PWLA 1W37A 1VFUA 1OX4B 1K8CA 4G8TA 2QCNA 1LDCA 2R1LA 3W24A 2JF6A 1FHVA 1OD0A 1RCQA 1G4PA 4XD3A 1YPFA 1DJXA 3WDPP 3ZOAA 2CITA 2ZRWA 4H7CA 3M9YA 1L6YA 2Y8UA 5J8LA 2BV9A 2OLAA 2VKZG 2QHAA 1KXHA 4QCFA 1W3IA 1OFAA 2J13A 1RJPA 3LCGA 4HN8A 1FDJA 3TR2A 5C70A 1XUZA 1J5TA 3ARPA 1KFJA 3VDCA 3Q4DA 4XBJA 3EGJA 1F2JA 3GY1A 3WIJA 1QBAA 3LCFA 4OHQA 3BLLA 3GVWA 2GVLA 2H3DA 3HQ1A 4C7FA 1I4NA 4GH1A 2C16A 4QIUA 4ZQPA 3V1PA 2NQJA 2VM8A 1GWJA 1UZ4A 4GZ7A 3N2TA 1FXQA 2EHHA 3B0NA 2UV8G 3W7OA 1RVGA 1R7OA 4P8WA 4LEQA 2GQAA 1EFZA 1UD2A 2OKTA 1Q7MA 3EX3A 3AYRA 4LT9A 1PZ1A 4D9PA 3RPTA 3LY0A 2XVPA 1PTGA 2C71A 3RLVA 4DO4A 5BNKA 4KERA 3VA8A 3OB8A 1B3WA 1R2TA 1K9EA 2OEJA 3QZEA 4YVXA 1MRAA 4A05A 1EDQA 4IIBA 3FA5A 1UJQA 3JS3A 4UNLA 3UD6A 3ZVHB 4WEVX 1RP8A 5EY5A 2VOTA 4UOQA 1KFKA 3MI6A 3RCYA 3S9ZA 3U2EA 4EANA 1SR0A 3KHJA 2D0HA 3LNPA 1JUBA 3RPDA 3N4AA 3HF3A 3THCA 4B9ZA 2GWGA 4CVWA 5FEWA 1TPH1 2OU4A 2W3ZA 4D6GA 5C55A 1WOBA 5HINA 4Z2LA 2D24A 2VQTA 2AAAA 1GOIA 1IEIA 1E5JA 2G5WA 4HYVA 1XBZA 3E0IA 1O5QA 3C8NA 4V2XA 1MXSA 3DGBA 5H1WA 1GW9A 5I5RA 1XYZA 3L4ZA 4GBDA 3EXSA 1M7OA 4OWGA 3UBPC 3M0YA 4O52A 2ZWYA 2NXGA 1V3KA 4DLMA 3TW9A 1O6IA 3TSDA 2E6YA 2V2CA 2PFHA 3OZOA 1MWOA 1HKKA 5HWNA 3B9NA 3P3BA 2TPSA 5CAKA 2J8GA 3LZ5A 3UYCA 4BI6A 5FJJA 3MV11 1XLCA 4EAMA 2A3HA 4LVGA 3V18A 1YTDA 1XLKA 1REQB 2ZX9A 5DCEA 3MUXA 5HAOA 1R0MA 2CESA 3BSGA 4OKDA 1CB7B 3I68A 1IQ8A 8TIMA 2WVTA 3T0BA 3PM6A 1UUMA 1DTNA 1TX2A 2ZTJA 3UERA 2CLFA 3CV2A 4GIEA 4HOXA 2PP3A 2VWTA 3EOOA 1WUEA 4WVXA 4QDWA 2PWVA 6GEPA 4TMBA 1QHPA 3IJQA 4DWSB 4WSJA 1QW7A 2ZZ2A 2FHFA 3M0KA 1T0OA 3AIEA 1GHSA 1KBIA 4GABA 3VKCA 2X7WA 4LPCA 8XIMA 1JD7A 3PULA 1ZZMA 4A29A 1F3EA 4EF8A 3SRKA 3UWQA 4GISA 3ARXA 2CLHA 3KL5A 1Q65A 1XSKA 4TVDA 3M5ZA 3WLLA 2VENA 1IWPA 3EEZA 4S2CA 1JD9A 3A4WA 3R25A 1TJPA 2CLLA 4GYFA 4UR7A 1W3HA 1ZB5A 3WL1A 3TTOA 5FF0A 3UJSA 3SEPA 4PZVA 4A3UA 3VNZA 1UZ1A 4PB3A 3AIUA 4GVGA 4FIQA 3ELFA 4JKKA 1JIBA 3V3WA 4N6EA 2YSWA 1YDVA 4D6FA 7CGTA 4LWWA 1G4EA 1J6OA 5HNNA 2I1OA 3C0SA 3G1RA 1Z42A 2DU2A 3MVTA 3ZS4A 1TJRA 3VIOA 1AH3A 1J79A 1H0GA 2VC5A 4MAVA 4A4AA 3BJTA 4DJED 3I4EA 2A79A 4E3VA 5JBFA 1GOOA 1QTWA 5SWUA 2I9UA 3E2RA 1V3IA 3B04A 4GH3A 3D46A 2VJXA 2DSVA 3UVAA 3B8IA 4BEUA 1XYFA 3KVMA 2PDIA 1R38A 4MDPA 1C8XA 3QC0A 5H8UA 3GVQA 3TTQA 3BC9A 3CB3A 2OQYA 4LY4A 2ZX7A 4L4PA 4LXFA 3DKLA 2O7QA 4FEZA 5K4XA 3L12A 4R27A 4B5WA 3AYSA 3TWAA 4W88A 3W6LA 4GYPC 3BJFA 1Y0EA 4MJZA 2FGZA 1M9HA 3F5KA 3IIZA 4Q6JA 2QMJA 3GVRA 1G01A 3ARTA 5I7GA 5A6KA 4GQGA 3AIQA 5BRBA 1VCGA 3FHQA 4K38A 3WLKX 3SRFA 3EKZA 1H50A 2DQXA 3VKRA 3VKBA 2QUMA 3RYSA 1TUXA 3TC7A 2WHKA 3VKJA 1BVZA 2D2GA 4E5TA 2YOCA 3ITGA 4KQNA 4LVBA 3LTSA 2ZC8A 1UR1A 4XO7A 3KCJA 4CU7A 1E9ZB 3TYEA 4N9DA 2XFFA 1EB3A 3O6DA 2JGYA 3Q67A 4RR4A 1JPKA 3WQCA 4JYDA 2BLEA 3KBNA 5J04A 3VGGA 1Q85A 4CCDA 4UQBA 2FHCA 4JHOA 1RY0A 3GK0A 3NAVA 4UWMA 2DSUA 5BU6A 3WF3A 3CS2A 3OYXA 4WZHA 1BSIA 1FX6A 4ERGA 5AECA 2CWXA 4GQBA 4PMXA 1WOAA 3TFCA 2Y62A 3CLWA 1JF6A 4GO9A 4X3ZA 2V3EA 4GCXA 4JTIA 1UBPC 2ZA1A 2BFGA 5ECUA 2VZOA 4IGNA 1JFHA 1MW1A 2WHJA 2NX3A 1XIDA 4KMQA 1XUUA 1VYSX 2QNEA 2C18A 3TZFA 5D8WA 2OO6A 2Z1SA 1TUFA 2W63A 5DMYA 4HHLA 1A0EA 1N8WA 4RLIA 4UTHA 5LNVA 2QJGA 1R9ZA 1VBJA 3MKVA 1HFBA 4RE3A 2VDHA 3CV7A 5G4EA 3UZJA 1B30A 3APYA 2EAWA 3N2CA 2J7EA 1W56A 5CBBA 1WCGA 1QOXA 3G0XA 4LB3A 4UB9A 1M7XA 2H9AB 1G67A 4GZEA 5F1VA 3EWXA 4DJDA 1IEVA 1AD1A 3FX4A 1XPYA 2ISDA 1ZAJA 4NRRA 4J3TA 2ZXBA 5C9ZA 3G1DA 1A3HA 1WV2A 3OZPA 5A2BA 3PTKA 2Y24A 5G4WA 1OF8A 3WK1A 3R8RA 3BARA 1UD3A 5I3FA 4LAZA 2XN1A 2OYMA 1W1ZA 1FWSA 3PG8A 4S3AA 3W1UA 3WLIA 2XVLA 4LW7A 3WH8A 2OZ8A 4K3ZA 3AHTA 1XPGA 4ZL1A 4UNIA 1VRXA 1O5KA 1D7KA 2ZICA 2UY2A 4LJ3A 1ME8A 1HIZA 4LBUA 1OC7A 4TX8A 3AMKA 4HU3A 1TWDA 4YTSA 1AJ0A 3GNOA 3BAJA 2NVCA 5KITA 1ZCCA 1W1B1 4PUJA 3NSMA 2V5BA 3HG5A 2C8NA 1GPFA 3QW4B 4FNTA 4ADTA 4N02A 2ZXAA 3PN8A 2YLAA 3PANA 1E3XA 2HRWA 5PTDA 4B5TA 1KLZA 5C0QA 4DBSA 1XCXA 1QOQA 3C2YA 4CQ8A 2X41A 2XN0A