4G9RA

B-raf v600e kinase domain bound to a type ii dihydroquinazoline inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyrazolopyridine inhibitors of B-Raf(V600E). Part 4: Rational design and kinase selectivity profile of cell potent type II inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 77
structure length 262
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g9rA01
1AD5A 2E9PA 3MPAA 4F1MA 4RIWA 3DOGA 1Q41A 4QMXA 3TKHA 4X3FC 3FMKA 2V7AA 4ONAA 4EOLA 4PNKA 3ATTA 2G1TA 5J1WA 3MBLA 4NZWB 3GVUA 5D1JA 1PMNA 3QUDA 3IDPA 4M12A 2HZNA 4QMNA 2JDTA 3HL7A 4QP4A 3R8MA 5C8KA 3N4VA 4RIYB 4F9AA 3Q2MA 2C3JA 4CFUA 1F0QA 3A7FA 3FLWA 3NR9A 4AGDA 3AGLA 3DCVA 3UMWA 3HMOA 1FVTA 2PE2A 2X6EA 3R8VA 4QMZA 3ZEPA 4EWQA 4HCTA 2I1MA 3ZOSA 3FHIA 3GOPA 1OIRA 2C6DA 5M55A 5DT0A 4IFCA 4X2FA 4I23A 2OJJA 3O17A 4Y72A 4BHNA 4CTCA 4EH4A 4USEA 4YBKA 4J95A 3V6RA 3VUMA 2SRCA 3EN4A 4S2ZA 2PUUA 5KNJA 4CRSA 3C13A 3KN5A 1XH4A 4FT7A 4UWYA 1BUHA 5BVEA 3ROYA 2W5HA 5JH6A 2QO7A 4NM7A 2ONLC 4YMJA 3UQCA 1ZYDA 2C69A 3PXKA 3DS6A 3UMXA 4CFMA 1HCLA 4XP0A 5FD2A 3EH9A 2OJFE 3SDJA 2VTAA 1BX6A 4RJ6A 2XYUA 3UC3A 4Y5QA 4AFJA 3VS0A 5CSXA 2R64A 3I5ZA 3C4FA 4OTPA 5HO6A 4NKAA 2JBPA 2GTMA 3E88A 4IM0A 5L3AA 5EFQA 3WE8A 1GIJA 4MXAA 4QMPA 3CJFA 3PY1A 4M66A 5TO8A 3IW8A 5ANDA 4ANQA 3QRTA 4NM5A 5J5SA 3DT1A 4OTQA 3SA0A 3EN5A 4GUEA 3AXWA 1WCCA 3CC6A 1BI8A 4MKCA 4IACA 3D2KA 2QKWB 1OBGA 3F3ZA 1O6LA 3GFWA 3HMIA 4OTWA 1OL1A 2YWPA 3LFCA 4O0UA 2UVXA 2ITTA 5C8MA 2V62A 5J9YA 3FHRA 4K0YA 4O0TA 1WBWA 3TKIA 4WSQA 4BDCA 3F7WA 5JGAA 5JEBA 3DKGA 2YM4A 5A4TA 2PVNA 3UZPA 4H3PA 3C1XA 4IAIA 1K2PA 2F57A 4J53A 5LCJA 2A27A 4IC8A 1OPKA 4YC6A 2OF2A 3TZ7A 4M67A 3RCJA 4AWIA 4BVUA 2Y4IB 4CKIA 4RX5A 4J8NA 1REJA 2XM9A 3BU3A 3ZUUA 1YI6A 3MTFA 4O0SA 3ZXTA 3KXHA 2OJ9A 3HV3A 3I79A 2X4ZA 3MVMA 4WIHA 2B9HA 5EOLA 5AV3A 4LOQA 2W96B 2WMSA 4AS0A 1PXLA 2ITXA 3DJ6A 2RL5A 3EZRA 3POOA 4TRLA 3THBA 4TYHB 5AUZA 3LMHA 3R7VA 3PXZA 3NAYA 4JBOA 5L8LA 4BKYA 4ERWA 2HW6A 3QYZA 4LL0A 5D41A 1JWHA 2WEIA 3D5VA 4IVDA 4BDHA 2I6LA 3KXXA 4M69A 2VUWA 2BZIB 3HECA 3Q2JA 3LLTA 4I94A 5KKRC 2R3FA 3UJGA 4IB0A 4NTSA 5EI2A 4EK6A 2QOQA 3ORMA 2V7OA 3R6XA 4QYYA 5CANA 3I5NA 3DNDA 4ALUA 3SKCA 4X7QA 4HYIA 1YDRE 5ANEA 1G8AA 4CVAA 4FVRA 3R2BA 1KWPA 2DYLA 4D58A 2W9FB 2C5VA 2PMNX 3OHTA 4IE9A 5E8SA 3FLZA 1K3AA 4PDYA 2O65A 1Q8ZA 1WBPA 3FMDA 4F7JA 2JDSA 4YZNA 2W1FA 3WF7A 1Q4LA 1NXKA 4O0XA 4DTBA 3CIKA 5AUXA 4FTLA 2C5OA 3CTHA 4MXOA 3BYSA 5BYZA 4Y73A 4E8AA 3D7ZA 4N6YA 3WYXA 1OM1A 2PK9A 3M2WA 4V0GA 3SW4A 2QQ7A 4ZP5A 3LE6A 4Z7HA 2XZSA 2WXVA 3C4EA 3S0OA 4PX6A 4PTCA 5CI6A 2Q83A 4JQEA 3QALE 2JEDA 2OZOA 3KKVA 2HWOA 4C38A 4DH3A 2PTKA 4FV3A 5CEMA 4B0GA 3GC8A 3BHHA 3CPCA 4TT7A 4C4GA 4RGJA 3KXNA 5C01A 4BCQA 3CGOA 4D1ZA 4ALVA 3D5XA 4F9YA 5A6NA 4YZCA 3V8WA 5BMMA 5HU9A 4IEBA 3MW1A 2VX3A 3RBWA 3OG7A 5LXMA 1B6CB 3E87A 4DEGA 5LVPA 3DTCA 2QOOA 1OIYA 4PDOA 4RZWA 4TYGA 3VHKA 3VS4A 2X2MA 2YDJA 3QRUA 2E9UA 4KRDA 2RKUA 2ZAZA 5KMNA 3VS7A 4FSMA 1M17A 3VW8A 3PXYA 4KIKA 1MQ4A 5CU6A 4TYEA 2V0DA 1WMKA 2EUFB 1PMEA 3C4WA 1H26A 2WTKC 4MBIA 4GIIA 4HCVA 4NM0A 5JFSA 3VBWA 5IQDA 4RRVA 4E26A 3ZBXA 4FOCA 4AN3A 1J7LA 4F0IA 2JKMA 4C3RA 4A9TA 4NYEA 3MIYA 4UZHA 4ZLYA 3GC0A 4RJ3A 5EHLA 4L7SA 4AA0A 3O23A 5EOBA 2EXCX 3F3UA 2PVRA 2J2IB 2XYNA 3GBZA 3SLSA 5AP1A 1PXPA 1YW2A 4C4JA 4BBMA 1YXVA 4PTGA 3V5PA 3VUIA 4XLVA 4C61A 4DFYA 4GK3A 5CF8A 5B0XA 3TNIA 1BL6A 4A9RA 3NCZA 4F0GA 2BKZA 4FIFA 5KCVA 4W8EA 4IIRA 5HORA 3HRFA 4UWCA 4I4EA 2HENA 5HIDA 4ZLOA 3OZ6A 2CSNA 3GQLA 4ZMEA 4FMQA 4F7LA 3LKMA 4YP8A 3TCPA 3DLZA 4EEVA 3F9NA 2CCIA 3OCTA 3RWQA 5IUGA 3HV6A 1GAGA 4FTJA 2AYPA 4YLLA 4O2ZA 5HGIA 2JDRA 4RX9A 1TQIA 5F1ZA 3TV7A 5DGZA 5AM6A 3RPVA 4OTFA 1CKPA 4IWPA 5FTQA 3NAXA 4DE4A 4FTIA 3FXZA 1JLUE 3TIYA 4E5AX 2W1EA 4G31A 3LFAA 4KAOA 4PP7A 2PPQA 2QOIA 4CKRA 4FC0A 2PWLA 3W2SA 4BIDA 3KY2A 1WBOA 2ZMCA 3FL4A 5CWZA 3QHWA 4YLJA 3OCSA 4BN1A 5EDQA 2HOGA 4ZSEA 4F7SA 4X2JA 2WQOA 3D94A 3UE4A 5DR2A 4NU1A 3DBQA 2YLFA 3Q9XA 1GNGA 4G3CA 3GFEA 4J71A 2YIWA 1FINA 2XF0A 4AQCA 2NP8A 4G34A 3FMHA 1MP8A 4WNPA 3DNEA 3A4OX 3F61A 3DDQA 4LRKA 4OTIA 2EB2A 3KRJA 4JX7A 2XNPA 4ZY4A 2C5NA 3ZSIA 5A46A 5IMEA 5DEWA 2VO0A 2BZKB 5FTOA 2GNFA 2OGVA 3AMBA 3F2AA 4O7NA 4B4LA 2CMWA 3D7TB 4ZEGA 3ZTXA 2CGWA 5BPYA 2W1DA 2BFXA 4WRSA 2IVSA 2QKRA 4UEUA 3CD8A 3H3CA 3PVGA 4O1PA 3WF9A 4E7WA 4YLKA 3SQQA 4BDJA 3H0ZA 2GU8A 2BAKA 4KSQA 1Q99A 3HA8A 4U80A 2VTIA 5JRSA 3BHUA 4CLJA 3G0EA 5TF9A 4YO6A 1KOAA 4FSQA 4IADA 5CU2A 3QCYA 4BZNA 3DBFA 5IQBA 3CE3A 3HRCA 3FZRA 3LFEA 2X9FA 2UZDA 2PZYA 3EYGA 4FZ6A 4CSVA 4EH9A 4K2RA 1XBCA 3H4JA 4V05A 4LV8A 2VNYA 4PWNA 3O8UA 4KKGA 2REIA 1ATPE 4GFOA 3ZRKA 2YFXA 4TKSA 4II5A 3BPRA 4YHTA 4PMPA 4F1OA 3UP7A 2R0UA 3C51A 3DDPA 5EQYA 4D9UA 3UYTA 5IQHA 4J97A 1OB3A 3MS9A 2W99B 4IH8A 4CG8A 3R73A 4BHZA 2IPXA 3RK5A 3PJ3A 2J0JA 3R63A 3VN9A 1SNXA 2Z7LA 4GH2A 2JKKA 4BTFA 1R0EA 1PXOA 4YZBA 3VO3A 4AE6A 4AN2A 5E4HA 4TZRA 3VS5A 2IN6A 1R78A 2O5KA 2IWIA 3JVRA 5JZNA 4C62A 1VJYA 3FJQE 4K77A 2IW9A 1Q3DA 3O96A 3RAKA 3ZFMA 4FICA 1KE9A 2Y4PA 3BE2A 3MFTA 3MH3A 4KBKA 5DHJA 4CFNA 4EHVA 3GU5A 4GKHA 5J7HA 4U41A 4YJOA 4R8QA 4WA9A 3RAHA 1RW8A 2VTTA 3FZPA 5HICA 4BDBA 2XCHA 1YWRA 1OIUA 4X2NA 3FLYA 3QZGA 4FL3A 1A48A 3K2LA 3PIZA 4AA5A 2Z02A 3ZH8A 4E6DA 4XOZA 4FV1A 4LGDA 2BCJA 3BU5A 1XHAA 5M4CA 5AP5A 4GJ2A 4JVGA 2UZUE 3FMMA 3NUPA 2W17A 3PFQA 3EJ1A 3P79A 2XRWA 5HG5A 4B7TA 2QG7A 4ZLZA 5FDPA 4HYUA 3ZO4A 5DIAA 5IA4A 4FEXA 4JBQA 4ZTHA 4O6EA 4MF1A 5BUIA 4J1RA 2XIRA 2OO8X 4DG0E 5IA2A 2XIZA 1AQ1A 4MQ2A 4FV2A 3VUDA 1GOLA 5E91A 3OUKA 4D2TA 4EJNA 3MVLA 3FQSA 4LV5A 3H10A 4NKSA 1IR3A 3MJ2A 5IPJA 2QD9A 3LQ3A 2YIRA 5AFVA 5KUPA 2WQBA 5L4QA 4M97A 1YXXA 4IANA 4EZ5A 1H0WA 4CFXA 5CX9A 3TXOA 1H28A 1YOMA 4FIEA 4W4WA 4L01A 4KKEA 4BCMA 2PMOX 4F6UA 5K4JA 3OD6X 2IW6A 3BKBA 2CCHA 4I24A 2WNTA 4AOIA 4F6SA 4KA3A 2A0CX 4FTOA 1JVPP 2IVUA 2J4ZA 5E8VA 3RK7A 3WZDA 4K9YA 3ZBFA 2IZRA 3IK3A 3Q4TA 5BUJA 4EQCA 3Q9WA 4IX4A 4QMVA 5HO7A 1W8CA 2ZV7A 5B7VA 5F4NA 4EH6A 4ZXTA 3RALA 3QQUA 5AP0A 4DGNA 3CBLA 2R7BA 3KVWA 3PP0A 4NL0A 4BZDA 3AC3A 4FTCA 1ZWSA 3IOKA 2QO2A 2ONLA 3HMPA 4MNFA 4ASXA 3HNGA 2PVJA 3NNXA 4RFZA 5FLFA 4L6QA 2B55A 2X8DA 2WAJA 3D9VA 4V0GB 3H30A 1LR4A 5TT7A 3S4QA 1PXMA 1JKLA 3FZOA 1XWSA 2QOKA 2G9XA 3A7GA 3DK6A 3KVXA 4FKTA 4UMTA 5CALA 4EH2A 5KMJA 5EM8A 1QPDA 4RWIA 1BI7A 2VZ6A 3D7TA 4BDFA 5IMXA 5LMAA 4YUQA 4WRGA 4XCUA 3LJ1A 2WTIA 5M4UA 3RJCA 2PUPA 3CR0A 3A2CA 4K8AA 5CF6A 3UO4A 5H8EA 1IAHA 1QPCA 1YI3A 2WTDA 4CFWA 4OTHA 3F5XA 5C4LA 3FYKX 2VWWA 3W2QA 5L8JA 5DRDA 5J87A 3A61A 3F66A 5CS6A 4R77A 3FXWA 4F0FA 3PG1A 4I21A 5L2TA 3SC1A 4MX9A 1W98A 3R0TA 3HAVA 4Q9ZA 5KX8A 4NT4A 3BU6A 3V3VA 4E1ZA 3MY0A 3WILA 3VBTA 2WFYA 3PPJA 1U5QA 4JLCA 4B99A 4F7NA 2NPQA 4D4YA 1YOLA 4HGSA 3EWHA 3WZJA 2E9VA 4HVSA 2O8YA 1M2RA 4NWMA 4EHEA 3E8CA 5IUIA 3UPZA 2UZLA 4LGHA 3ACJA 2RGPA 3EN9A 2YZLA 2C6OA 4JRNA 2J9MA 4D9TA 2Y8OA 5EYKA 4BCNA 1AGWA 5DVRA 2VU3A 3UP2A 4J96A 4FEUA 4YC8A 3RMFA 3NMUF 1VR2A 5JSMA 5M4IA 3OW4A 4U6RA 3E8DA 4PMTA 2R3OA 2XIYA 3RTPA 2OK1A 4MHAA 4TY1A 1CKIA 3ROCA 4RBLA 1KV2A 1OL2A 1SZMA 3KCFA 4O0VA 3MSSA 2GNGA 2ZM3A 4M84A 5GJDA 4F70A 4APCA 2BIKB 3P9JA 3UVQA 4BGHA 4AT3A 1LUFA 2ERZE 5H9BA 2PE1A 1U46A 5FXQA 2IVTA 2VTPA 3G90X 3CTQA 3LJ2A 5CXZA 1FMKA 2XK3A 4CTBA 3QF9A 3QTUA 5E9EA 2JAVA 4QP2A 4IB3A 5AP4A 5AUUA 3R1NA 4IAAA 2VO6A 3L1SA 2RFSA 3LXNA 1VEBA 2VWZA 4MXXA 2BDJA 2ITPA 1KOBA 1UV5A 5EM7A 2C47A 3ALNA 3V01A 5HG9A 5JKGA 3MFUA 4AW5A 5DR9A 1WVWA 4L42A 2C3LA 2VTRA 3DXPA 5HBEA 4QQCA 2X9EA 4PPAA 2OIDA 5DEYA 3OOGA 4FTKA 1WAKA 3P5KA 2VWUA 1Q97A 4O0WA 4YHFA 2UVZA 3TNPC 4W4XA 3BIZA 3EN7A 2ETKA 1V0PA 3PPKA 4IDTA 2JBOA 4ID7A 3L9NA 2C5XA 3IS5A 1JBPE 2O2UA 4ZTNA 4AP7A 2G01A 2X2LA 3MA3A 4B8LA 4H1JA 3G15A 4FZ7A 3KQ7A 4FV5A 5GZAA 4JOAA 4QNYA 4MH7A 1O6KA 2WTJA 4ZS4A 1YHSA 4XV2A 2NNWB 2Z7RA 3I0QA 3GCUA 3L8PA 3KB7A 1U4DA 3PJ2A 4G16A 3ATSA 5L6WL 3DXQA 1P4OA 4XG8A 5JMSA 3KULB 3SD0A 4H1MA 4P90A 2RFDA 5I9VA 5FGKA 5CSVA 2ZVAA 4FIJA 5D10A 3CCNA 4IZ5A 4WBOA 5K0KA 4G9RA 3U4UA 4EL9A 3PYYA 5LVOA 3MYGA 2QLUA 3SAYA 4CZTA 2PULA 5E1SA 2DS1A 2WOUA 3LM5A 3PJCA 4I92A 4QTAA 4RSSA 5CU4A 3SOCA 5DFPA 4GU9A 3VBVA 3F7ZA 4FYNA 4XV1A 4I3ZA 2ZB0A 4ANNA 1UU3A 5AP7A 4NEUA 5BNJA 2J50A 4AGWA 4L45A 1ZMVA 3NRMA 4BBEA 5B2MA 2PMLX 3PA3A 4NUSA 4ZSGA 2BRNA 3DJ5A 4GU6A 1BLXA 1M7QA 2IJMA 2Y9QA 3QX4A 5CAPA 3WF6A 1JKSA 3KRRA 4DITA 4YC3A 4NJ3A 2OSCA 3VRZA 3RPSA 4IM3A 3NWWA 3U8WA 4HPTE 3TNQB 3WIGA 5M56A 3GCSA 4LRJA 2XK7A 3FMLA 4ANLA 4DH8A 4DCAA 3K5VA 3D83A 2ESMA 2VO3A 4EK8A 3NW6A 1LP4A 3HA6A 3BYUA 4FT5A 2PVMA 4FTTA 4K6ZA 4AZTA 4E5BA 3R71A 5C4KA 4J98A 1LPUA 2DUVA 2GS6A 1OPLA 5EKNA 3QA8A 4D5HA 1FPUA 2CNQA 1E9HA 3B2WA 4AG8A 4EUUA 3MH1A 2XK8A 3FPQA 1E1XA 3SGCA 4JIAA 3FV8A 4GK4A 2E9NA 2JGZA 4Q5HA 4IWDA 4QMTA 3R7IA 3SRVA 4BCJA 3G6HA 4O86A 3HMMA 3G6GA 2R9SA 2Z60A 4EBVA 1Y8GA 3CTJA 1YKRA 4TWCA 5HNIX 5HIBA 1PJKA 2V55A 3FE3A 3FKLA 3ZC5A 3PVBA 3BE9A 4YZMA 4PV0A 3PY0A 4O38A 2FYSA 3VUHA 2C5YA 3F3VA 4RPVA 1GIHA 3FUPA 2C30A 2VTHA 1V1KA 2GNHA 1ZY4A 3OT8A 4M0YA 4PL3A 4TNDA 3RWPA 1WBVA 4XLIA 4CZYB 3PA5A 5HTBA 5M44A 4BDIA 5KMOA 1K9AA 3NYOA 3O0GA 4JQ7A 4IW0A 4OTRA 1UU7A 2BALA 5ETAA 4CZUA 3SXSA 3O50A 5FP6A 2P0CA 4BC6A 4YSJA 5CEKA 5TOZA 2UZEA 5L2WA 4FSYA 2C68A 4L52A 4ZMFA 5FBOA 3D4QA 5BVWA 3SV0A 2CDZA 3E7OA 5H2UA 5CVGA 4XG7A 3A7IA 3SXFA 4HGTA 2NO3A 5DH3A 2VGOA 1JKTA 5IF1A 4I93A 4KSPA 2ITOA 3QA0A 5ANGA 2WO6A 4WG3A 4XJ0A 3ULIA 1RJBA 2WKMA 4Z3VA 5EHYA 3R7EA 2ITQA 5AUWA 5FEDA 4C4HA 1M7NA 4NTTA 4U40A 4AACA 5E92A 2J5FA 3OCBA 4XBUA 4CMOA 2VGPA 1PW2A 4XG4A 4TNBA 4FZAB 3S2PA 4AOTA 2YCFA 3UPXA 1H4LA 1CMKE 5LWNA 1KE7A 4L00A 2J5EA 3Q60A 4UB7A 3ZDUA 4F1TA 3RP9A 4E6AA 5JGDA 1H1WA 2FO0A 2P3GX 3EKNA 5E8TA 4Y46A 2BMCA 2CLXA 3E64A 3QHRA 3T9TA 4XG2A 3FI2A 1W82A 4RLLA 3ZO1A 2WMXA 5CY3A 4C0TA 3KREA 4IX5A 4DGLC 5I0BA 3VUTA 2XKCA 3OWKA 4ACCA 2J0IA 3PUPA 2C3KA 4OTDA 4FTAA 2OICA 3FKOA 1J7IA 4FG7A 3TJDA 4QYEA 4DLIA 3ZXZA 4MXZA 5ANIA 1U5RA 5JQ8A 3MESA 1YXSA 4UYNA 4C2WA 2A4LA 4IFGA 3N4TA 4NW5A 4BYIA 4F9WA 4ORKA 5LMBA 4BZOA 1GZKA 2GHMA 3DZQA 3PXRA 2W0JA 4IWOA 3U54A 1XH5A 5C9CA 2GS2A 2XS0A 3V04A 2FH9A 2HWPA 3COHA 3RPOA 5HTCA 4YJPA 3PSDA 3GUBA 1FMOE 1QL6A 2UW9A 4IB5A 5A54A 4IQ6A 4QP9A 3QTSA 3WE4A 2IG7A 2PU8A 4QMLA 4F63A 2UZVA 4MQ1A 5KHXA 2FSLX 4HYHA 4D4RA 2X7OA 3OC1A 3LLAA 4DTAA 1YXTA 3JXWA 4RA4A 2F49A 3RM7A 3LXLA 3QUEA 3QD4A 4DF3A 1F5QA 4YTHA 4E93A 2XMYA 1Y8YA 3E5AA 1SMHA 5EQPA 1CDKA 3QGYA 4W8DA 1OBDA 2JD5A 3A7HA 3ORTA 3PPZA 3BQCA 3Q9ZA 5F95A 4KBCA 1DS5A 3TV6A 4EQUA 2UW6A 4TYJA 4QTCA 4YTIA 4GT4A 2WD1A 4A9YA 5J7BA 2BUJA 3TUBA 3WYYA 3I60A 3UC4A 3U6JA 3A4PA 5EG3A 4D5KA 3Q32A 3RVGA 5AEPA 2PL0A 4TXCA 4ACDA 4ENYA 3OXZA 1H1PA 5C03A 3U6HA 3L9PA 3OP5A 5D12A 4U9AA 2BZJA 5HOAA 5IH6A 3LHJA 5JFWA 3JY0A 3MPMA 3R02A 3CQWA 3DY7A 3I6WA 3SX9A 2X4FA 3PJ1A 3QTWA 3UNJA 3WARA 1XH9A 2FGIA 2WMQA 2RG5A 3BYOA 4G6LA 4HGLA 4IBMA 4ZOGA 3TZ8A 5AA8A 4EQMA 3MB6A 4U81A 4P4CA 3U9CA 3LCTA 3HYHA 2BAJA 4U43A 5JQ5A 3EFKA 4XG9A 4PTEA 5EI6A 5AX9A 5E8UA 1OL6A 5A4QA 1NY3A 3BLRA 1IRKA 1TVOA 2YN8A 3AD4A 3NUUA 5ANKA 3W16A 3VVHA 3P08A 2XNOA 3MGYA 4NW6A 3ZSGA 5J9LA 2BRHA 3TWJA 4KUJA 3QRIA 1ERKA 5CLPA 3UOLA 3OY3A 2UW5A 1H1QA 2VD5A 4U3ZA 5DLSA 4BDDA 1YVJA 5BVFA 3UO5A 2P33A 5IA5A 3QX2A 3DLSA 4IAFA 1CTPE 3DPKA 5EH0A 5L6OA 2PVKA 2JIVA 2WMWA 5CZHA 4ANSA 3OOMA 1H01A 3F82A 4GMYA 1SVGA 2FA2A 4FGBA 3DAJA 3FQHA 2OIQA 4ZTQA 1UNLA 4WSYA 4V04A 3AT3A 2LGCA 3R8PA 1H00A 2QONA 4WG5A 5CSPA 3LCDA 3NUXA 4O81A 5KZIA 3DJ7A 2C6TA 5I5ZA 1XH8A 3F2NA 4H39A 4BDEA 3GI3A 1JSTA 4RQVA 5A4EA 2HY0A 3CKXA 3BGZA 3R83A 4AT4A 4CG9A 3KN6A 4JT3A 4CXAA 1NVQA 3RHXA 3BHTA 3FXXA 4HVDA 4CYJA 3EIDA 4X3FB 4L9IA 4UV0A 4BI1A 4Z55A 1M2QA 2VWYA 5CAOA 3UNKA 3DQXA 4EZ7A 2UV2A 3AMYA 1WBNA 4S32A 3S1HA 3NCGA 3QYWA 4QPSA 2GNIA 3ACKA 2GMXA 4IC7A 5T68A 3M1SA 3LFSA 5HEZA 5AUYA 4BCFA 3QD0A 4JR7A 3ZMMA 4BDAA 5CEPA 5M53A 2YERA 3KMUA 4DC2A 1JPAA 2HZ0A 3CY3A 1KUTA 4O7RA 3DGKA 1Q8WA 1V0BA 3PRFA 3W2RA 2EWAA 2H6DA 4IAKA 2C6IA 4FF8A 4GS6A 3ORZA 2OIBA 4IVAA 4FKUA 3NNWA 1ZZLA 3OROA 4I5MA 1ZRZA 5HE2A 3QTZA 1REKA 3WF8A 4DA5A 5LVNA 4H58A 2DWBA 2BRBA 1ZMWA 4R3PA 5CT0A 4RIYA 3EKKA 1PMVA 5ETFA 2XKFA 3Q53A 3QQHA 1ZYLA 4FIHA 4AZWA 5J5TA 4ZTMA 2VX1A 3COMA 3MTLA 3ULZA 3B8RA 3GEQA 2JDOA 4JJRA 1URWA 4M3QA 2VAGA 3NUSA 5JN2A 2EB3A 4CMUA 5LQFA 2BDWA 4F65A 3FSKA 2HZIA 4QMUA 4ASEA 4FT0A 1MQBA 3JPVA 4JL9A 5I9WA 3I4BA 4RIOA 4EC9A 5HLWA 1E1VA 2BFYA 2BZHB 2G15A 4AFEA 4FV9A 3R21A 4WNMA 4M15A 3DK7A 4HNFA 2PVFA 5I3OA 2WMUA 2QG5A 4KS8A 3HP2A 1GIIA 5CNNA 3EL8A 4D4VA 2WTVA 5BYLA 1BMKA 2OFVA 3W55A 3UODA 1NVRA 5KE0A 4UMRA 4C34A 5FEQA 5E8YA 4IAYA 4KABA 2XM8A 1T45A 3DKFA 3FMEA 4FK3A 3I7CA 5ETIA 3W2OA 4AGUA 2X6DA 3E3PA 2QR7A 4A07A 2ITWA 3BV2A 3F6XA 3CQEA 3EQRA 3KEXA 3VJNA 3HZTA 4XOYA 4GL9A 2HZ4A 2A1AB 2QNJA 4FBXA 4BI0A 2X7GA 4O22A 4BIBA 1X8BA 4OT5A 3A7JA 4Z7GA 3LM0A 2C1BA 2ZJWA 2XB7A 1FGIA 4DEDA 3AC2A 1PXNA 4BWKA 2VNWA 3QTIA 4Y5HA 3ZZEA 3PXQA 2QVSE 3JS2A 3RZFA 3E93A 4DFUA 4C02A 4I20A 4JXFA 4UWBA 3NVMB 3QZHA 1IA8A 1YQJA 4FI1A 4IWQA 2UW0A 1MUOA 4PY1A 3SG8A 5FRIA 2WMVA 5LARA 3QD3A 4BCOA 4ALWA 3Q04A 3DKOA 2OLCA 4L43A 3UIMA 4NSTA 4EKKA 1QPJA 1U54A 2PSQA 3LFNA 4L8MA 3DK3A 1FOTA 1ZAOA 4FT9A 4ZAUA 2BTRA 4HJOA 5M4FA 2W1IA 3LFDA 4MWHA 4CYIA 3UZTA 2JC6A 3C4XA 5FDXA 4XV3A 5CSWA 4A4LA 5C26A 5LVMA 5HX8A 3N4UA 2W9ZB 1NW1A 2OXXA 1OKYA 4HZSA 4CFVA 5TKDA 3OW3A 2H34A 5HQ0A 3CEKA 5L2IA 1IAJA 2IO6A 3WZKA 3P4KA 2Q0NA 3DKCA 3KA0A 4O2PA 4YJQA 3V5JA 5M57A 3ORIA 2XBAA 4R7BA 3G2FA 3ZLYA 4F99A 4FE2A 3L9LA 5AP3A 4RWLA 3R1SA 3KFAA 1O9UA 1W83A 4FKWA 4FV8A 4LG4A 2KTYA 1OVEA 1S9JA 2RFNA 3PE2A 3G5DA 4ZS0A 4JDIA 3Q9YA 3E7VA 1VZOA 4AE9A 2XK9A 3TTIA 4BTMA 4ZZNA 3AC1A 4P5ZA 3V51A 3OT3A 1JNKA 3DV3A 4UXLA 4C35A 1Q8YA 4IZ7A 4EKLA 4XNEA 3ZHPC 4FL1A 4F09A 4FNYA 4DH5A 2IZSA 3R8ZA 4O7SA 3HUBA 5AA9A 4IVBA 5AV2A 1GY3A 3G51A 4YHJA 5HG7A 5A6OA 3FL5A 2HELA 4G3FA 3FWQA 5D9HA 1I09A 4AUAA 1JAMA 5CQUA 3HMNA 3LZBA 4UMUA 4R5YA 5AV0A 3VBQA 3DU8A 3BX5A 4FG8A 2HAKA 4I6BA 1PHKA 3PJ8A 4APPA 3TL8A 4MYGA 5HBJA 2RF9A 2WQMA 3TNHA 3F5UA 4EOSA 2WTCA 3ZCLA 4ITIA 2XJ1A 5ITAA 3QQFA 3SRVB 1QPEA 5HCZA 2OG8A 3KL8A 4BDKA 5IEYA 1UU9A 3PWYA 5K4IA 4X21A 1T46A 4L7FA 1UNGA 4OW8A 2XKEA 3IW6A 1OUKA 1WBTA 3ORNA 3ZO2A 1FVRA 2R3NA 5FWKK 4PQNA 4QTBA 1YRPA 4I41A 5AR8A 4EH3A 3QC4A 5J9ZA 2JITA 3V6SA 4NH1A 4TL0A 2R3MA 2XNBA 3W32A 1JKKA 4FOBA 1PXIA 5GZ9A 4XG3A 4JAJA 4HPUE 3I1AA 2F7EE 3TJCA 3OWPA 1DM2A 2IVVA 4RFYA 5DE2A 3ZONA 3QAME 3E63A 4YSMA 4M13A 3HDMA 3OMVA 2YIXA 3MVHA 3F3WA 4E6CA 4FG9A 5EDRA 4LMUA 5CSHA 4JBVA 3UDBA 4O96A 2QOFA 3NSZA 4CFFA 4B6LA 2VWVA 4RZVA 2JDVA 5IA0A 4G3EA 4IB1A 2X39A 3POZA 4MEDA 3B2TA 3QRJA 4FSUA 3MIAA 5HE3A 4W9WA 2IZUA 4R3RA 3JY9A 1OKVA 3DA6A 1OPJA 3TEIA 5JGBA 1WZYA 4R78A 2UW8A 5A3XA 3IO7A 4O83A 2ZMDA 3OUNB 3C4CA 1Y57A 1WBSA 3QXPA 4JRVA 2W06A 4Z16A 4EJ7A 3AD6A 2R3HA 3CPBA 4Q5EA 2WGJA 3LCSA 4FV4A 2QLQA 4ZK5A 4XX9A 2YABA 1UU8A 3OXTA 2GQSA 5HHWA 4WKQA 4DFLA 2B52A 4XP2A 1OZ1A 3PTGA 2GCDA 2VTJA 5AV1A 3SG9A 5T3QA 2YA9A 2YCRA 2YISA 2Z7QA 4JI9A 3S3IA 2WMBA 1HCKA 4U3YA 3E8NA 4QYGA 4HW7A 4G9CA 2WTWA 4PP9A 3MDYA 2UZTA 5TE0A 4C2VA 4O1OA 2BROA 4RJ5A 2Q0BA 4YJNA 4LUDA 2OJGA 2BPMA 5AIKA 4TPTA 2UZBA 2PE0A 1FVVA 3MH2A 4FTRA 3H9FA 4S33A 5EHOA 2YIQA 2R3PA 5CEQA 3CXWA 3HP5A 1NT2A 4I0SA 2UZWE 2Y7JA 2C6EA 4BRXA 2G2IA 2UUEA 3DBEA 3NYNA 5F9EA 2NRUA 4QQTA 5HU3A 4PRJA 4GJ3A 4M7IA 1OECA 4UY9A 5DT3A 2KULA 3WZEA 4E5WA 5HIEA 3P23A 3R2YA 4C33A 4GFMA 4R5SA 4RJ7A 2X7FA 3HV7A 4BWPA 2XNEA 5HVJA 3HRBA 4FVQA 4CKJA 2PMIA 2EU9A 1R0PA 4E20A 3KMMA 3ITZA 2YM6A 4FGRA 2QCSA 1ZMUA 4C58A 3MN3A 3NLBA 3ODZX 4JQ8A 2IW8A 3FMNA 3R7GA 5CASA 3K54A 3QWKA 3LMGA 4IX3A 1B38A 5H3QA 5E7RA 2QU5A 2FVDA 5AR2A 1OIQA 5AR4A 1XBBA 4FVPA 4WBBB 3QTQA 5L2SA 4BWXA 2QHMA 2EXMA 3LJ0A 4FKRA 4CNHA 3UNZA 3R1QA 3UYSA 2F2UA 2QHNA 3GCVA 4F6WA 2PZPA 4GKIA 2YZAA 4QOXA 5J95A 3RINA 2J51A 3KF7A 3ET7A 4EZ3A 2GNJA 4S34A 4ZJVA 3OEFX 4RX8A 3IGOA 2B1PA 5BX0A 3H9RA 3HKOA 3KXZA 1APME 4CQEA 1ZYCA 4RC2A 1UWJA 1ZYSA 4QD6A 4J99A 1J1CA 4WNKA 5ANJA 4HVIA 3REPA 4O82A 2R3RA 3GGFA 3LOKA 2VTLA 3COIA 5KBRA 3L8VA 3HAMA 3IW5A 2UVYA 4B8MA 4LFIA 4I1ZA 4GUBA 2QOBA 4K1BA 4QTEA 2CGVA 1NVSA 3GOKA 4QYHA 5CENA 4O91A 5HO8A 4M0ZA 3ZYAA 3ZDIA 5LMKA 5GJGA 3IOPA 1CKJA 3OY1A 2XJ2A 3OWLA 5DI1A 2JAMA 3EQGA 3RK9A 4EK4A 1RE8A 1GZ8A 3JYAA 2PZ5A 5AAGA 3CS9A 4O21A 4XV9A 2HXLA 5M06A 3ZFXA 3PSBA 3EZVA 2B0QA 4O84A 1R1WA 5AWMA 4CRLA 3WIKA 2VTQA 3WBLA 4HYSA 2QOLA 2YJSA 3DAEA 3QQJA 4IM2A 3EFLA 4YZ9A 5DA3A 3TI1A 5FBNC 3CY2A 3FZ1A 4GYGA 2QOHA 3R00A 4WHZA 4AU8A 4DEAA 5JZJA 2XKDA 2CHLA 2JIIA 2VTNA 1UVRA 5DN3A 4BCHA 3EB0A 4FKLA 3MB7A 3SVVA 3O7LD 3I0OA 3CSVA 3OVVA 3QLFA 2OBJA 4RG0A 3R7OA 3QC9A 3W8QA 2OWBA 3B8QA 5AX3A 4Y83A 5DG5A 4RWKA 4N4SA 3F5PA 2F9GA 3ALOA 3FPMA 2YCSA 1P14A 4L67A 3DFAA 2I0YA 5A14A 3G0FA 4KIQA 4YPDA 5TR6A 5CF4A 1W84A 3Q5IA 2WEVA 3AGMA 3GXLA 2WIHA 2XIKA 3LXPA 2GTNA 5L6PA 2Z8CA 4FL2A 4A4OA 3EQIA 4AOJA 5LJJA 4M8TA 5IG1A 2CNVA 5EYDA 4LMNA 2YDIA 4EHGA 4FX3A 4UZDA 3OBJA 1SVEA 2VN9A 4B9DA 3NZ0A 2UW3A 4ZTLA 4DGOA 5FUTA 3HEGA 4NJDA 3HV5A 3NX8A 3OTVA 3ZLWA 4E4XA 5CAQA 5IA1A 3ZRLA 3K3JA 4X3FA 4YJSA 2R3GA 4PL5A 4DINA 1BL7A 1YXUA 2WPAA 2OKRA 4DG2E 1A9UA 4QMQA 1FBNA 2R4BA 2CKQA 4MK0A 2ERKA 2VO7A 2W1CA 5BVDA 3GT8A 2V22A 4FKIA 4XG6A 4JIKA 4DBNA 4EORA 5E8ZA 2XEZA 2W5BA 3D14A 2WMAA 3SHEA 3QFVA 3QKLA 4R6VA 4TWOA 4DFXE 5KMIA 3QL8A 4FNXA 4DN5A 3GU7A 1G8SA 3P78A 4FV0A 5E8XA 4FSNA 2XIXA 3QWJA 4CD0A 3L8XA 4L46A 4C7TA 1DAWA 1UA2A 3DBDA 3KC3A 4DH7A 4NFMA 3GU8A 4YR8A 3DQWA 5CI7A 5CU0A 3BI6A 4CV8A 1XKKA 4N0SA 1XR1A 2B53A 3FC2A 4CQGA 3EQPA 3UOJA 4MXCA 1GJOA 4JG8A 4F4PA 2ZYBA 3FEGA 4ASDA 3MJ1A 5AJQA 3Q6WA 3FLQA 4MD9E 3PP1A 4GT3A 2X81A 3LPBA 4OBPA 3RCDA 3FAAA 3VS3A 2J90A 3IG7A 3UTOA 3RAIA 4BI2A 2O63A 4FV7A 4NCTC 2UZOA 2B7AA 2JLDA 3H9OA 4GEOA 5EK7A 2ETMA 5EW8A 4WT6A 4FIGA 4YJVA 3UQFA 3KRLA 2C3IB 4BF2A 3BWFA 3LFBA 5HNBA 1P5EA 1STCE 2CGXA 1PXJA 3ODYX 4NM3A 3VIDA 4BKJA 4FKPA 4WG4A 2PZRA 4RJ4A 1SNUA 3PWDA 5AR3A 2G2FA 3ZUTA 4S31A 3NPCA 1IG1A 1W7HA 4JX3A 3FI3A 4D55A 3P7CA 4EOMA 4BCPA 4ITJA 4XRJA 2YJRA 3QQLA 1OUYA 4J7BA 5E90A 5CAVA 1KE5A 4AA4A 4IZYA 3TIZA 4AW0A 3FYJX 4Q2AA 5IH5A 4JAIA 3E62A 1BYGA 1L3RE 1IEPA 4FK6A 3R9NA 2YLEA 4LRMA 3T9IA 2OZAA 4EOQA 3LCKA 1R3CA 5CTPA 3R9OA 5KO1A 2XH5A 4YBJA 1S9IA 3R8UA 3RNIA 4EUTA 1XJDA 3UIUA 4EOJA 4DTKA 4ZY6A 2C1AA 4QP3A 4G3GA 4QP7A 1Q8UA 2YITA 2W1ZA 3IW4A 5HKMA 2BILB 4D1XA 2HYYA 3NUNA 1TQMA 4GW8A 4KS7A 5I4NA 1KE6A 1SM2A 2QODA 2UW7A 4R7IA 5HE1A 3ENHA 5CVFA 5GIOE 3BYMA 4PUZA 5FM2A 2V5QA 1ZOHA 2QOCA 4KD1A 5EM5A 5AR7A 3D2IA 4ENXA 5CU3A 2XRUA 1PMUA 3BWJA 4XUFA 2EVAA 3AT2A 3EQFA 1YDSE 1PYXA 3EHAA 4ANMA 2CLQA 5AIRA 4FYOA 2ITZA 5CAUA 4ACMA 4QQJA 3VJOA 4ZSAA 4USFA 4JR3A 3BLHA 3Q52A 4UX9A 2R0IA 4FSRA 5C8NA 3BBTB 4GYIA 4MNEA 4BTJA 1OKZA 4QYFA 4I0TA 4RVMA 1PKGA 3LMIA 3HLLA 1SYKA 3AC5A 1WVYA 3DB6A 3QKMA 4L3JA 1VYZA 2CN5A 2OH4A 2BDFA 3KXGA 3PZEA 4FNWA 3V5LA 3F5GA 4XP3A 4OAVB 1UKHA 3TDVA 3LFFA 3PE1A 3KMWA 4QMYA 2WU7A 4L3PA 1B39A 1OMWA 5HCYA 2X0GA 2VWBA 3NW5A 4YU2A 5HI2A 4DEHA 2ITVA 3FKNA 4BB4A 3O2MA 1DI9A 4IDVA 3LW0A 3GU6A 3NW7A 4WOVA 5IISA 3CGFA 2WELA 4UYAA 3IDBA 5I9XA 5KMMA 1YDTE 3MH0A 2GDOA 4MF0A 4MVFA 1XQZA 2ETRA 4EONA 2XNGA 2JKOA 1Q61A 4Y95A 3U87A 4O7VA 2OF4A 4JDJA 1KV1A 3MI9A 3VUKA 4I5CA 5HX6A 2GNLA 4KINA 3V5QA 5I3RA 2AC3A 3DZOA 1Q8TA 3LAUA 3IGGA 4GG5A 4ZY5A 3BHVA 1IASA 2OW3A 4MXYA 1HOWA 5EYMA 5CEOA 4AZSA 3TN8A 2UZNA 3FLSA 2XNNA 5AP6A 5CEIA 4G2FA 4ANOA 1J7UA 5FXRA 3LXKA 5FEEA 3VBXA 3R9RA 1W0XC 4AXAA 1JOWB 4I4FA 1UKIA 4IZAA 5B2KA 3QCXA 4RIXB 2G2HA 3L8SA 3ANQA 4CCUA 2C0OA 1YOJA 2O0UA 4AW1A 3W10A 5EM6A 4AZFA 2WU6A 2X8IA 5HCXA 2BHHA 2W1HA 5H8BA 3UG2A 2WOTA 2WQNA 5M07A 4K33A 4G5JA 2GPHA 3EFWA 4HOKA 5HE0A 4N57A 4DH1A 2ZV9A 3T8OA 3QRKA 4L3LA 4TN6A 3RNYA 2ZDUA 1YI4A 3EL7A 1VYWA 4PMMA 4A7CA 4AW2A 3V8SA 4UMQA 1ZOEA 3ERKA 3VS6A 3VNTA 3VF8A 1L8TA 3GENA 2W4OA 3D5WA 5FTGA 3BGQA 1ND4A 5HVKA 3PVUA 2BRMA 2R3JA 3KRXA 2WMRA 3QD2B 3RZBA 4EYJA 3AOXA 1Q5KA 5L2QA 2XUUA 4E73A 1LEZA 4FEQA 4ZTRA 4BBFA 3TUDA 2FSOX 2ITYA 2X1NA 3V5WA 2OJIA 2CJMA 3IW7A 3MY1A 5HZNA 4M68A 3LVPA 3W33A 3NNUA 1H1RA 2F4JA 1QMZA 3ENMA 2R3IA 3VS1A 1Z57A 4DCEA 2QO9A 4XRLA 3O8PA 4C36A 5DMZA 4MD8E 1Q3WA 1KSWA 3QQKA 4IHPA 4DHFA 4FEVA 1NA7A 2XJ0A 1IA9A 3EQHA 3K3IA 4UBAA 1OITA 3MY5A 3RGFA 3RM6A 3MA6A 5L8KA 2J7TA 3TT0A 2VV9A 2XK4A 4KIOA 4OTGA 4OBOA 2GFCA 4L53A 3AC8A 5D11A 4CMTA 4QP6A 3UGCA 3KU2A 2EXEA 4EOKA 5DT4A 3U55A 2XCKA 4BY9E 4KRCA 1OI9A 4W4YA 3KF4A 2R3KA 4OR5A 3FSFA 4RX7A 3QZIA 3U51A 4H05A 4E6QA 4O27B 5LMKC 2PVHA 5LVLA 5AUVA 3GCQA 2F2CB 3DB8A 5GIPE 5AAFA 3LQ8A 2Z2WA 4A06A 4W9XA 2Y6OA 3M11A 3R1YA 2VTOA 4FUYA 4JBPA 4EH5A 2OH0E 3TKUA 4WD5A 4FSWA 4RVTA 4YJRA 3R9HA 4KIKB 3BV3A 4BIEA 4UN0C 2H9VA 3HDNA 4TTHB 2GFSA 1V0OA 2HY81 2YM5A 1MRVA 2RFEA 4FKGA 2X8EA 2CGUA 4D2VA 4DT9A 3PIYA 3G9LX 1ZOGA 3QQGA 5CXHA 4YTFA 5K3YA 4DT8A 3ETAA 4W4VA 4WUAA 3AT4A 3OF0A 4PDPA 2R7IA 1ZZ2A 5T6KA 5K5XA 3ORLA 4QMSA 1UWHA 3QUPA 5HD7A 3SXRA 5HVYA 4QT1A 3BYVA 4I6QA 4P5QA 4YNOA 5IA3A 1RDQE 2YCQA 2C0TA 2R5TA 4CLIA 1GZOA 4DGMA 3NUAA 3QKKA 1GZNA 1J91A 1RQQA 3F3TA 2E9OA 4FA2A 4U79A 3JUHA 2RIOA 3VC4A 3HGKA 4QPAA 1P2AA 2DQ7X 3IONA 2FUMA 4ZIMA 5HG8A 3RI1A 1P4FA 4E4MA 4EWHA 4P7EA 1DAYA 2JIUA 2OFUA 4FNZA 4FZFB 4J8MA 3ZC6A 4D2WA 5BQ0A 2Y4IC 4TWNA 3MFRA 3UO6A 3ID6C 4G6OA 3C9WA 1F3MC 3H0YA 5FXSA 5IZFA 5KMLA 1MRUA 4OLIA 5E8WA 3C5UA 3I7BA 1H24A 4X6RA 5GZ8A 5J8IA 4EK3A 2XBJA 2YEXA 4XHKB 4EBWA 2BAQA 3COKA 2ZV2A 5DNRA 4PF4A 4EOIA 3G33A 4UXQA 1J1BA 4FTQA 4OT6A 2C6KA 1JSUA 1J3HA 3BQRA 5AADA 2WMTA 5IQCA 1PYEA 4X6QC 4BYJA 2BTSA 4WO5A 2W05A 3ZLSA 5AP2A 2C6MA 2GHLA 2WB8A 1XH6A 1YHVA 5JFVA 3NDMA 1M14A 2PY3A 2HK5A 5EW3A 4BGQA 3TNWA 3JVSA 4PPBA 5JFXA 3EFJA 4IVCA 4Z9LA 1M52A 4YNEA 3CJGA 3MV5A 4BKZA 1OKWA 4X3JA 4ZJJA 4C3PA 3C0HA 3ZUVA 4CT2A 5HBHA 3TZ9A 4X0MA 4FZDB 5G1XA 4FSTA 4RA5A 3UZRA 4YURA 3GQIA 2XEYA 2ZB1A 5CQWA 5K5NA 4RC3A 5FG8A 4UMPA 1WVXA 4JG6A 2ZDTA 3K5UA 5A9UA 2I7QA 4DFBA 4U44A 4DAWA 5LOHA 2R3LA 4PNIA 4IX6A 4O7WA 3AC4A 5M51A 4UALA 3FLNC 4L44A 5BYYA 3LIJA 3NEWA 2J0KA 1DI8A 1PXKA 2C0IA 2ZOQA 4RJ8A 3KCKA 4XMOA 1EH4A 2UW4A 1Y91A 3NS9A 4I22A 3VW6A 4BDGA 3GB2A 3ZSHA 3VBYA 4BR3A 1OL7A 3KGAA 1H07A 5DWRA 2YM8A 3KULA 2I40A 5DOSA 2QR8A 1UNHA 5ETCA 5J79A 3UBDA 3AG9A 3QZFA 4R1YA 5F20A 2J0MB 3TG1A 4AGCA 5AUTA 3VWAA 3ANRA 3EN6A 3PZHA 3Q4UA 3Q3BA 3KRWA 4QRCA 2HXQA 2CN8A 1PKDA 4ZJIA 3FY2A 3AQVA 2BR1A 3IDCA 3IQ7A 5IEVA 5DBXA 1XO2B 4RWJA 4NCTA 3FQEA 5BMSA 1Q62A 1TKIA 2X2KA 4E4NA 1TQPA 2GS7A 2R2PA 2OI4X 3IPHA 3W1FA 3F88A 5EW9A 4D2RA 5LWMA 3TDWA 5CZIA 4DEBA 5HTIA 4BCKA 4V01A 2RG6A 3TM0A 3KXMA 3W18A 2JFMA 4JNWA 4FSZA 3ZLXA 2F7XE 4LL5A 5HLNA 4MAOA 2AUHA 4EOOA 4DBXA 4CCBA 4O7YA 3UVRA 1CM8A 4QMWA 4RLKA 4TW9A 1Z5MA 3R01A 5H8GA 4AAAA 3FC1X 4GG7A 4L68A 2HW7A 5I9ZA 1KE8A 3WOWA 2P4IA 3OFMA 3C50A 2XP2A 3AD5A 4J52A 2JKQA 3F2RA 4ASZA 2JFLA 5ACKA 1PY5A 3VQHA 2C6LA 3ZFYA 1FGKA 5IEXA 1OGUA 3OEZA 3MVJA 2OU7A 4EI4A 2YAAA 4D4SA 5IQEA 1Y6AA 2B54A 5ACBC 3DTWA 4N70A 2YM3A 3UIXA 4O7LA 5HD4A 2XA4A 4BGGA 5KMKA 1MRYA 4O7TA 3QCQA 3PLAE 3U6IA 3KK8A 5IU2A 3OXIA 3OBGA 3Q5ZA 5HESA 5KHWA 5CF5A 1ZXEA 2HIWA 5EKOA 5LCKA 4TYIA 3BGPA 4QP1A 5DR6A 4C57A 3RAWA 5HLPA 5DYJA 3A8XA 2P2IA 4MBJA 4D2PA 3BRBA 2PYWA 4AN9A 3BZ3A 4JS8A 4FKOA 2PHKA 2BKKA 4KBAA 3RHKA 2PUNA 2WHBA 3IKAA 5K9IA 4DG3E 4XS2A 1U54B 4U97A 4ZSJA 4FUXA 4QMOA 3I81A 3PSCA 5CT7A 5DPVA 4AZEA 1YHWA 3QLGA 3PA4A 4FR4A 3D0EA 3R8LA 3UG1A 4DFNA 3M42A 2CNUA 3QTRA 3MFSA 2IZTA 4HNIA 2A2AA 2W7XA 1H8FA 2VX0A 4JG7A 4N6ZA 3QBNA 3NUYA 2QU6A 3QU0A 4XEYA 3G9NA 3EQDA 4U8ZA 2WTKB 3P7BA 4RMZA 3EMGA 4H3BA 3UOHA 3BELA 4MWIA 3EOCA 5D7VA 5AR5A 4IXPA 4ZSLA 2LAVA 4FODA 3MWUA 4PPCA 3P0MA 3UVPA 4ITHA 3EYHA 3R04A 3SOAA 5M09A 2W4KA 3CP9A 3NIZA 3R22A 4G5PA 3OWJA 3PVWA 4PDSA 4QO9A 3V5TA 4BFMA 4QMMA 4DYMA 4I5PA 5BVOA 4IAZA 2H8HA 3VRYA 3VF9A 4CEGA 2O3PA 3F69A 2AC5A 1WFCA 4IMYA 1H25A 4LOPA 4USDA 2WQEA 3ZM4A 4FKJA 1XBAA 4GV1A 2I0HA 3FDNA 3Q96A 4QPMA 3S00A 5CNOA 3ZU7A 5EQEA 3U4WA 5C27A 3R7UA 3NVKI 4D0WA 2PVYA 3HV4A 4H36A 3PXFA 4LQMA 1CSNA 4EOPA 2BIYA 3WF5A 4FKQA 4IJPA 1G5SA 4YZDA 3TZMA 2ACXA 4A4XA 4U45A 2QURA 3VULA 3CLYA 2J0LA 2PVLA 4NK9A 4O0YA 3E3BX 3BLQA 1ZY5A 4KIPA 1PRYA 4GVAA 1H0VA 3TTJA 3HUCA 3VAPA 3BBWA 4D28A 5IUHA 4MBLA 2WZJA 3NNVA 4YPSA 2YDKA 4C37A 2E2BA 4O7ZA 2YAKA 1I44A 1Z9XA 4BICA 3N9XA 5CYIA 4C4FA 5GHVA 1G3NA 3UQGA 2W5AA 2CPKE 3OTUA 4K11A 5ANOA 4GSBA 4MCVA 5A4LA 4ERKA 1Y6BA 5IDNA 3T3UA 3ORKA 3GNIB 5G6VA 4YTCA 5C1QB 2OXYA 1XH7A 5I9YA 2XVDA 2XK6A 2WIPA 4GT5A 1M2PA 4XH6A 3A99A 5IKWA 3W2CA 4DEIA 1BKXA 2P2HA 4QQ5A 3PIXA 2BHEA 5FM3A 5D7AA 4C59A 2QC6A 1A06A 5AV4A 3ZZWA 4D0XA 4OAUC 2YIYA 4I0RA 4LI5A 3HX4A 5AAEA 2RSVA 3DBCA 3U9NA 4R3CA 4JDKA 4QNAA 2FSMX 2Y0AA 4QP8A 2QI8A 4YJUA 5BVKA 3E8EA 4ZTSA 4G1WA 3NGAA 3UIBA 4A9SA 4FTUA 3RPYA 1H08A 3FI4A 3QGWA 4HCUA 2CKPA 2BVAA 5CVHA 4G3DA 4RFMA 4A9UA 4AT5A 4DLJA 4O0RA 1Q24A 3A62A 3GP0A 4RIWB 3QCSA 3BEAA 2YACA 3Q6UA 4GCJA 2FB8A 4KNBA 4RIXA 5DRBA 2GQRA 4F9BA 4FTMA 3JR1A 5IQIA 3FMJA 4NFNA 3C7QA 4WNOA 5EDPA 3TV4A 3VHEA 5KKRB 3PY3A 2YWVA 3D15A 3D5UA 4LOOA 3ZEWA 5IDPA 4G17A 3DXNA 4EC8A 4E3CA 3NIEA 4MTAA 4EYMA 5JK3A 2B9IA 5ICPA 4HVGA 2R3QA 4XYFA 4ARKA 4BTKA 5M08A 4MNEB 2H96A 3BEGA 3R28A 4Y85A 4LM5A 5GJFA 2B4SB 4D1SA 1FQ1B 2YHVA 3RKBA 5J1VA 1JQHA 1YWVA 4YO4A 4EH8A 3R30A 3VQUA 4C4IA 2CKOA 2ITUA 2J6MA 4FIIA 3O7LB 2W4JA 4KKHA 5I9UA 3CD3A 2O64A 1JSVA 4JDHA 5AM7A 2NRYA 1O6YA 2BRGA 5KZ0A 3ZO3A 3FI8A 4HZRA 1YWNA 4MD7E 4NIFB 3ORPA 3TUCA 1ZYJA 5EYCA 5F94A 5B2LA 3FZSA 4AZVA 4CGAA 4U42A 1LEWA 5FQDC 2PZIA 3IECA 5JRQA 3ZRMA 2I0EA 4OGRA 2W1GA 4GRBA 4I6HA 3P1AA 4I6FA 5A4CA 4DEEA 4KWPA 3ZM9A 4ZZOA 4IJ9A 4YGAA 4EHZA 2B9FA 3S95A 1SVHA 3RPRA 4D2SA 5IQFA 3R9DA 3WI6A 3A8WA 4P2KA 4NIFA 3VUGA 2OZAB 3LCOA 4U0IA 5K0XA 5FP5A 3VS2A 4AX8A 4PMSA 3NYXA 4R1VA 4TWPA 4EK5A 3T3VA 4OUCA 4KB8A 5JT2A 4HGEA 3OS3A 4C3FA 3LQ5A 4LUEA 4FEWA 1ZARA 2HCKA 5EI8A 5E1EA 2A19B 3W8LA 4F64A 4RVKA 2ZM4A 4G6NA 4RT7A 4O6LA 3OCGA 4QTDA 4K18A 3HVCA 4LYNA 2GHGA 4OBQA 5IH4A 1R39A 3MPTA 5GINE 3O71A 4BL1A 3PG3A 4X2KA 4M69B 2YM7A 3KK9A 2B9JA 3C4ZA 3C0IA 4F08A 5KBQA 3PLSA 4Y8DA 3ZS5A 3PRIA 4M14A 4HVHA 1H1SA 1H27A 2GSFA 2I0VA 4X2GA 4PL4A 4AF3A 3O8TA 3GC9A 3GCPA 3N51A 1OL5A 4R7HA 2VWXA 1PF8A 3EQBA 3GU4A 4RVLA 4U7ZA 2F7ZE 3C0GA 4GVJA 4BCGA 3FBVA 4BCIA 4E4LA 2ITNA 3FY0A 3ORXA 4GK2A 4GIHA 4RQKA 4TYHA 3DFCB 3QXOA 3LFQA 4FV6A 3E92A 2Y6MA 2ZV8A 3Q4ZA 2C4GA 3DAKA 4DFZE 5IQAA 4FTNA 2CKEA 2FSTX 3EQCA 3I6UA 5HNGA 3CQUA 2VRXA 4FKSA 4FT3A 4ANBA 3O51A 3Q4CA 4F9CA 4S30A 4WUNA 4CV9A 2GQGA 1U59A 2P55A 3QTXA 2ZM1A 4XBRA 3A60A 5BVNA 3FZTA 4C8BA 3AMAA 3ELJA 3II5A 3W2PA 3BCEA 3BHYA 4RC4A 3TACA 3C5IA 3P86A 3NYVA 3SW7A 1URCA 2XNMA 4YJTA 2Z7SA 3CKWA 4GFGA 3L9MA 5IQGA 4C4EA 3R7YA 5AMNA 2VWIA 2VTMA 4FKVA 4Q9SA 3V8TA 3PDTA 2OXDA 1QCFA 4ZZMA 4H3QA 4LGGA 2VTSA 3WZUA 4I5HA 4EH7A 4ACGA 1ZLTA 4ACHA 4CT1A 5BUEA 3P7AA 5GNKA 3UOKA 4DGGA 4U5JA 2PUIA 3GC7A
chains in the Genus database with same CATH superfamily
1AD5A 2E9PA 3MPAA 4F1MA 4RIWA 3DOGA 1Q41A 4QMXA 3TKHA 4X3FC 3FMKA 2V7AA 4ONAA 4EOLA 4PNKA 3ATTA 2G1TA 5J1WA 3MBLA 4NZWB 3GVUA 5D1JA 1PMNA 3QUDA 3IDPA 4M12A 2HZNA 4QMNA 2JDTA 3HL7A 4QP4A 3R8MA 5C8KA 3N4VA 4RIYB 4F9AA 3Q2MA 2C3JA 4CFUA 1F0QA 3A7FA 3FLWA 3NR9A 4AGDA 3AGLA 3DCVA 3UMWA 3HMOA 1FVTA 2PE2A 2X6EA 3R8VA 4QMZA 3ZEPA 4EWQA 4HCTA 2I1MA 3ZOSA 3FHIA 3GOPA 1OIRA 2C6DA 5M55A 5DT0A 4IFCA 4X2FA 4I23A 2OJJA 3O17A 4Y72A 4BHNA 4CTCA 4EH4A 4USEA 4YBKA 4J95A 3V6RA 3VUMA 3UDSA 2SRCA 3EN4A 4S2ZA 2PUUA 5KNJA 4CRSA 3C13A 3KN5A 1XH4A 4FT7A 4UWYA 1BUHA 5BVEA 3ROYA 2W5HA 5JH6A 2QO7A 4NM7A 2ONLC 4YMJA 3UQCA 1ZYDA 2C69A 3PXKA 3DS6A 3UMXA 4CFMA 1HCLA 4XP0A 5FD2A 3EH9A 2OJFE 3SDJA 2VTAA 1BX6A 4RJ6A 2XYUA 3UC3A 4Y5QA 4AFJA 3VS0A 5CSXA 2R64A 3I5ZA 3C4FA 4OTPA 5HO6A 4NKAA 2JBPA 2GTMA 3E88A 4IM0A 5L3AA 5EFQA 3WE8A 4FJVA 1GIJA 4MXAA 4QMPA 3CJFA 3PY1A 4M66A 5TO8A 3IW8A 5ANDA 4ANQA 3QRTA 4NM5A 5J5SA 3DT1A 4OTQA 3SA0A 3EN5A 4GUEA 3AXWA 1WCCA 3CC6A 1G8KA 1BI8A 4MKCA 4IACA 3D2KA 2QKWB 1OBGA 3F3ZA 1O6LA 3GFWA 3HMIA 4OTWA 1OL1A 2YWPA 3LFCA 4O0UA 2UVXA 2ITTA 5C8MA 2V62A 5J9YA 3FHRA 4K0YA 4O0TA 1WBWA 3TKIA 4WSQA 4BDCA 3F7WA 5JGAA 5JEBA 3DKGA 2YM4A 5A4TA 2PVNA 3UZPA 4H3PA 3C1XA 4IAIA 1K2PA 2F57A 4J53A 5LCJA 2A27A 4IC8A 1OPKA 4YC6A 2OF2A 3TZ7A 4M67A 3RCJA 4AWIA 4BVUA 2Y4IB 4CKIA 4RX5A 4J8NA 1REJA 2XM9A 3BU3A 3ZUUA 1YI6A 3MTFA 4O0SA 3ZXTA 3KXHA 2OJ9A 3HV3A 3I79A 2X4ZA 3MVMA 4WIHA 2B9HA 5EOLA 5AV3A 4LOQA 2W96B 2WMSA 4AS0A 1PXLA 2ITXA 3DJ6A 2RL5A 3EZRA 3POOA 4TRLA 3THBA 4TYHB 5AUZA 3LMHA 3R7VA 3PXZA 3NAYA 4JBOA 5L8LA 4BKYA 4ERWA 2HW6A 3QYZA 4LL0A 5D41A 1JWHA 2WEIA 3D5VA 4IVDA 4BDHA 2I6LA 3KXXA 4M69A 2VUWA 2BZIB 3HECA 3Q2JA 3LLTA 4I94A 5KKRC 2R3FA 3UJGA 4IB0A 4NTSA 5EI2A 4EK6A 2QOQA 3ORMA 2V7OA 3R6XA 4QYYA 5CANA 3I5NA 3DNDA 4ALUA 3SKCA 4X7QA 4HYIA 1YDRE 5ANEA 1G8AA 4CVAA 4FVRA 3R2BA 1KWPA 2DYLA 1TZDA 2W9FB 4D58A 2C5VA 2PMNX 3OHTA 4IE9A 5E8SA 3FLZA 1K3AA 4PDYA 2O65A 1Q8ZA 1WBPA 3FMDA 4F7JA 2JDSA 4YZNA 2W1FA 3WF7A 1Q4LA 1NXKA 4O0XA 4DTBA 3CIKA 5AUXA 4FTLA 2C5OA 3CTHA 4MXOA 3BYSA 5BYZA 4Y73A 4E8AA 3D7ZA 4N6YA 3WYXA 1OM1A 2PK9A 3M2WA 4V0GA 3SW4A 2QQ7A 4ZP5A 3LE6A 4Z7HA 2XZSA 2WXVA 3C4EA 3S0OA 4PX6A 4PTCA 5CI6A 2Q83A 4JQEA 3QALE 2JEDA 2OZOA 3KKVA 2HWOA 4C38A 4DH3A 2PTKA 4FV3A 5CEMA 4B0GA 3GC8A 3BHHA 3CPCA 4TT7A 4C4GA 4RGJA 3KXNA 5C01A 4BCQA 3CGOA 4D1ZA 4ALVA 3D5XA 4F9YA 5A6NA 4YZCA 3V8WA 5BMMA 5HU9A 4IEBA 3MW1A 2VX3A 3RBWA 3OG7A 5LXMA 1B6CB 3E87A 4DEGA 5LVPA 3DTCA 2QOOA 1OIYA 4PDOA 4RZWA 4TYGA 3VHKA 3VS4A 2X2MA 2YDJA 3QRUA 2E9UA 4KRDA 2RKUA 2ZAZA 5KMNA 3VS7A 4FSMA 1M17A 3VW8A 3PXYA 4KIKA 1MQ4A 5CU6A 4TYEA 2V0DA 1WMKA 2EUFB 1PMEA 3C4WA 1H26A 2WTKC 4MBIA 4GIIA 4HCVA 4NM0A 5JFSA 3VBWA 4MUQA 5IQDA 4RRVA 4E26A 3ZBXA 4FOCA 4AN3A 1J7LA 4F0IA 2JKMA 4C3RA 4A9TA 4NYEA 3MIYA 4UZHA 4ZLYA 3GC0A 4RJ3A 5EHLA 4L7SA 4AA0A 3O23A 5EOBA 2EXCX 3F3UA 2PVRA 2J2IB 2XYNA 3GBZA 3SLSA 5AP1A 1PXPA 1YW2A 4C4JA 4BBMA 1YXVA 4PTGA 3V5PA 3VUIA 4XLVA 4C61A 4DFYA 4GK3A 5CF8A 5B0XA 3TNIA 1BL6A 4A9RA 3NCZA 4O4CA 4F0GA 2BKZA 4FIFA 5KCVA 4W8EA 4IIRA 5HORA 3HRFA 4UWCA 4I4EA 2HENA 5HIDA 4ZLOA 3OZ6A 2CSNA 3GQLA 4ZMEA 4FMQA 4F7LA 3LKMA 4YP8A 3TCPA 3DLZA 3TYKA 4EEVA 3F9NA 2CCIA 3OCTA 3RWQA 5IUGA 3HV6A 1GAGA 4FTJA 2AYPA 4YLLA 4O2ZA 5HGIA 2JDRA 1TFFA 4RX9A 1TQIA 5F1ZA 3TV7A 5DGZA 5AM6A 3RPVA 4OTFA 1CKPA 4IWPA 5FTQA 3NAXA 4DE4A 4FTIA 3FXZA 1JLUE 3TIYA 4E5AX 5BV3A 2W1EA 4G31A 3LFAA 4KAOA 4PP7A 2PPQA 2QOIA 4CKRA 4FC0A 2PWLA 3W2SA 4BIDA 3KY2A 1WBOA 2ZMCA 3FL4A 5CWZA 3QHWA 4YLJA 3OCSA 4BN1A 5EDQA 2HOGA 4ZSEA 4F7SA 4X2JA 2WQOA 3D94A 3UE4A 5DR2A 4NU1A 3DBQA 2YLFA 3Q9XA 1GNGA 4G3CA 3GFEA 4J71A 2YIWA 1FINA 2XF0A 4AQCA 2NP8A 4G34A 3FMHA 1MP8A 4WNPA 3DNEA 3A4OX 3F61A 3DDQA 4LRKA 4OTIA 2EB2A 3KRJA 4JX7A 2XNPA 4ZY4A 2C5NA 3ZSIA 5A46A 5IMEA 5DEWA 2VO0A 2BZKB 5FTOA 2GNFA 2OGVA 3AMBA 3F2AA 4O7NA 4B4LA 2CMWA 3D7TB 4ZEGA 3ZTXA 2CGWA 5BPYA 2W1DA 2BFXA 4WRSA 2IVSA 2QKRA 4UEUA 3CD8A 3H3CA 3PVGA 4O1PA 3WF9A 4E7WA 4YLKA 3SQQA 4BDJA 3H0ZA 2GU8A 2BAKA 4KSQA 1Q99A 3HA8A 4U80A 2VTIA 5JRSA 3BHUA 4CLJA 3G0EA 5TF9A 4YO6A 1KOAA 4FSQA 4IADA 5CU2A 3QCYA 4BZNA 3DBFA 5IQBA 3CE3A 3HRCA 3FZRA 3LFEA 2X9FA 2UZDA 2PZYA 3EYGA 4FZ6A 4CSVA 4EH9A 4K2RA 1XBCA 3H4JA 4V05A 4LV8A 2VNYA 4PWNA 3O8UA 4KKGA 2REIA 1ATPE 4GFOA 3ZRKA 2YFXA 4TKSA 4II5A 3BPRA 4YHTA 4PMPA 4F1OA 4BJJB 3UP7A 2R0UA 3C51A 3DDPA 5EQYA 4D9UA 3UYTA 5IQHA 4J97A 1OB3A 3MS9A 2W99B 4IH8A 4CG8A 3R73A 4BHZA 2IPXA 2NYAA 3RK5A 3PJ3A 2J0JA 3R63A 3VN9A 1SNXA 2Z7LA 4GH2A 2JKKA 4BTFA 1R0EA 1PXOA 4YZBA 3VO3A 4AE6A 4AN2A 5E4HA 4TZRA 3VS5A 2IN6A 1R78A 2O5KA 2IWIA 3JVRA 5JZNA 4C62A 1VJYA 3FJQE 4K77A 3AKLA 2IW9A 1Q3DA 3O96A 3RAKA 3ZFMA 4FICA 1KE9A 2Y4PA 3BE2A 3MFTA 3MH3A 4KBKA 5DHJA 4CFNA 4EHVA 3GU5A 4GKHA 5J7HA 4U41A 4YJOA 4R8QA 4WA9A 3RAHA 1RW8A 2VTTA 3FZPA 5HICA 4BDBA 2XCHA 1YWRA 1OIUA 4X2NA 3FLYA 3QZGA 4FL3A 1A48A 3K2LA 3PIZA 4AA5A 2Z02A 3ZH8A 4E6DA 4XOZA 4FV1A 4LGDA 2BCJA 1XMLA 3BU5A 1XHAA 5M4CA 5AP5A 4GJ2A 4JVGA 2UZUE 3FMMA 3NUPA 2W17A 3PFQA 3EJ1A 3P79A 2XRWA 5HG5A 4B7TA 2QG7A 4ZLZA 5FDPA 4HYUA 3ZO4A 5DIAA 5IA4A 4FEXA 4JBQA 4ZTHA 4O6EA 4MF1A 5BUIA 4J1RA 2XIRA 2OO8X 4DG0E 5IA2A 2XIZA 1AQ1A 4MQ2A 4FV2A 3VUDA 1GOLA 5E91A 3OUKA 4D2TA 4EJNA 3MVLA 1VLRA 3FQSA 4LV5A 3H10A 4NKSA 1IR3A 3MJ2A 5IPJA 2QD9A 3LQ3A 2YIRA 5AFVA 5KUPA 4AXEA 2WQBA 5L4QA 4M97A 1YXXA 4IANA 4EZ5A 1H0WA 4CFXA 5CX9A 3TXOA 1H28A 1YOMA 4FIEA 4W4WA 1W2FA 4L01A 4KKEA 4BCMA 2PMOX 4F6UA 5K4JA 3OD6X 2IW6A 3BKBA 2CCHA 4I24A 2WNTA 4AOIA 4F6SA 4KA3A 2A0CX 4FTOA 1JVPP 2IVUA 2J4ZA 5E8VA 3RK7A 3WZDA 4K9YA 3ZBFA 2IZRA 3IK3A 3Q4TA 5BUJA 4EQCA 3Q9WA 4IX4A 4QMVA 5HO7A 1W8CA 2ZV7A 5B7VA 5F4NA 4EH6A 4ZXTA 3RALA 3QQUA 5AP0A 4DGNA 4AXCA 3CBLA 2R7BA 3KVWA 3PP0A 4NL0A 4BZDA 3AC3A 2XANA 4FTCA 1ZWSA 3IOKA 2QO2A 2ONLA 3HMPA 4MNFA 4ASXA 3HNGA 2PVJA 3NNXA 4RFZA 5FLFA 4L6QA 2B55A 2X8DA 2WAJA 3D9VA 4V0GB 3H30A 1LR4A 5TT7A 3S4QA 1PXMA 1JKLA 3FZOA 1XWSA 2QOKA 2G9XA 3A7GA 3DK6A 3KVXA 4FKTA 4UMTA 5CALA 4EH2A 5KMJA 5EM8A 1QPDA 4RWIA 1BI7A 2VZ6A 3D7TA 4BDFA 5IMXA 5LMAA 4YUQA 4WRGA 4XCUA 3LJ1A 2WTIA 5M4UA 3RJCA 2PUPA 3CR0A 3A2CA 4K8AA 5CF6A 3W0MA 3UO4A 5H8EA 1IAHA 1QPCA 1YI3A 2WTDA 4CFWA 4OTHA 3F5XA 5C4LA 3FYKX 2VWWA 3W2QA 5L8JA 5DRDA 5J87A 3A61A 3F66A 5CS6A 4R77A 3FXWA 4F0FA 3PG1A 4I21A 5L2TA 3SC1A 4MX9A 3W0NA 1W98A 3R0TA 3HAVA 4Q9ZA 5KX8A 4NT4A 3BU6A 3V3VA 4E1ZA 3MY0A 3WILA 3VBTA 2WFYA 3PPJA 1U5QA 4JLCA 4B99A 4F7NA 2NPQA 4D4YA 1YOLA 4HGSA 3EWHA 3WZJA 2E9VA 3W0QA 4HVSA 2O8YA 1M2RA 4NWMA 4EHEA 3E8CA 5IUIA 3UPZA 2UZLA 4LGHA 3ACJA 2RGPA 3EN9A 2YZLA 2C6OA 4JRNA 2J9MA 4D9TA 2Y8OA 5EYKA 4BCNA 1AGWA 5DVRA 2VU3A 3UP2A 4J96A 4FEUA 4YC8A 3RMFA 3NMUF 1VR2A 5JSMA 5M4IA 3OW4A 4U6RA 3E8DA 4PMTA 2R3OA 2XIYA 3RTPA 2OK1A 4MHAA 4TY1A 1CKIA 3ROCA 4RBLA 1KV2A 1OL2A 1SZMA 3KCFA 4O0VA 3MSSA 2GNGA 2ZM3A 4M84A 5GJDA 4F70A 4APCA 2BIKB 3P9JA 3UVQA 4BGHA 4AT3A 1LUFA 2ERZE 5H9BA 2PE1A 1U46A 5FXQA 2IVTA 2VTPA 3G90X 3CTQA 1OGYA 3LJ2A 5CXZA 1FMKA 2XK3A 4CTBA 3QF9A 3QTUA 5E9EA 2JAVA 4QP2A 4IB3A 5AP4A 5AUUA 3R1NA 4IAAA 2VO6A 3L1SA 2RFSA 3LXNA 1VEBA 2VWZA 4MXXA 2BDJA 2ITPA 1KOBA 1UV5A 5EM7A 2C47A 3ALNA 3V01A 5HG9A 5JKGA 3MFUA 4AW5A 5DR9A 1WVWA 4L42A 2C3LA 2VTRA 3DXPA 5HBEA 4QQCA 2X9EA 4PPAA 2OIDA 5DEYA 3OOGA 4FTKA 1WAKA 3P5KA 2VWUA 1Q97A 4O0WA 4YHFA 2UVZA 3TNPC 4W4XA 3BIZA 3EN7A 2ETKA 1V0PA 3PPKA 4IDTA 2JBOA 4ID7A 3L9NA 2C5XA 3IS5A 1JBPE 2O2UA 4ZTNA 4AP7A 2IF8A 2G01A 2X2LA 3MA3A 4B8LA 4H1JA 3G15A 4DDGA 4FZ7A 3KQ7A 4FV5A 5GZAA 4JOAA 4QNYA 4MH7A 1O6KA 2WTJA 2X0PA 4ZS4A 1YHSA 4XV2A 2NNWB 2Z7RA 3I0QA 3GCUA 3L8PA 3KB7A 1U4DA 3PJ2A 4G16A 3ATSA 5L6WL 3DXQA 1P4OA 4XG8A 5JMSA 3KULB 3SD0A 4H1MA 4P90A 2RFDA 5I9VA 5FGKA 5CSVA 3PFYA 2ZVAA 4FIJA 5D10A 3CCNA 4IZ5A 4WBOA 5K0KA 4G9RA 3U4UA 4EL9A 3PYYA 5LVOA 3MYGA 2QLUA 3SAYA 4CZTA 2PULA 5E1SA 2DS1A 2WOUA 3LM5A 3PJCA 4I92A 4QTAA 4RSSA 5CU4A 3SOCA 5DFPA 4GU9A 3VBVA 3F7ZA 4FYNA 4XV1A 4I3ZA 2ZB0A 4ANNA 1UU3A 5AP7A 4NEUA 5BNJA 2J50A 4AGWA 4L45A 1ZMVA 3NRMA 4BBEA 5B2MA 2PMLX 3PA3A 4NUSA 4ZSGA 2BRNA 3DJ5A 4GU6A 1BLXA 1M7QA 2IJMA 2Y9QA 3QX4A 5CAPA 3WF6A 1JKSA 3KRRA 4DITA 4YC3A 4NJ3A 2OSCA 3VRZA 3RPSA 4IM3A 3NWWA 3U8WA 4HPTE 3TNQB 3WIGA 5M56A 3GCSA 4LRJA 2XK7A 3FMLA 4ANLA 4DH8A 4DCAA 3K5VA 3D83A 2ESMA 2VO3A 4EK8A 3NW6A 1LP4A 3HA6A 3BYUA 4FT5A 2PVMA 4FTTA 4K6ZA 4AZTA 4E5BA 3R71A 5C4KA 4J98A 1LPUA 2DUVA 2GS6A 1OPLA 5EKNA 3QA8A 4D5HA 1FPUA 2CNQA 1E9HA 3B2WA 4AG8A 4EUUA 3MH1A 2XK8A 3FPQA 1E1XA 3SGCA 4JIAA 3FV8A 4GK4A 2E9NA 2JGZA 4Q5HA 4IWDA 4QMTA 3R7IA 3SRVA 4BCJA 3AKJA 3G6HA 4O86A 3HMMA 3G6GA 2R9SA 2Z60A 4EBVA 1Y8GA 3CTJA 1YKRA 4TWCA 5HNIX 5HIBA 1PJKA 2V55A 3FE3A 3FKLA 3ZC5A 3PVBA 3BE9A 4YZMA 4PV0A 3PY0A 4O38A 2FYSA 3VUHA 2C5YA 3F3VA 4RPVA 1GIHA 3FUPA 2C30A 2VTHA 1V1KA 2GNHA 1ZY4A 3OT8A 4M0YA 4PL3A 4TNDA 3RWPA 1WBVA 4XLIA 4CZYB 3PA5A 5HTBA 5M44A 4BDIA 5KMOA 1K9AA 3NYOA 3O0GA 4JQ7A 3BL7A 4IW0A 4OTRA 1UU7A 2BALA 5ETAA 4CZUA 3SXSA 3O50A 5FP6A 2A98A 2P0CA 4BC6A 4YSJA 5CEKA 5TOZA 2UZEA 5L2WA 4FSYA 2C68A 4L52A 4ZMFA 5FBOA 3D4QA 5BVWA 3SV0A 2CDZA 3E7OA 5H2UA 5CVGA 4XG7A 3A7IA 3SXFA 4HGTA 2NO3A 5DH3A 2VGOA 1JKTA 5IF1A 4I93A 4KSPA 2ITOA 3QA0A 5ANGA 2WO6A 3ML1A 4WG3A 4XJ0A 3ULIA 1RJBA 2WKMA 4Z3VA 5EHYA 3R7EA 2ITQA 5AUWA 5FEDA 4C4HA 1M7NA 4NTTA 4U40A 4AACA 5E92A 2J5FA 3OCBA 4XBUA 4CMOA 2VGPA 1PW2A 4XG4A 4TNBA 4FZAB 3S2PA 4AOTA 2YCFA 3UPXA 1H4LA 1CMKE 5LWNA 1KE7A 4L00A 2J5EA 3Q60A 4UB7A 3ZDUA 4F1TA 3RP9A 4E6AA 5JGDA 1H1WA 2FO0A 2P3GX 3EKNA 5E8TA 4Y46A 2BMCA 2CLXA 3E64A 3QHRA 2XAMA 4FRFA 3T9TA 4XG2A 3FI2A 1W82A 1W2DA 4RLLA 3ZO1A 2WMXA 5CY3A 4C0TA 3KREA 2ZFYA 4IX5A 4DGLC 5I0BA 3VUTA 2XKCA 3OWKA 4ACCA 2J0IA 3PUPA 2C3KA 4OTDA 4FTAA 2OICA 3FKOA 1J7IA 4FG7A 3TJDA 4QYEA 4DLIA 3ZXZA 4MXZA 5ANIA 1U5RA 5JQ8A 3MESA 1YXSA 4UYNA 4C2WA 2A4LA 4IFGA 3N4TA 4NW5A 4BYIA 4F9WA 4ORKA 5LMBA 4BZOA 1GZKA 2GHMA 3DZQA 4DHIB 3PXRA 2W0JA 4IWOA 3U54A 1XH5A 5C9CA 2GS2A 2XS0A 3V04A 2FH9A 2HWPA 3COHA 3RPOA 5HTCA 4YJPA 3PSDA 3GUBA 1FMOE 1QL6A 2UW9A 4IB5A 5A54A 4IQ6A 4QP9A 3QTSA 3WE4A 2IG7A 2PU8A 4QMLA 4F63A 2UZVA 4MQ1A 5KHXA 2FSLX 4AXDA 4HYHA 4D4RA 2X7OA 3OC1A 3LLAA 4DTAA 1YXTA 3JXWA 4RA4A 2F49A 3RM7A 3LXLA 3QUEA 3QD4A 4DF3A 1F5QA 4YTHA 4E93A 2XMYA 1Y8YA 3E5AA 1SMHA 5EQPA 1CDKA 3QGYA 4W8DA 1OBDA 2JD5A 3A7HA 3ORTA 3PPZA 3BQCA 3Q9ZA 5F95A 4KBCA 1DS5A 3TV6A 4EQUA 2UW6A 4TYJA 4QTCA 4YTIA 4GT4A 2WD1A 4A9YA 5J7BA 2BUJA 3TUBA 3WYYA 3I60A 3UC4A 3U6JA 3A4PA 5EG3A 4D5KA 3Q32A 3RVGA 5AEPA 2PL0A 4TXCA 4ACDA 4ENYA 2XALA 3OXZA 1H1PA 5C03A 3U6HA 3L9PA 3OP5A 5D12A 4U9AA 2BZJA 5HOAA 5IH6A 3LHJA 5JFWA 3JY0A 3MPMA 3R02A 3CQWA 3DY7A 3I6WA 3SX9A 2X4FA 3PJ1A 3QTWA 3UNJA 3WARA 1XH9A 2FGIA 2WMQA 2RG5A 3BYOA 4G6LA 4HGLA 4IBMA 4ZOGA 3TZ8A 5AA8A 3P5JC 4EQMA 3MB6A 4U81A 4P4CA 3U9CA 3LCTA 3HYHA 2BAJA 4U43A 5JQ5A 3EFKA 4XG9A 4PTEA 5EI6A 5AX9A 5E8UA 1OL6A 5A4QA 1NY3A 3BLRA 1IRKA 1TVOA 2YN8A 3AD4A 3NUUA 5ANKA 3W16A 3VVHA 3P08A 2XNOA 3MGYA 4NW6A 3ZSGA 5J9LA 2BRHA 3TWJA 4KUJA 3QRIA 1ERKA 5CLPA 3UOLA 3OY3A 3W0PA 2UW5A 1H1QA 2VD5A 4U3ZA 5DLSA 4BDDA 1YVJA 5BVFA 3UO5A 2P33A 5IA5A 3QX2A 3DLSA 4IAFA 1CTPE 3DPKA 5EH0A 5L6OA 2PVKA 2JIVA 2WMWA 5CZHA 4ANSA 3OOMA 1H01A 3F82A 4GMYA 1SVGA 2FA2A 4FGBA 3DAJA 3FQHA 2OIQA 4ZTQA 2XARA 1UNLA 4WSYA 4V04A 3AT3A 2LGCA 3R8PA 1H00A 2QONA 4WG5A 5CSPA 3LCDA 3NUXA 4O81A 5KZIA 3DJ7A 2C6TA 5I5ZA 1XH8A 3F2NA 4H39A 4BDEA 3GI3A 1JSTA 4RQVA 5A4EA 2HY0A 3CKXA 3BGZA 3R83A 4AT4A 4CG9A 3KN6A 4JT3A 4CXAA 1NVQA 3RHXA 3TMOA 3BHTA 3FXXA 4HVDA 4CYJA 3EIDA 4X3FB 4L9IA 4UV0A 4BI1A 4Z55A 1M2QA 2VWYA 5CAOA 3UNKA 3DQXA 4EZ7A 2UV2A 3AMYA 1WBNA 4S32A 3S1HA 3NCGA 3QYWA 4QPSA 2GNIA 3ACKA 2GMXA 4IC7A 5T68A 3M1SA 3LFSA 5HEZA 5AUYA 4BCFA 3QD0A 4JR7A 3ZMMA 4BDAA 5CEPA 5M53A 2YERA 3KMUA 4DC2A 1JPAA 2HZ0A 3CY3A 1KUTA 4O7RA 3DGKA 1Q8WA 1V0BA 3PRFA 3W2RA 2EWAA 2H6DA 4IAKA 2C6IA 4FF8A 4GS6A 3ORZA 2OIBA 4IVAA 4FKUA 3NNWA 1ZZLA 3OROA 4I5MA 1ZRZA 5HE2A 3QTZA 1REKA 3WF8A 4DA5A 5LVNA 4H58A 2DWBA 2BRBA 1ZMWA 4R3PA 5CT0A 4RIYA 3EKKA 1PMVA 5ETFA 2XKFA 3Q53A 3QQHA 1ZYLA 4FIHA 4AZWA 5J5TA 4ZTMA 2VX1A 3COMA 3MTLA 3ULZA 3B8RA 3GEQA 2JDOA 4JJRA 1URWA 4M3QA 2VAGA 3NUSA 5JN2A 2EB3A 4CMUA 5LQFA 2BDWA 4F65A 3FSKA 2HZIA 4QMUA 4ASEA 4FT0A 1MQBA 3JPVA 4JL9A 5I9WA 3I4BA 4RIOA 4EC9A 1W2CA 5HLWA 1E1VA 2BFYA 2BZHB 2G15A 4AFEA 4FV9A 3R21A 4WNMA 4M15A 3DK7A 4HNFA 2PVFA 5I3OA 2WMUA 2QG5A 4KS8A 3HP2A 1GIIA 5CNNA 3EL8A 4D4VA 2WTVA 5BYLA 1BMKA 2OFVA 3W55A 3UODA 1NVRA 5KE0A 4UMRA 4C34A 5FEQA 5E8YA 4IAYA 4KABA 2XM8A 1T45A 3DKFA 3FMEA 4FK3A 3I7CA 5ETIA 3W2OA 4AGUA 2X6DA 3E3PA 2XAOA 2QR7A 4A07A 2ITWA 3BV2A 3F6XA 3CQEA 3EQRA 3KEXA 3VJNA 3HZTA 4XOYA 4GL9A 2HZ4A 2A1AB 2QNJA 4FBXA 4BI0A 2X7GA 4O22A 4BIBA 1X8BA 4OT5A 3A7JA 4Z7GA 3LM0A 2C1BA 2ZJWA 2XB7A 1FGIA 4DEDA 3AC2A 1PXNA 4BWKA 2VNWA 3QTIA 4Y5HA 3ZZEA 3PXQA 2QVSE 3JS2A 3RZFA 3E93A 4DFUA 4C02A 4I20A 4JXFA 4UWBA 3NVMB 3QZHA 1IA8A 1YQJA 4FI1A 4IWQA 2UW0A 1MUOA 4PY1A 3SG8A 5FRIA 2WMVA 5LARA 3QD3A 4BCOA 4ALWA 3Q04A 3DKOA 2OLCA 4L43A 3UIMA 4NSTA 4EKKA 1QPJA 1U54A 2PSQA 3LFNA 4L8MA 3DK3A 1FOTA 1ZAOA 4FT9A 4ZAUA 2BTRA 4HJOA 5M4FA 2W1IA 3LFDA 4MWHA 4CYIA 3UZTA 2JC6A 3C4XA 5FDXA 4XV3A 5CSWA 4A4LA 5C26A 5LVMA 5HX8A 3N4UA 2W9ZB 1NW1A 2OXXA 1OKYA 4HZSA 4LV7A 4CFVA 5TKDA 3OW3A 2H34A 5HQ0A 3CEKA 5L2IA 1IAJA 2IO6A 3WZKA 3P4KA 2Q0NA 3DKCA 3KA0A 4O2PA 4YJQA 3V5JA 5M57A 3ORIA 2XBAA 4R7BA 3G2FA 3ZLYA 4F99A 4FE2A 3L9LA 5AP3A 4RWLA 3R1SA 3KFAA 1O9UA 1W83A 4FKWA 4FV8A 4LG4A 2KTYA 1OVEA 1S9JA 2RFNA 3PE2A 3G5DA 4ZS0A 4JDIA 3Q9YA 3E7VA 1VZOA 4AE9A 2XK9A 3TTIA 4BTMA 4ZZNA 3AC1A 4P5ZA 3V51A 3OT3A 1JNKA 3DV3A 4UXLA 4C35A 1Q8YA 4IZ7A 4EKLA 4XNEA 3ZHPC 4FL1A 4F09A 4FNYA 4DH5A 2IZSA 3R8ZA 4O7SA 3HUBA 5AA9A 4IVBA 5AV2A 1GY3A 3G51A 4YHJA 5HG7A 5A6OA 3FL5A 2HELA 4G3FA 3FWQA 5D9HA 1I09A 4AUAA 1JAMA 5CQUA 3HMNA 3LZBA 4UMUA 4R5YA 5AV0A 3VBQA