4G9ZA

Lassa nucleoprotein with dsrna reveals novel mechanism for immune suppression
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
205
Chain Sequence
AMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(P*GP*CP*CP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Viral protein/rna
total genus 55
structure length 205
sequence length 213
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4g9zA01
4GV3A 4GVEA 4G9ZA 4GV9A 3MX5A 3MWTA 3Q7CA 3MX2A 4FVUA 3Q7BA 3R3LA 3MWPA 4GV6A
chains in the Genus database with same CATH superfamily
4CZGA 2VGNA 2QWLA 1FK9A 4CZFA 4PUOA 2IVPA 2Q1NA 3L0QA 4IEIA 3QIPA 2Q31A 1UAXA 3C7NB 1V4TA 4DR6K 2D0AA 1T7PA 3AO1A 5BN9A 4W5TA 4FJGA 4KRFA 1BCOA 4WFAL 1T05A 4DF4A 2NRVA 3KZBA 2DPNA 3GBTA 3OYEA 3MN7A 4B9TA 2NRRA 2ZQBA 4GV3A 1ASWA 1HYSA 2WONA 1VQNN 4CFDA 2P9NA 1REVA 3ULEB 1LAVA 4RW4A 5T7BA 5CR4A 3L6QA 4CFBA 3CJBA 3RVCA 2HB5A 2OCEA 1B9FA 4CJSA 2YNHA 4IFYA 5ADXH 2HBMA 4WF9L 4FJLA 1HMVA 3NBPA 4CEFA 3V9WA 2XY8A 3ZT1A 4CZIA 4JD2A 5AZIA 3ZSVA 1QS4A 4AHRA 4JRQA 2IAJA 3F5TA 1HKGA 5EX5A 4BG8A 2QK9A 3MCAB 1TAUA 5AQYA 3VEOA 3N4PA 4PKIA 4ZHRA 3QDKA 5AQIA 4FJMA 2KKZA 2QA4N 3O8MA 3VPZA 3ZSWA 4WE1A 4E1MA 3KLHA 1KAYA 4TSXA 4FSVA 2ZM6K 4QS9A 4F2SA 5DM6L 5EXWA 4WCEL 1VQON 3J7ZO 1IG9A 4DSKA 5J2QA 4FZYA 4WQ4C 3LP1A 4KTQA 1VQ6N 2CGKA 5CZ1A 1ITGA 2JLEA 2YI1A 3EL2A 4J8FA 4DQSA 3SCXA 4Z4IA 1Q9YA 4BVPA 3QLHA 4LH4A 4N56A 3PX6A 1TUYA 4Z4CA 4C8KA 4PQUA 1K6YA 3ATUA 1WNSA 3UKUB 1JLFA 4M63C 1VK0A 1NGEA 5J2NA 2OPRA 3TSQA 4DUZK 3NGYA 1MWKA 4U7BA 3PO4A 3AAQA 2DTUA 4BR0A 3DOLA 3O4WA 2ZJRL 3HI0A 3VEYA 3NH2A 3VQPA 3DLHA 3LM9A 4HUEA 2YKNA 4CEEA 1BGXT 2EX3A 4OKJA 3L2RA 2JGUA 3SUQA 3EE9A 1X3MA 2D1KA 1NBWA 2NRHA 1WSHA 5GADP 5JVGL 4BDYA 3PX4A 5AQTA 2Z1JA 4FWNA 1HNWK 3WNHA 4CJ5A 4Q5VA 1QE1A 4W5OA 1NK5A 3CIPA 1KAZA 4OGEA 2VCPA 3K2PA 1RGIA 3QEVA 1TGOA 1TKZA 1HPZA 3AA2A 1HRHA 3O4NA 1YJWN 2CH6A 3WXMB 3OBWA 3LP3A 4KHNA 5D3GA 1S9GA 3CETA 3EZ5A 4DS4A 4FJIA 1WN7A 2YNFA 4IXCA 4DWIA 4CJVA 3H46O 2FC0A 1U04A 1T6DA 4LSLA 5C2DA 3ZT0A 2HHVA 3NAEA 3T1AA 4IOAL 3ZSXA 1BI4A 1HNZK 2V7YA 3QEWA 1OH7A 1RT2A 3ZT4A 4ELTA 3K58A 4NLCA 3J81O 3KLIA 4IFEA 2X78A 2FBVA 4IFVA 2ZWHA 5GAGP 4LF5K 3CXCM 4BQZA 3I0SA 3BP8A 4PWDA 1VSLA 3DRPA 4BRCA 2VQEK 1WAFA 4GV9A 3OBYA 2P1JA 3V9UA 1NK4A 1EKEA 3CCJN 3WNEA 4OPKA 1WSIA 3UIQA 1LW2A 3SQ1A 4O44A 1N32K 5DK5A 5HL7L 3U3YA 4B3SK 4BREA 3HJFA 1WB9A 3LDQA 4BRDA 1RDBA 1HYZA 4CD3A 3HPOA 4DB3A 3E01A 3PO5A 5HP1A 3AO4A 3DAWA 1CXUA 5H1SQ 4FYDA 5F2RA 3BZKA 3C6AA 1U6ZA 4R79A 4DFJA 3HSCA 1G99A 1VSKA 2E1ZA 2QWOA 1HKBA 4CHOA 3AVBA 5BRFA 3A5NC 1JCEA 1RILA 4FJ7A 4DQPA 1P8ZA 4BRFA 1U45A 4FM2A 1IKXA 1SS6A 4CJQA 4K42A 4FWLA 1R0AA 2P9UA 3VA3A 2WC9A 2P5GA 1FKPA 4OVLA 4QS7A 3OW2M 2VWJA 3L4QA 1NMDA 3SMSA 1ATSA 2D0BA 1VHXA 1VQ5N 3FZMA 3QB0A 4CIFA 3C6HA 1S22A 2XY5A 3T3FA 3EY1A 3O9SA 3A0IX 2E2OA 3EO3A 1NOZA 4FWMA 3VESA 3QBWA 3OYHA 3M1FA 2P9NB 4M7XA 1ESVA 1RT1A 4FLUA 1IH7A 2F96A 1E4GT 2OPPA 3LPUA 5KRSA 3LP2A 3AV9A 4H5WA 2P9SA 4IG0A 3CHWA 1Y97A 4JKGA 4WQ5C 2ZD1A 4BE2A 4CHZA 5KGXA 2YNGA 1Q86O 1GLAG 4BQLA 3DLEA 4HTLA 4JK7A 2OYQA 4BR5A 4ICLA 4DKWA 4B9SA 4CGGA 2Q97A 2GX9A 1VQLN 3C7NA 1BO5O 1I39A 1U2VB 3VQ4A 3I8DA 3CJ1A 5DMRA 2WFBA 3ZLJA 1EXQA 4BRMA 3AVCA 2P9KA 2QTDA 4FOIA 4G1QA 3A8YA 3EYZA 3FZHA 3PLAA 1DTQA 1HYVA 1GLEG 3E9OA 4H0OA 3KK1A 4AHTA 1IKVA 4LD0A 4E7HA 5EY4A 2OTJN 3ULEA 4DU4A 3IAYA 1VSEA 3FZKA 3SUNA 1N36K 1EWQA 3K0SA 3NCIA 4A2AA 1XNRK 1ZBSA 1OH6A 2IVNA 5FPDA 5J1EA 2HOEA 3M8RA 3PSFA 3KVGA 1RDUA 5C15A 4YHHK 1P90A 2AP1A 1VQ8N 3TABA 1XC9A 2X74A 3LAMA 4ELUA 2YCHA 3TSUA 1ZYQA 2DFEA 2QKBA 5HRNA 1OKJA 3DYAA 3L2UA 1MA9B 1O13A 4CZHA 2YNIA 2G8FA 1FKOA 1TL1A 3V1RA 4KREA 1JLCA 2E88A 1A5VA 5AR0A 1X3NA 1NGJA 1TL3A 3VEWA 1LW0A 5KGWA 1KD1O 3O3FA 4FJ9A 3O4QA 1G15A 3QMLA 1CLQA 4CECA 4IOCL 1VQPN 2XY6A 5AQKA 1IBKK 4KHWA 3MN6A 4CJUA 1YVUA 2YHYA 1BWFO 3V9XA 4CE9A 4X66K 4OPJA 1I3AA 1QVGM 3UKUA 1JL2A 4W5RA 4DCHA 2P9IB 1IO2A 5M1PA 4JI2K 3ZSZA 3B8AX 1C0UA 4EP5A 4OPAA 3A5MC 4GVEA 4JI0K 3T19A 3CI5A 4OLAA 1BL3A 1BISA 2Q36A 4JI4K 3ZYYX 4CEQA 3ENHA 1BA0A 1LAWA 2A42A 5AQWA 1RT4A 1BQNA 4H03B 3CYMA 4B1XB 2UUCK 3HVTA 1QQCA 4DQRA 3LANA 3LDLA 3D0PA 3SPZA 2VYPA 2FF3B 1U47A 2E20A 3B6OA 4IWVA 3CERA 4K25A 3TSPA 4AM7A 3VTHA 1X9SA 1RBTA 2WOMA 3U9DA 3L3VA 4M41A 2G8WA 1C6VA 1RTDA 4ID5A 5FRNA 3H1QA 4JKBA 3F9MA 3P4IA 4QCLA 3DJCA 3VF2A 4NB4A 2QWRA 4IJAA 4CI6A 3KD1E 1NMNA 2QEXN 1J5EK 5J2MA 1BIZA 4CHNA 4EFHA 3WXIA 1N6QA 3T69A 4CK2A 5AQPA 3H08A 1GLBG 4LY7A 4CGDA 3VENA 3MXMA 1S3XA 2D0CA 3EKSA 3SUPA 3MWPA 4BROA 1YITN 3S3MA 1GLCG 3U9ZA 4FOEA 4PKGA 1LWCA 3QICA 3MMVA 1NKBA 4FLZA 4LC9B 5A2QO 1TKDA 3CC4N 3KWGA 4IDKA 3SK3A 4NXNK 2UXBK 4C23A 2PFUA 3QETA 3SPYA 3I0RA 5MLCQ 3IS9A 3AVKA 1J54A 4CZEA 5EVZA 1KAXA 2XO7A 1XUPO 2W42A 4JI3K 3THYB 4E1NA 2GEMA 3TR8A 4FLTA 3P5JA 4CEAA 3WNGA 1S1UA 3VQ9A 3HK2A 5FRMA 3QESA 5AQSA 3CF5L 1HQEA 2GWKA 4CBXA 2XY7A 1RT6A 4PL7A 3MDQA 1TUUA 1S5JA 4GMJB 4H0PA 4CFAA 1RNHA 4AQYK 3AARA 2HF4A 1BIUA 3J7AP 3C6TA 1NGGA 3IKMA 4NCAA 3VA0A 4MLEA 1NKCA 1NK8A 3ISNC 3TANA 4CHPA 4EIAA 3AVIA 1RT7A 4Q0BA 1BCMA 1C0GA 3KKSA 4FWOA 5AQXA 1TAQA 3HPHA 3IRXA 4IG3A 2G8HA 1HJOA 2OZMA 1VSFA 4B3TK 1HNXK 1Q8IA 4J2DA 4N5SA 4A5AA 1GLJO 4CEZA 2ZE2A 2QWMA 1IBLK 2NZTA 2XHBA 3VQAA 2O4GA 3O9UA 5JMVA 4AHCA 1GOAA 1NWKA 3G4SN 2NNWA 3E9PA 5AQHA 3HOSA 4GKJK 3QO9A 3UKRB 3QNOA 4Z0UA 1DGKN 3CCLN 1N33K 5C12A 5AFUA 3ITHA 4IEEA 4KPYA 5JICA 1OH5A 3FLCO 1VQ4N 3ZEUB 3LZIA 4BR2A 2P9KB 3DLGA 4MFBA 3IUCA 4ILGB 3UE5A 3VQEA 3ZETB 5LMNK 2YX6A 4BRGA 3RRHA 3R9PA 3HYFA 3H6EA 1U4BA 3BF3A 5C25A 1BA1A 3AVMA 3JYTA 1WBBA 4LF9K 3WT0A 3K5LA 1I94K 4KI4A 2GBZA 4DR7K 4O0JA 2IOCA 5I42A 3KJVA 4ILHA 1FJGK 4DR2K 5AQUA 4F3OA 3DXKA 1U2VA 2CH5A 5M1KA 4CIEA 1NK0A 4DU1A 5KQDA 3CD6N 3TARA 2KLAA 4FXDA 4AF1A 2HW3A 1SKSA 5KRTA 2HMPA 4PY5A 5JLFA 2CGLA 3D2FB 1ZBFA 2NRXA 4DTNA 2DFHA 1J6ZA 4HUGA 4E1JA 1VAZA 1TKTA 1YIJN 4HVJA 4A2BA 4BACA 4FLXA 2YHBA 3M6GA 3E66A 1UA1A 2VG7A 3C65A 1D8YA 4YFUA 2BE2A 4LF4K 4ELVA 1CXQA 4CF0A 2ITGA 3K5NA 4JEPA 4ISFA 1RT3A 3AO2A 3EEQA 2OPQA 3AO3A 3B6PA 3CCRN 2UXDK 3HP9A 4I7FA 1ZC6A 3HBTA 3OYNA 3J8AA 1SV5A 3LDSA 4DV2K 4JYAK 1CZAN 3CJ7A 4LSNA 1QQMA 3K9JA 1ZBIA 4CVNE 1NM1A 1Q18A 1NK7A 4KBOA 4FPBA 2R7YA 4E0DA 4FWKA 3CCMN 1UWBA 2X6NA 4L8RB 1IKYA 2HVIA 2ASOA 1J9AA 5KI6A 3KK3A 2DFFA 4E7JA 3VQQA 2UYTA 4CF9A 4F9OA 2A3ZA 1WBDA 5DM7L 2O8EB 2O8DB 2BANA 4O8KA 4H5RA 4IJNA 2KHOA 4AM6A 3AA5X 1U48A 4MO4A 3CQ8A 4FJJA 1BUPA 1OVQA 1LOTB 3U4LA 4ISEA 3ZSOA 1NJIO 2O8FA 1OH8A 4DV5K 3RTVA 1BG3A 1QTMA 4DQQA 3R8EA 1YHQN 1WAJA 2HNYA 3FGUA 2GUPA 3G10A 2Q3SA 1W0HA 2P9IA 5M1NA 1S72N 1JJ2M 2G8IA 3RR8A 3VGMA 4DLGA 4CK1A 1K8AO 2A1RA 2F9WA 3L2QA 5BPNA 5AQRA 4B1YB 3AGKA 4HCBA 4IO8A 2X6SA 3S3OA 4BVOA 3SI6A 5JLHA 5K14A 3N4QA 1ATNA 4WYBA 3BDPA 4MO5A 2QXFA 4DS5A 3TTFA 2D0OA 4KFBA 5SZTA 1SL0A 4NYFA 4L3QA 4M45A 2O8CB 4B1UB 2OTLN 3LP0A 2PZSA 3OVNA 2FSJA 3PV8A 4M7YA 5F1XA 3RMAA 3JS6A 4I9LA 2KZMA 3OYDA 4ZTFA 2WBNA 3SBTA 3LZJA 1HX1A 3K9KA 5I3UA 4DTXA 3VQBA 4B1WB 5I9EB 2Z1IA 4DTMA 1FW6A 4CCHA 5M1QA 3A2FA 1JCGA 3WUHA 2HHTA 4DR3K 2VWKA 3ZX0A 3KK2A 3EE8A 4C1NI 2HHWA 4A62A 1NGAA 1J5OA 1D4XA 1C1CA 1KVCA 1TV6A 3WQUA 3C6UA 4DSJA 3PIOL 3VQ6A 3VTIA 1YI2N 4DQIA 2OZSA 4H5VA 3NMUA 2ZF5O 2RPIA 4KHSA 2NLXA 4M42A 3HL8A 1S1TA 5GAEP 3VETA 2VGMA 3EKUA 5BR9A 4AH9A 2PBDA 3R6MA 5C10A 4IKFA 3MEEA 4MDBA 3L8BA 4DV6K 1XMQK 4DTRA 3SJJA 5HLFA 3TU5A 1CZ9A 3P39A 4BR7A 3S3NA 4JI5K 3THYA 2O4IA 1NGCA 4FW2A 2RHKA 3HPGA 3DI6A 1D9FA 1ZBLA 2FBYA 3JSMA 4JS4A 2VWBA 2JWLA 2W6LA 2YHAA 2EHGA 1T44A 2QW9A 1RTJA 4KKOA 3CQXA 3SBGA 1A5XA 1K8KB 2KQ2A 3A5LC 1TK8A 4YOXA 2OA8A 4HCCA 4DF8A 3CFPA 3BF1A 5AFUH 4LF7K 4H8KA 3CQYA 2E8AA 3AVGA 4I6MB 4RW7A 5KTQA 3BEXA 3F73A 1VSMA 1VSDA 4F4KA 4N41A 1VRUA 4DR5K 3MWTA 2ETJA 4KHQA 3SQ4A 2GTDA 2HHSA 3K5MA 2Y1IA 3DWLA 4OKKA 1HPMA 4HUFA 1SL2A 2Q0UA 4CK3A 1RTHA 1JXEA 3HO1A 1T03A 4DV3K 4KH4A 4DQ8A 3FZFA 3UKRA 4DTSA 3C95A 3VOVA 5E26A 1J53A 3KLGA 3OA9A 4FZZA 3DXKB 4B9VA 5KPZA 5IT9O 3FR0A 3M8PA 4FK0A 2PY5A 3CMEN 3ZSQA 4E7LA 2E1YA 3ZEUA 4YDUC 2V52B 1ZBUA 3ZSRA 3L2VA 3THWB 3AGRA 5M1FA 4C8LA 3OHRA 1W7AA 2FBTA 4O55A 3W0LA 4ZTJA 4ISGA 4IBNA 4C8MA 3LWLA 3ZETA 4GW6A 4JI1K 2E6LA 1U49A 5AQOA 3K5OA 3G25A 2V7ZA 3CPWM 2IS3A 4FWQA 4X64K 3C94A 3HTVA 1RBSA 5HRPA 1NGHA 3L4IA 3OS0A 4MQ3A 5HROA 4AILC 4CGIA 2AA4A 3U6FA 3OYFA 2GELA 4CF2A 1KXPA 3U3GA 1L3VA 2QI2A 5TKYA 5FPNA 4DHYA 2PAVA 3O3HA 2YHWA 5BREA 1VQMN 3PSIA 2Y1JA 4CJ3A 4GV6A 3D45A 3NF6A 2KW4A 3HM9A 3K59A 3ATVA 5KPTA 2YV0X 5LL6Z 4GNIA 5CHIA 4HHTA 2VG5A 3D2FA 5LMUK 1RBUA 4AHSA 4OKEA 3T7ZA 3THXB 4BRPA 3GOIA 3PUFA 1VRTA 5GAHP 4JKDA 1TYQB 4ILJA 3WXJA 4U67L 3MX5A 3SLCA 2UUBK 3MXJA 2Q0RA 3I8BA 2HBKA 3SQ0A 1ASUA 2P9LB 3DLKA 2VG6A 5AQQA 2O8FB 3ALYA 1XNQK 1Z6RA 4CERA 4M3RA 4CJPA 3TAFA 4IO9L 3I33A 3GE1A 1VQKN 4BC4A 1A5WA 2G8VA 2QWNA 1C1AA 2IGIA 3V4IA 4YNQA 1NJXA 4KB0A 2E2QA 3AVHA 2W40A 4I2QA 1T6CA 4BWMA 1NKEA 2IVOA 3VGLA 3MXIA 4J2AA 3K57A 1H1VA 1TVRA 3VQCA 4M3WA 1HUXA 3CM6A 2O8EA 2WUSA 2O8DA 3ZX3A 1Q82O 4H5TA 3S41A 1KFDA 1SKRA 3SAFA 4WQ4A 1TK5A 2HF3A 3ZSYA 1X9MA 3J80O 4K41A 1MWMA 3KTQA 3OYAA 1XWLA 3PX0A 4FWPA 3DLRA 4KH5A 3OYLA 3GG4A 2I5JA 3NF9A 4KTWA 5C0YA 3WQTA 3V9ZA 3E1YA 1DT9A 4V19S 4KHPK 4KO0A 2B5JA 4CZJA 1RDDA 4CIGA 3V1OA 1ATRA 4YORA 3NE6A 2BGGA 3O80A 1WSJA 3CCQN 4DSIA 1QZ6A 3D2EB 5AQVA 3G6EN 3F9KA 3TWHA 4CZKA 3G71N 3LL3A 3J7YP 1C0FA 1HNVA 4H5NA 4N47A 4CBWA 3O3GA 3L2WA 2FLOA 3P38A 4O8UA 3VMFB 3SQ2A 3MCPA 3RMBA 4KAZA 3MEGA 4MDAA 4X62K 4FCYA 1QQOA 3O9RA 4FW1A 4EHUA 1SQKA 4B1ZA 3S9HA 4JN4A 1RT5A 3VF4A 4YOWA 4EZ9A 4JI8K 4B3RK 5EU7A 3CMAN 2O8CA 1QVFM 4XH5A 4GKKK 5FPEA 1JL1A 3KKRA 1ASVA 4BC3A 4OLBA 4JKEA 3OY9A 5LY3A 4JKHA 4FVUA 1NGBA 4A61A 4BG9A 4FJNA 4WFNL 4IZ9A 3VQDA 3T1HK 4NYNA 1KTQA 4M3TA 1S9EA 1XMOK 1DEJA 3BZCA 4CESA 4N76A 3SYZA 1RDWX 2IIRA 2P51A 1VQ9N 3OYBA 4E3SA 2I7PA 1LV5A 1IKWA 5LJVA 3QFPA 2G8UA 5EOYA 3CCVN 1T8EA 4DSLA 4DV1K 3SV3A 1SZ2A 1RFQA 4FO0A 5SWMA 4FLVA 3BGRA 1WSEA 3AA3A 4B9NA 1YF5L 1YVNA 3C0BA 4BC5A 4BDZA 4BRIA 3TTDA 4FJ8A 3JXUA 4O0IA 2YJFA 1KVBA 1UA0A 1VSHA 2QM1A 5AJ3K 5BRDA 4QS8A 3NHGA 4RTFD 4BDPA 3I56N 4NXMK 4CF1A 3MK6A 3ZCMA 3VEXA 1NJWA 2ZGYA 1JCFA 4R5PA 2HBJA 2ZGZA 3VF6A 4OO1J 3DRRA 4CJEA 1UOCA 1K8KA 4B08A 1NJYA 1IV0A 3QNNA 2WTUA 2CGJA 4RCHA 1JLEA 5AQNA 2W6KA 3VQ7A 3CCSN 4BY9C 4I6MA 2FF6A 1W2BM 3NDKA 1DKGD 5BRHA 3KIOA 4M3UA 1O1WA 3HVRA 2A6AA 3ASMA 4FPAA 4LH5A 4RW8A 4H0XB 2EWSA 5KQ8A 3WXKA 4PKHA 1SKWA 3A5OC 2KFNA 2B6AA 1BOTO 1S1WA 4JKAA 3QINA 3LM2A 5E41A 4RWTA 2P9PB 3MN5A 2FSKA 5FROA 3DLBA 4G9ZA 1WOQA 3VN5A 1QHTA 1EO1A 3SMPA 3NGZA 4H0VB 3WNFA 5AQMA 4DTUA 4JK8A 4JKFA 4CJ7A 3CC7N 3THWA 3H45C 4EP4A 3DXMB 4CJWA 5GIOA 4NO7A 2YJEA 5LJWA 1L3SA 4PL8A 1KVAA 4C1NK 5AQZA 1YJNN 3TAEA 1MU2A 2YKMA 1RBRA 2A5XA 1RBVA 3HRGA 3LDPA 1V4SA 2NRTA 4Z4GA 4BWJA 1WSFA 4H4OA 1Q7YO 4C8NA 4BR9A 1W9HA 4CHQA 4A59A 2W41A 2GUIA 3O1BA 4WQ5A 4BE0A 3M3ZA 3SNNA 4K8XA 4FM1A 4JNEA 3BUZB 2GV9A 2H3GX 3W3DA 1OVYA 2IDOA 4A5BA 4JAXA 3G0ZA 3ULDA 3QERA 3LDNA 1DLOA 3HOTA 3U8XA 1NG9A 4YDUA 3OS2A 1KCFA 1NK9A 3THXA 3OYIA 4FL9A 3TAMA 2HBLA 3CJCA 1TYQA 4JHDB 2KZZA 1TKXA 3NH1A 1HJRA 2ATQA 3OYJA 4DUYK 3SAHA 3R1XA 1HNIA 4NCGA 2P9LA 1JLQA 4YOUA 4DFKA 1Q9XA 3OYCA 4B9MA 2E5LK 4OJRA 5BPMA 1EP4A 4ID1A 4B9UA 3MN9A 3JAMO 2XRIA 1EETA 4B9QA 1BHLA 3PY8A 4CJKA 2NRZA 4AHUA 3AVLA 4CZLA 2Q2RA 1YXQA 2FXUA 4FWSA 4FLYA 2PYLA 4RW6A 4CEDA 1HR0K 3HSTB 1BQMA 4B3MK 3OYKA 4YOYA 3ZX2A 1ILYA 4B9LA 4BR4A 2O8BB 4DTOA 1S1VA 2ASPA 1L3UA 1HLUA 1KFSA 4RW9A 5KPRA 3WEEA 1X1PA 4E89A 4CZMA 3M8SA 3M8QA 4NCBA 4CHYA 3RSEB 5GINA 4F2RA 5ELZA 4LF8K 5IWAK 1LCUA 2E2PA 3TPQA 1IJJA 3FFIA 1T3VA 1XI1A 1LWFA 4MLHA 1GLFO 1M1KO 4XH1A 3H3NO 2UU9K 1XHXA 1DTTA 4M3ZA 4CEBA 4KB1A 3P83D 3VEVA 3CPEA 4QOZB 1C0MA 1N34K 3AAPA 5JS1A 3AA4A 4K8ZA 2Z1GA 2D0PA 3I55N 4DV0K 1NLVA 3EZWA 3VERA 4E7IA 5AZJB 4BRLA 1JLGA 1QHAA 2OANA 4H0YB 3D2EA 3V9SA 1NJZA 1S6PA 5C42A 3T1YK 4WFBL 3NH0A 3TAPA 4H0TB 4YOTA 1WUAA 3KK7A 2IC3A 4CGFA 4FJ5A 3F2KA 1F21A 2LSNA 4A57A 4F8RA 3HM8A 3OJSA 3WXLA 4JI7K 4Z4EA 5TKWA 4W5NA 3DOKA 1JLBA 1KC8O 4PA1A 4DMNA 1R59O 3BY5A 3HP6A 5F0XA 3VEZA 3O1WA 3DLLL 1K9MO 3OYMA 4BRQA 4XIUA 4YOVA 1RDAA 3RRGA 1B9DA 3TAGA 1KRPA 1ZBHA 2ITMA 3TAQA 1XQSC 5C2FA 4BE1A 3NF8A 4KTZA 5GIPA 3CJ9A 2HNZA 3IG1A 4B3OA 4KI6A 3FE1A 3LWMA 3P31A 3AO5A 5BPLA 2E4LA 3M5RA 5FLXO 2RKIA 3GDQA 3SZ2A 3O9TA 1NGFA 2P5OA 4HTUA 4GVMA 1QSYA 2ASMA 3NF7A 3CFRA 4B8AB 1L3TA 3V81A 3QEXA 3DRSA 5AQGA 1YJ9N 4CJ4A 4RG8A 2BDPA 4Z4FA 5AQJA 2HHUA 3VQ8A 1W97L 3KLEA 4J2EA 1BU6O 1WSGA 4OPHA 2J4RA 4UY8O 2DY4A 4EAHD 2D4WA 5BN8A 4PHTX 4M3YA 2HHQA 3RWUA 3UB5A 4JD2B 5AZIB 3ZT3A 1WLJA 1Y64A 2UXCK 3CM5A 5AQLA 4LFBK 1XC3A 4KH6A 1X9WA 1QSLA 5HBMA 3R3LA 4KHUA 3H3OB 4W5QA 1VSJA 3O9QA 1X9JA 4CBUA 2BH1A 1SUQA 4BRKA 1QSSA 4CGJA 4KV8A 4I2PA 4O5BA 1SAZA 3NVMA 2HHXA 4CFCA 2NUBA 2E2NA 5ADXA 4Z4HA 4FM0A 3CCUN 1KQSM 2JWKA 2V51B 3KHYA 4FJHA 1MDUB 2KFZA 3DM2A 1VSIA 1KLNA 2P9PA 3O08A 3IFRA 2QXLA 2FBXA 5CYMA 3H1VX 4XH4A 3IMXA 1Z26A 5FDLA 3SAGA 4E7KA 3THVA 2D5RA 1M90O 5CYQA 4BC2A 2RE2A 3NFAA 1GOBA 3ENBA 3O6WA 3DXMA 4DTPA 1Z25A 1JKHA 3Q7CA 4JV5K 3OS1A 4Y1DA 3PIPL 4LFAK 5FPMA 2A1SA 2G8KA 4FK2A 4M3XA 5J2PA 2NRWA 3D7EO 5M1OA 5C24A 3AY9A 2BUPA 4CJLA 3LAKA 4DLEA 3V6DA 3HT3A 2UUAK 3CG7A 1K73O 3QBXA 2RN2A 5AQFA 4CJRA 4OGCA 4Y1CA 3ZT2A 4GY2B 4FJKA 3O5BA 4CJFA 1L5UA 5HRSA 3IDHA 3NVKA 2YHXA 4F3TA 4X65K 1YUWA 1KLMA 5JS2A 2KTQA 3FFKB 4Z94A 4H4MA 2HVHA 3OJUA 3CFOA 5BR8K 4CEOA 3AVJA 3NGIA 1IBMK 2E6MA 2F9TA 1HQUA 1NU0A 2ZJPL 4DFMA 2F4VK 4I9QA 4FVMA 1VQ7N 4FK4A 1YTUA 1YAGA 4JKCA 3E9LA 4FJXA 3WEEB 4JRPA 4DSEA 2B4JA 1YT3A 4CD1A 4JHDA 3QFUA 1BI4B 5CE3A 4O4GA 3VQ5A 1NGDA 3MAQA 2QKKA 4LF6K 3RMDA 4BRNA 1QZ5A 3CCEN 3D6RA 2F7TA 3LDOA 4CF8A 4DU3A 5HOOA 3OTOK 2QWPA 3AVNA 3FZLA 1NOYA 1RCHA 1E4FT 4B1VA 3VGKA 4CGHA 3TTCA 4DG1A 4FWRA 1EX4A 1GOCA 3ID8A 3P1GA 3CC2N 2RF2A 3MX2A 1D5AA 4DV7K 5JVHL 1JLAA 2A40A 3QIOA 2AJQA 3TI0A 1ZXOA 3CJAA 5HRRA 2O8BA 1LWEA 4IDHA 4DR1K 1HKCA 3RMCA 3SV4A 4DTJA 3SUOA 1GLDG 1C1BA 4DFPA 1RDCA 3KLFA 4YY3K 2HSTA 3OYGA 2HNDA 3RSEA 3MECA 4FLWA 4J2BA 1NK6A 4JI6K 2FSNA 3GL1A 2OPSA 3ENOA 4QAGA 3L3UA 3Q7BA 4KHYA 2A41A 1KSPA 3LALA 3QEPA 2F8TA 1GLLO 3DMJA 5CZ2A 1TK0A 1EQYA 3HXMA 4HWIA 3MEDA 1IG8A 1S6QA 1N8RO 2I7NA 2ZJQL 3RR7A 4EHTA 2F8SA 4JK9A 1QQNA 4E19A 3V1QA 2P9UB 5AZJA 4CW7B 2VQFK 4DV4K 1C0TA 4XEIA 3KWIA 4BRHA 5CY4A 1NNEA 1E3MA 3AVAA 2PYJA 4OX9K 1YTAA 4NLBA 1EWRA 5E84A 1Z05A 1N5YA 5B8HA 3QEIA 1JXBA 2HHHK 4IOXA 4BGAA 2GWJA 4BRAA 4JLHA 4BGBA 4O5FA 4EZ6A 4DSFA 4B8CA 3ID6A 1S1XA 4AHVA 1BDGA 3AVFA 4Y0WA 4DR4K 1CZBA 3HZ6A 2QWQA 4LFCK 4CJTA 2BTFA 4FZXC 4K43A 1Q81O 1B92A 3KD5E 4UQGA 1RTIA 3LPTA 1SL1A 1D9DA 2P9SB 2HMIA 3SJHA 1NGIA 4K0KK 2Z1HA 4JKGB 4C8OA 3EN9A 4JS5A 1XHZA 1FXXA
chains in the Genus database with same CATH topology
4CZGA 3A5MC 2VGNA 3BEXA 4GVEA 2QWLA 4YOUA 3CI5A 3MWTA 2Q36A 4CZFA 3ZYYX 2GTDA 3ENHA 1BA0A 2IVPA 2A42A 2Q1NA 3L0QA 4IEIA 5AQWA 5BPMA 3DWLA 2Q31A 3MN9A 4H03B 1HPMA 3C7NB 4B1XB 4B9QA 1V4TA 2Q0UA 2NRZA 3LDLA 4CZLA 2VYPA 2FF3B 5BN9A 2Q2RA 1YXQA 2FXUA 4FWSA 2E20A 4IWVA 3CERA 4K25A 4WFAL 3TSPA 4AM7A 3VTHA 2NRVA 3KZBA 3FZFA 4KH4A 3UKRA 4DQ8A 4YOYA 3U9DA 3VOVA 5E26A 3ZX2A 1ILYA 3OA9A 2DPNA 3DXKB 4BR4A 3GBTA 5KPZA 2ASPA 3MN7A 2NRRA 3FR0A 1HLUA 3H1QA 3F9MA 4JKBA 4GV3A 3CMEN 3P4IA 3DJCA 3VF2A 5KPRA 1VQNN 4NB4A 2P9NA 2E1YA 2QWRA 3ULEB 4YDUC 4IJAA 2V52B 3WEEA 3ZEUA 4CZMA 5CR4A 4CI6A 3AGRA 3RSEB 5GINA 3L6QA 5M1FA 5ELZA 3CJBA 3OHRA 3RVCA 1LCUA 3W0LA 2QEXN 4ISGA 2E2PA 3TPQA 1IJJA 1T3VA 4EFHA 5ADXH 3WXIA 3ZETA 2HBMA 4MLHA 1GLFO 3T69A 4WF9L 5AQPA 1M1KO 5AQOA 4XH1A 1GLBG 3G25A 2V7ZA 3H3NO 3CPWM 4FWQA 3VENA 4C23A 1S3XA 4CZIA 3EKSA 3HTVA 4JD2A 5AZIA 3MWPA 4BROA 1YITN 1GLCG 3U9ZA 1NGHA 4FOEA 3F5TA 4PKGA 1HKGA 3CPEA 3L4IA 5EX5A 3VEVA 3QICA 4BG8A 3AAPA 3MCAB 3MMVA 5AQYA 3VEOA 3N4PA 4PKIA 4LC9B 2D0PA 3I55N 3CC4N 1NLVA 3QDKA 2AA4A 5AQIA 3EZWA 3VERA 3KWGA 2GELA 3SK3A 2KKZA 2QA4N 1KXPA 3O8MA 5AZJB 4H0YB 1QHAA 2OANA 2PFUA 2QI2A 3D2EA 5TKYA 5FPNA 3VPZA 4DHYA 2PAVA 4WFBL 2YHWA 4H0TB 5BREA 5MLCQ 4YOTA 1KAYA 4FSVA 4QS9A 1VQMN 1WUAA 4BRLA 5DM6L 3KK7A 4CZEA 5EVZA 5EXWA 4WCEL 1KAXA 3F2KA 1VQON 4GV6A 1XUPO 3J7ZO 4A57A 3HM8A 2GEMA 3ATVA 5KPTA 4WQ4C 3WXLA 5TKWA 4GNIA 1VQ6N 2CGKA 5CHIA 1KC8O 3D2FA 2YI1A 3EL2A 1R59O 4J8FA 5F0XA 5AQSA 3VEZA 3O1WA 3CF5L 4BVPA 2GWKA 3DLLL 3T7ZA 4CBXA 1K9MO 4BRPA 3GOIA 4PL7A 1TUYA 4BRQA 3MDQA 1TUUA 5GAHP 4H0PA 4JKDA 4YOVA 3ATUA 3UKUB 1TYQB 3AARA 4ILJA 2ITMA 2HF4A 4M63C 1NGGA 1NGEA 3IKMA 3WXJA 4U67L 3MX5A 3SLCA 3TSQA 1XQSC 2Q0RA 3I8BA 5C2FA 2HBKA 4MLEA 1MWKA 2P9LB 4U7BA 5AQQA 3AAQA 4EIAA 5GIPA 3CJ9A 4BR0A 2ZJRL 1Z6RA 3O4WA 1C0GA 3HI0A 4FWOA 3VEYA 5AQXA 4IO9L 1HJOA 3I33A 3GE1A 1VQKN 3FE1A 4BC4A 3LM9A 2QWNA 3P31A 4A5AA 1GLJO 5BPLA 2QWMA 3M5RA 2NZTA 3EE9A 3GDQA 5JMVA 1X3MA 2D1KA 1NBWA 2E2QA 2NRHA 3O9UA 1NGFA 3O9TA 1NWKA 5GADP 5JVGL 3G4SN 2NNWA 3E9PA 5AQHA 5AQTA 3HOSA 2W40A 3UKRB 1T6CA 4FWNA 2IVOA 3VGLA 1DGKN 2ASMA 3CCLN 1H1VA 5C12A 5AFUA 1HUXA 4IEEA 3CIPA 1KAZA 5AQGA 1YJ9N 2WUSA 5JICA 3ZX3A 3FLCO 4H5TA 3S41A 1Q82O 1VQ4N 5AQJA 3ZEUB 4BR2A 2VCPA 1RGIA 2P9KB 3SAFA 1YJWN 2CH6A 4WQ4A 3WXMB 1W97L 3OBWA 3IUCA 4ILGB 2HF3A 3CETA 3UE5A 1BU6O 4OPHA 4K41A 2J4RA 4IXCA 3ZETB 4UY8O 1MWMA 3H46O 2YX6A 4BRGA 4EAHD 2D4WA 4FWPA 3R9PA 1T6DA 4KH5A 5BN8A 4PHTX 3GG4A 3H6EA 5C2DA 3UB5A 3BF3A 4JD2B 5AZIB 5C0YA 3WQTA 1BA1A 1Y64A 4IOAL 3E1YA 1DT9A 3WT0A 5AQLA 2V7YA 1XC3A 4KH6A 3R3LA 4CZJA 3H3OB 1ATRA 4YORA 3O9QA 1X9JA 4NLCA 3O80A 4CBUA 4IFEA 2BH1A 3CCQN 4BRKA 1QZ6A 3D2EB 5AQVA 3G6EN 4CZKA 3G71N 3LL3A 4ILHA 1C0FA 1SAZA 4H5NA 2ZWHA 5GAGP 3NVMA 4CBWA 3CXCM 4BQZA 3BP8A 2FLOA 3P38A 4O8UA 5AQUA 2E2NA 3MCPA 3VMFB 4BRCA 3DXKA 1U2VA 2CH5A 5ADXA 5M1KA 4GV9A 4MDAA 3OBYA 2JWKA 3CCUN 2V51B 1KQSM 3KHYA 5KQDA 1QQOA 3O9RA 3CD6N 2KLAA 4AF1A 1MDUB 2HMPA 4EHUA 3CCJN 1SQKA 4B1ZA 4JN4A 5JLFA 3VF4A 2CGLA 5HL7L 2P9PA 3D2FB 2NRXA 3IFRA 3O08A 4YOWA 2QXLA 4BREA 1J6ZA 4E1JA 3H1VX 4XH4A 1VAZA 3IMXA 3CMAN 1QVFM 4XH5A 1YIJN 5FPEA 3LDQA 4BRDA 4A2BA 3SAGA 4BC3A 3M6GA 3E66A 4CD3A 1M90O 4JKEA 3C65A 4BC2A 4DB3A 2RE2A 5LY3A 3DAWA 4JKHA 3ENBA 4FVUA 1NGBA 4A61A 3O6WA 5H1SQ 3DXMA 4BG9A 4JEPA 4WFNL 4ISFA 5F2RA 4IZ9A 3C6AA 3Q7CA 1U6ZA 4R79A 3CCRN 1ZC6A 3HBTA 1G99A 3HSCA 2E1ZA 3PIPL 2QWOA 5FPMA 1HKBA 2NRWA 3D7EO 1DEJA 5M1OA 3AY9A 1RDWX 3J8AA 5BRFA 2BUPA 3A5NC 1CZAN 2IIRA 3CJ7A 1QQMA 1JCEA 3K9JA 1VQ9N 1NM1A 1P8ZA 1Q18A 2I7PA 4KBOA 4FPBA 4BRFA 4FWKA 1K73O 5LJVA 1SS6A 3QBXA 3QFPA 5AQFA 3CCMN 5EOYA 3CCVN 4GY2B 4K42A 3O5BA 1SZ2A 1RFQA 4FO0A 2ASOA 4FWLA 3IDHA 3NVKA 2YHXA 2P9UA 1YUWA 2UYTA 2WC9A 1YF5L 1YVNA 4F9OA 4QS7A 3C0BA 4BC5A 3OW2M 2A3ZA 4BRIA 3FFKB 3TTDA 3L4QA 4Z94A 3JXUA 5DM7L 2YJFA 1NMDA 3SMSA 1ATSA 1VQ5N 4O8KA 4H5RA 3FZMA 2QM1A 5BRDA 3QB0A 4QS8A 3C6HA 4RTFD 4IJNA 2KHOA 3I56N 1S22A 4AM6A 2F9TA 4MO4A 1BUPA 3O9SA 2ZJPL 1LOTB 3A0IX 3U4LA 2E2OA 3EO3A 4FWMA 4ISEA 1NJIO 3VESA 3MK6A 1VQ7N 1YAGA 3QBWA 4JKCA 3E9LA 2ZGYA 2P9NB 3M1FA 4M7XA 3VEXA 1JCFA 1ESVA 3WEEB 2HBJA 2ZGZA 3VF6A 4OO1J 1BG3A 1E4GT 3R8EA 4CD1A 1K8KA 1YHQN 4JHDA 3QFUA 5CE3A 3FGUA 2GUPA 4H5WA 1NGDA 2CGJA 2P9IA 2P9SA 4RCHA 3CHWA 5M1NA 5AQNA 1S72N 1JJ2M 4JKGA 4WQ5C 3CCSN 4BRNA 3VGMA 1QZ5A 4I6MA 4BY9C 2FF6A 1Q86O 3CCEN 1K8AO 1W2BM 1GLAG 3D6RA 2F7TA 1DKGD 4BQLA 5BRHA 3LDOA 4HTLA 4JK7A 4BR5A 2F9WA 5HOOA 2A6AA 2QWPA 5BPNA 4FPAA 4DKWA 3FZLA 5AQRA 4B1YB 4H0XB 2Q97A 3AGKA 2GX9A 2EWSA 3C7NA 1VQLN 5KQ8A 1BO5O 3WXKA 1U2VB 4IO8A 1E4FT 4PKHA 4B1VA 3CJ1A 3A5OC 4BVOA 5JLHA 3VGKA 1BOTO 3N4QA 1ATNA 3TTCA 4WYBA 4JKAA 2WFBA 4FWRA 4MO5A 3ID8A 3CC2N 3LM2A 4BRMA 3MX2A 3TTFA 4RWTA 5JVHL 2D0OA 2P9PB 2P9KA 2QTDA 3MN5A 2FSKA 4FOIA 2A40A 3A8YA 1ZXOA 3CJAA 4G9ZA 4L3QA 1WOQA 3FZHA 4IDHA 4B1UB 1HKCA 3PLAA 2OTLN 1GLEG 3SMPA 1EO1A 3E9OA 4H0OA 4H0VB 2FSJA 1GLDG 5AQMA 4M7YA 4JK8A 5EY4A 3ULEA 2OTJN 4JKFA 5F1XA 4CJ7A 3JS6A 2HSTA 3CC7N 3FZKA 3RSEA 3H45C 3DXMB 2WBNA 3SBTA 5GIOA 4NO7A 1HX1A 3K9KA 4A2AA 2YJEA 2FSNA 3GL1A 5LJWA 4PL8A 1ZBSA 3ENOA 2IVNA 4B1WB 4C1NK 5FPDA 3Q7BA 5I9EB 2A41A 5AQZA 1YJNN 2HOEA 5M1QA 3HRGA 1JCGA 1RDUA 2A5XA 3KVGA 1V4SA 3LDPA 3WUHA 5C15A 2NRTA 3ZX0A 1P90A 3EE8A 2AP1A 4C1NI 4A62A 1VQ8N 1GLLO 1NGAA 1D4XA 1EQYA 2YCHA 4HWIA 3WQUA 1Q7YO 1IG8A 3PIOL 3TSUA 4BR9A 3VTIA 1N8RO 2I7NA 1YI2N 1OKJA 4A59A 2ZJQL 1MA9B 2W41A 4EHTA 1O13A 3O1BA 4JK9A 4WQ5A 1QQNA 4H5VA 4CZHA 3M3ZA 3NMUA 2P9UB 2ZF5O 5AZJA 2NLXA 5GAEP 3VETA 2VGMA 3EKUA 4JNEA 4XEIA 3BUZB 5BR9A 2E88A 2PBDA 2H3GX 3KWIA 3R6MA 3W3DA 4BRHA 5AR0A 5C10A 4MDBA 1OVYA 4NLBA 4A5BA 4JAXA 5E84A 3TU5A 3P39A 1X3NA 4BR7A 1Z05A 1NGJA 1NGCA 5B8HA 2RHKA 4IOXA 4BGAA 2GWJA 3VEWA 4BRAA 4BGBA 4O5FA 3LDNA 1KD1O 3HOTA 3U8XA 3ID6A 3QMLA 4YDUA 4IOCL 1VQPN 2VWBA 2JWLA 5AQKA 3MN6A 1BDGA 4Y0WA 2YHYA 3HZ6A 2QWQA 1BWFO 2BTFA 4FL9A 4K43A 1Q81O 1T44A 2QW9A 2HBLA 3CQXA 3SBGA 1QVGM 1K8KB 3CJCA 1TYQA 4JHDB 3UKUA 3A5LC 4DCHA 4YOXA 2P9SB 2P9IB 3SJHA 5M1PA 1NGIA 3SAHA 3BF1A 3R1XA 4JKGB 5AFUH 2P9LA 3EN9A 3B8AX 2E8AA 3CQYA 4I6MB 4OPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV3 A;  4GVE A;  4G9Z A;  4GV9 A;  3MX5 A;  3MWT A;  3Q7C A;  3MX2 A;  4FVU A;  3Q7B A;  3R3L A;  3MWP A;  4GV6 A; 
#chains in the Genus database with same CATH topology
 4CZG A;  2VGN A;  2QWL A;  1FK9 A;  4CZF A;  4PUO A;  2IVP A;  2Q1N A;  3L0Q A;  4IEI A;  3QIP A;  2Q31 A;  1UAX A;  3C7N B;  1V4T A;  4DR6 K;  2D0A A;  1T7P A;  3AO1 A;  5BN9 A;  4W5T A;  4FJG A;  4KRF A;  1BCO A;  4WFA L;  1T05 A;  4DF4 A;  2NRV A;  3KZB A;  2DPN A;  3GBT A;  3OYE A;  3MN7 A;  4B9T A;  2NRR A;  2ZQB A;  4GV3 A;  1ASW A;  1HYS A;  2WON A;  1VQN N;  4CFD A;  2P9N A;  1REV A;  3ULE B;  1LAV A;  4RW4 A;  5T7B A;  5CR4 A;  3L6Q A;  4CFB A;  3CJB A;  3RVC A;  2HB5 A;  2OCE A;  1B9F A;  4CJS A;  2YNH A;  4IFY A;  5ADX H;  2HBM A;  4WF9 L;  4FJL A;  1HMV A;  3NBP A;  4CEF A;  3V9W A;  2XY8 A;  3ZT1 A;  4CZI A;  4JD2 A;  5AZI A;  3ZSV A;  1QS4 A;  4AHR A;  4JRQ A;  2IAJ A;  3F5T A;  1HKG A;  5EX5 A;  4BG8 A;  2QK9 A;  3MCA B;  1TAU A;  5AQY A;  3VEO A;  3N4P A;  4PKI A;  4ZHR A;  3QDK A;  5AQI A;  4FJM A;  2KKZ A;  2QA4 N;  3O8M A;  3VPZ A;  3ZSW A;  4WE1 A;  4E1M A;  3KLH A;  1KAY A;  4TSX A;  4FSV A;  2ZM6 K;  4QS9 A;  4F2S A;  5DM6 L;  5EXW A;  4WCE L;  1VQO N;  3J7Z O;  1IG9 A;  4DSK A;  5J2Q A;  4FZY A;  4WQ4 C;  3LP1 A;  4KTQ A;  1VQ6 N;  2CGK A;  5CZ1 A;  1ITG A;  2JLE A;  2YI1 A;  3EL2 A;  4J8F A;  4DQS A;  3SCX A;  4Z4I A;  1Q9Y A;  4BVP A;  3QLH A;  4LH4 A;  4N56 A;  3PX6 A;  1TUY A;  4Z4C A;  4C8K A;  4PQU A;  1K6Y A;  3ATU A;  1WNS A;  3UKU B;  1JLF A;  4M63 C;  1VK0 A;  1NGE A;  5J2N A;  2OPR A;  3TSQ A;  4DUZ K;  3NGY A;  1MWK A;  4U7B A;  3PO4 A;  3AAQ A;  2DTU A;  4BR0 A;  3DOL A;  3O4W A;  2ZJR L;  3HI0 A;  3VEY A;  3NH2 A;  3VQP A;  3DLH A;  3LM9 A;  4HUE A;  2YKN A;  4CEE A;  1BGX T;  2EX3 A;  4OKJ A;  3L2R A;  2JGU A;  3SUQ A;  3EE9 A;  1X3M A;  2D1K A;  1NBW A;  2NRH A;  1WSH A;  5GAD P;  5JVG L;  4BDY A;  3PX4 A;  5AQT A;  2Z1J A;  4FWN A;  1HNW K;  3WNH A;  4CJ5 A;  4Q5V A;  1QE1 A;  4W5O A;  1NK5 A;  3CIP A;  1KAZ A;  4OGE A;  2VCP A;  3K2P A;  1RGI A;  3QEV A;  1TGO A;  1TKZ A;  1HPZ A;  3AA2 A;  1HRH A;  3O4N A;  1YJW N;  2CH6 A;  3WXM B;  3OBW A;  3LP3 A;  4KHN A;  5D3G A;  1S9G A;  3CET A;  3EZ5 A;  4DS4 A;  4FJI A;  1WN7 A;  2YNF A;  4IXC A;  4DWI A;  4CJV A;  3H46 O;  2FC0 A;  1U04 A;  1T6D A;  4LSL A;  5C2D A;  3ZT0 A;  2HHV A;  3NAE A;  3T1A A;  4IOA L;  3ZSX A;  1BI4 A;  1HNZ K;  2V7Y A;  3QEW A;  1OH7 A;  1RT2 A;  3ZT4 A;  4ELT A;  3K58 A;  4NLC A;  3J81 O;  3KLI A;  4IFE A;  2X78 A;  2FBV A;  4IFV A;  2ZWH A;  5GAG P;  4LF5 K;  3CXC M;  4BQZ A;  3I0S A;  3BP8 A;  4PWD A;  1VSL A;  3DRP A;  4BRC A;  2VQE K;  1WAF A;  4GV9 A;  3OBY A;  2P1J A;  3V9U A;  1NK4 A;  1EKE A;  3CCJ N;  3WNE A;  4OPK A;  1WSI A;  3UIQ A;  1LW2 A;  3SQ1 A;  4O44 A;  1N32 K;  5DK5 A;  5HL7 L;  3U3Y A;  4B3S K;  4BRE A;  3HJF A;  1WB9 A;  3LDQ A;  4BRD A;  1RDB A;  1HYZ A;  4CD3 A;  3HPO A;  4DB3 A;  3E01 A;  3PO5 A;  5HP1 A;  3AO4 A;  3DAW A;  1CXU A;  5H1S Q;  4FYD A;  5F2R A;  3BZK A;  3C6A A;  1U6Z A;  4R79 A;  4DFJ A;  3HSC A;  1G99 A;  1VSK A;  2E1Z A;  2QWO A;  1HKB A;  4CHO A;  3AVB A;  5BRF A;  3A5N C;  1JCE A;  1RIL A;  4FJ7 A;  4DQP A;  1P8Z A;  4BRF A;  1U45 A;  4FM2 A;  1IKX A;  1SS6 A;  4CJQ A;  4K42 A;  4FWL A;  1R0A A;  2P9U A;  3VA3 A;  2WC9 A;  2P5G A;  1FKP A;  4OVL A;  4QS7 A;  3OW2 M;  2VWJ A;  3L4Q A;  1NMD A;  3SMS A;  1ATS A;  2D0B A;  1VHX A;  1VQ5 N;  3FZM A;  3QB0 A;  4CIF A;  3C6H A;  1S22 A;  2XY5 A;  3T3F A;  3EY1 A;  3O9S A;  3A0I X;  2E2O A;  3EO3 A;  1NOZ A;  4FWM A;  3VES A;  3QBW A;  3OYH A;  3M1F A;  2P9N B;  4M7X A;  1ESV A;  1RT1 A;  4FLU A;  1IH7 A;  2F96 A;  1E4G T;  2OPP A;  3LPU A;  5KRS A;  3LP2 A;  3AV9 A;  4H5W A;  2P9S A;  4IG0 A;  3CHW A;  1Y97 A;  4JKG A;  4WQ5 C;  2ZD1 A;  4BE2 A;  4CHZ A;  5KGX A;  2YNG A;  1Q86 O;  1GLA G;  4BQL A;  3DLE A;  4HTL A;  4JK7 A;  2OYQ A;  4BR5 A;  4ICL A;  4DKW A;  4B9S A;  4CGG A;  2Q97 A;  2GX9 A;  1VQL N;  3C7N A;  1BO5 O;  1I39 A;  1U2V B;  3VQ4 A;  3I8D A;  3CJ1 A;  5DMR A;  2WFB A;  3ZLJ A;  1EXQ A;  4BRM A;  3AVC A;  2P9K A;  2QTD A;  4FOI A;  4G1Q A;  3A8Y A;  3EYZ A;  3FZH A;  3PLA A;  1DTQ A;  1HYV A;  1GLE G;  3E9O A;  4H0O A;  3KK1 A;  4AHT A;  1IKV A;  4LD0 A;  4E7H A;  5EY4 A;  2OTJ N;  3ULE A;  4DU4 A;  3IAY A;  1VSE A;  3FZK A;  3SUN A;  1N36 K;  1EWQ A;  3K0S A;  3NCI A;  4A2A A;  1XNR K;  1ZBS A;  1OH6 A;  2IVN A;  5FPD A;  5J1E A;  2HOE A;  3M8R A;  3PSF A;  3KVG A;  1RDU A;  5C15 A;  4YHH K;  1P90 A;  2AP1 A;  1VQ8 N;  3TAB A;  1XC9 A;  2X74 A;  3LAM A;  4ELU A;  2YCH A;  3TSU A;  1ZYQ A;  2DFE A;  2QKB A;  5HRN A;  1OKJ A;  3DYA A;  3L2U A;  1MA9 B;  1O13 A;  4CZH A;  2YNI A;  2G8F A;  1FKO A;  1TL1 A;  3V1R A;  4KRE A;  1JLC A;  2E88 A;  1A5V A;  5AR0 A;  1X3N A;  1NGJ A;  1TL3 A;  3VEW A;  1LW0 A;  5KGW A;  1KD1 O;  3O3F A;  4FJ9 A;  3O4Q A;  1G15 A;  3QML A;  1CLQ A;  4CEC A;  4IOC L;  1VQP N;  2XY6 A;  5AQK A;  1IBK K;  4KHW A;  3MN6 A;  4CJU A;  1YVU A;  2YHY A;  1BWF O;  3V9X A;  4CE9 A;  4X66 K;  4OPJ A;  1I3A A;  1QVG M;  3UKU A;  1JL2 A;  4W5R A;  4DCH A;  2P9I B;  1IO2 A;  5M1P A;  4JI2 K;  3ZSZ A;  3B8A X;  1C0U A;  4EP5 A;  4OPA A;  3A5M C;  4GVE A;  4JI0 K;  3T19 A;  3CI5 A;  4OLA A;  1BL3 A;  1BIS A;  2Q36 A;  4JI4 K;  3ZYY X;  4CEQ A;  3ENH A;  1BA0 A;  1LAW A;  2A42 A;  5AQW A;  1RT4 A;  1BQN A;  4H03 B;  3CYM A;  4B1X B;  2UUC K;  3HVT A;  1QQC A;  4DQR A;  3LAN A;  3LDL A;  3D0P A;  3SPZ A;  2VYP A;  2FF3 B;  1U47 A;  2E20 A;  3B6O A;  4IWV A;  3CER A;  4K25 A;  3TSP A;  4AM7 A;  3VTH A;  1X9S A;  1RBT A;  2WOM A;  3U9D A;  3L3V A;  4M41 A;  2G8W A;  1C6V A;  1RTD A;  4ID5 A;  5FRN A;  3H1Q A;  4JKB A;  3F9M A;  3P4I A;  4QCL A;  3DJC A;  3VF2 A;  4NB4 A;  2QWR A;  4IJA A;  4CI6 A;  3KD1 E;  1NMN A;  2QEX N;  1J5E K;  5J2M A;  1BIZ A;  4CHN A;  4EFH A;  3WXI A;  1N6Q A;  3T69 A;  4CK2 A;  5AQP A;  3H08 A;  1GLB G;  4LY7 A;  4CGD A;  3VEN A;  3MXM A;  1S3X A;  2D0C A;  3EKS A;  3SUP A;  3MWP A;  4BRO A;  1YIT N;  3S3M A;  1GLC G;  3U9Z A;  4FOE A;  4PKG A;  1LWC A;  3QIC A;  3MMV A;  1NKB A;  4FLZ A;  4LC9 B;  5A2Q O;  1TKD A;  3CC4 N;  3KWG A;  4IDK A;  3SK3 A;  4NXN K;  2UXB K;  4C23 A;  2PFU A;  3QET A;  3SPY A;  3I0R A;  5MLC Q;  3IS9 A;  3AVK A;  1J54 A;  4CZE A;  5EVZ A;  1KAX A;  2XO7 A;  1XUP O;  2W42 A;  4JI3 K;  3THY B;  4E1N A;  2GEM A;  3TR8 A;  4FLT A;  3P5J A;  4CEA A;  3WNG A;  1S1U A;  3VQ9 A;  3HK2 A;  5FRM A;  3QES A;  5AQS A;  3CF5 L;  1HQE A;  2GWK A;  4CBX A;  2XY7 A;  1RT6 A;  4PL7 A;  3MDQ A;  1TUU A;  1S5J A;  4GMJ B;  4H0P A;  4CFA A;  1RNH A;  4AQY K;  3AAR A;  2HF4 A;  1BIU A;  3J7A P;  3C6T A;  1NGG A;  3IKM A;  4NCA A;  3VA0 A;  4MLE A;  1NKC A;  1NK8 A;  3ISN C;  3TAN A;  4CHP A;  4EIA A;  3AVI A;  1RT7 A;  4Q0B A;  1BCM A;  1C0G A;  3KKS A;  4FWO A;  5AQX A;  1TAQ A;  3HPH A;  3IRX A;  4IG3 A;  2G8H A;  1HJO A;  2OZM A;  1VSF A;  4B3T K;  1HNX K;  1Q8I A;  4J2D A;  4N5S A;  4A5A A;  1GLJ O;  4CEZ A;  2ZE2 A;  2QWM A;  1IBL K;  2NZT A;  2XHB A;  3VQA A;  2O4G A;  3O9U A;  5JMV A;  4AHC A;  1GOA A;  1NWK A;  3G4S N;  2NNW A;  3E9P A;  5AQH A;  3HOS A;  4GKJ K;  3QO9 A;  3UKR B;  3QNO A;  4Z0U A;  1DGK N;  3CCL N;  1N33 K;  5C12 A;  5AFU A;  3ITH A;  4IEE A;  4KPY A;  5JIC A;  1OH5 A;  3FLC O;  1VQ4 N;  3ZEU B;  3LZI A;  4BR2 A;  2P9K B;  3DLG A;  4MFB A;  3IUC A;  4ILG B;  3UE5 A;  3VQE A;  3ZET B;  5LMN K;  2YX6 A;  4BRG A;  3RRH A;  3R9P A;  3HYF A;  3H6E A;  1U4B A;  3BF3 A;  5C25 A;  1BA1 A;  3AVM A;  3JYT A;  1WBB A;  4LF9 K;  3WT0 A;  3K5L A;  1I94 K;  4KI4 A;  2GBZ A;  4DR7 K;  4O0J A;  2IOC A;  5I42 A;  3KJV A;  4ILH A;  1FJG K;  4DR2 K;  5AQU A;  4F3O A;  3DXK A;  1U2V A;  2CH5 A;  5M1K A;  4CIE A;  1NK0 A;  4DU1 A;  5KQD A;  3CD6 N;  3TAR A;  2KLA A;  4FXD A;  4AF1 A;  2HW3 A;  1SKS A;  5KRT A;  2HMP A;  4PY5 A;  5JLF A;  2CGL A;  3D2F B;  1ZBF A;  2NRX A;  4DTN A;  2DFH A;  1J6Z A;  4HUG A;  4E1J A;  1VAZ A;  1TKT A;  1YIJ N;  4HVJ A;  4A2B A;  4BAC A;  4FLX A;  2YHB A;  3M6G A;  3E66 A;  1UA1 A;  2VG7 A;  3C65 A;  1D8Y A;  4YFU A;  2BE2 A;  4LF4 K;  4ELV A;  1CXQ A;  4CF0 A;  2ITG A;  3K5N A;  4JEP A;  4ISF A;  1RT3 A;  3AO2 A;  3EEQ A;  2OPQ A;  3AO3 A;  3B6P A;  3CCR N;  2UXD K;  3HP9 A;  4I7F A;  1ZC6 A;  3HBT A;  3OYN A;  3J8A A;  1SV5 A;  3LDS A;  4DV2 K;  4JYA K;  1CZA N;  3CJ7 A;  4LSN A;  1QQM A;  3K9J A;  1ZBI A;  4CVN E;  1NM1 A;  1Q18 A;  1NK7 A;  4KBO A;  4FPB A;  2R7Y A;  4E0D A;  4FWK A;  3CCM N;  1UWB A;  2X6N A;  4L8R B;  1IKY A;  2HVI A;  2ASO A;  1J9A A;  5KI6 A;  3KK3 A;  2DFF A;  4E7J A;  3VQQ A;  2UYT A;  4CF9 A;  4F9O A;  2A3Z A;  1WBD A;  5DM7 L;  2O8E B;  2O8D B;  2BAN A;  4O8K A;  4H5R A;  4IJN A;  2KHO A;  4AM6 A;  3AA5 X;  1U48 A;  4MO4 A;  3CQ8 A;  4FJJ A;  1BUP A;  1OVQ A;  1LOT B;  3U4L A;  4ISE A;  3ZSO A;  1NJI O;  2O8F A;  1OH8 A;  4DV5 K;  3RTV A;  1BG3 A;  1QTM A;  4DQQ A;  3R8E A;  1YHQ N;  1WAJ A;  2HNY A;  3FGU A;  2GUP A;  3G10 A;  2Q3S A;  1W0H A;  2P9I A;  5M1N A;  1S72 N;  1JJ2 M;  2G8I A;  3RR8 A;  3VGM A;  4DLG A;  4CK1 A;  1K8A O;  2A1R A;  2F9W A;  3L2Q A;  5BPN A;  5AQR A;  4B1Y B;  3AGK A;  4HCB A;  4IO8 A;  2X6S A;  3S3O A;  4BVO A;  3SI6 A;  5JLH A;  5K14 A;  3N4Q A;  1ATN A;  4WYB A;  3BDP A;  4MO5 A;  2QXF A;  4DS5 A;  3TTF A;  2D0O A;  4KFB A;  5SZT A;  1SL0 A;  4NYF A;  4L3Q A;  4M45 A;  2O8C B;  4B1U B;  2OTL N;  3LP0 A;  2PZS A;  3OVN A;  2FSJ A;  3PV8 A;  4M7Y A;  5F1X A;  3RMA A;  3JS6 A;  4I9L A;  2KZM A;  3OYD A;  4ZTF A;  2WBN A;  3SBT A;  3LZJ A;  1HX1 A;  3K9K A;  5I3U A;  4DTX A;  3VQB A;  4B1W B;  5I9E B;  2Z1I A;  4DTM A;  1FW6 A;  4CCH A;  5M1Q A;  3A2F A;  1JCG A;  3WUH A;  2HHT A;  4DR3 K;  2VWK A;  3ZX0 A;  3KK2 A;  3EE8 A;  4C1N I;  2HHW A;  4A62 A;  1NGA A;  1J5O A;  1D4X A;  1C1C A;  1KVC A;  1TV6 A;  3WQU A;  3C6U A;  4DSJ A;  3PIO L;  3VQ6 A;  3VTI A;  1YI2 N;  4DQI A;  2OZS A;  4H5V A;  3NMU A;  2ZF5 O;  2RPI A;  4KHS A;  2NLX A;  4M42 A;  3HL8 A;  1S1T A;  5GAE P;  3VET A;  2VGM A;  3EKU A;  5BR9 A;  4AH9 A;  2PBD A;  3R6M A;  5C10 A;  4IKF A;  3MEE A;  4MDB A;  3L8B A;  4DV6 K;  1XMQ K;  4DTR A;  3SJJ A;  5HLF A;  3TU5 A;  1CZ9 A;  3P39 A;  4BR7 A;  3S3N A;  4JI5 K;  3THY A;  2O4I A;  1NGC A;  4FW2 A;  2RHK A;  3HPG A;  3DI6 A;  1D9F A;  1ZBL A;  2FBY A;  3JSM A;  4JS4 A;  2VWB A;  2JWL A;  2W6L A;  2YHA A;  2EHG A;  1T44 A;  2QW9 A;  1RTJ A;  4KKO A;  3CQX A;  3SBG A;  1A5X A;  1K8K B;  2KQ2 A;  3A5L C;  1TK8 A;  4YOX A;  2OA8 A;  4HCC A;  4DF8 A;  3CFP A;  3BF1 A;  5AFU H;  4LF7 K;  4H8K A;  3CQY A;  2E8A A;  3AVG A;  4I6M B;  4RW7 A;  5KTQ A;  3BEX A;  3F73 A;  1VSM A;  1VSD A;  4F4K A;  4N41 A;  1VRU A;  4DR5 K;  3MWT A;  2ETJ A;  4KHQ A;  3SQ4 A;  2GTD A;  2HHS A;  3K5M A;  2Y1I A;  3DWL A;  4OKK A;  1HPM A;  4HUF A;  1SL2 A;  2Q0U A;  4CK3 A;  1RTH A;  1JXE A;  3HO1 A;  1T03 A;  4DV3 K;  4KH4 A;  4DQ8 A;  3FZF A;  3UKR A;  4DTS A;  3C95 A;  3VOV A;  5E26 A;  1J53 A;  3KLG A;  3OA9 A;  4FZZ A;  3DXK B;  4B9V A;  5KPZ A;  5IT9 O;  3FR0 A;  3M8P A;  4FK0 A;  2PY5 A;  3CME N;  3ZSQ A;  4E7L A;  2E1Y A;  3ZEU A;  4YDU C;  2V52 B;  1ZBU A;  3ZSR A;  3L2V A;  3THW B;  3AGR A;  5M1F A;  4C8L A;  3OHR A;  1W7A A;  2FBT A;  4O55 A;  3W0L A;  4ZTJ A;  4ISG A;  4IBN A;  4C8M A;  3LWL A;  3ZET A;  4GW6 A;  4JI1 K;  2E6L A;  1U49 A;  5AQO A;  3K5O A;  3G25 A;  2V7Z A;  3CPW M;  2IS3 A;  4FWQ A;  4X64 K;  3C94 A;  3HTV A;  1RBS A;  5HRP A;  1NGH A;  3L4I A;  3OS0 A;  4MQ3 A;  5HRO A;  4AIL C;  4CGI A;  2AA4 A;  3U6F A;  3OYF A;  2GEL A;  4CF2 A;  1KXP A;  3U3G A;  1L3V A;  2QI2 A;  5TKY A;  5FPN A;  4DHY A;  2PAV A;  3O3H A;  2YHW A;  5BRE A;  1VQM N;  3PSI A;  2Y1J A;  4CJ3 A;  4GV6 A;  3D45 A;  3NF6 A;  2KW4 A;  3HM9 A;  3K59 A;  3ATV A;  5KPT A;  2YV0 X;  5LL6 Z;  4GNI A;  5CHI A;  4HHT A;  2VG5 A;  3D2F A;  5LMU K;  1RBU A;  4AHS A;  4OKE A;  3T7Z A;  3THX B;  4BRP A;  3GOI A;  3PUF A;  1VRT A;  5GAH P;  4JKD A;  1TYQ B;  4ILJ A;  3WXJ A;  4U67 L;  3MX5 A;  3SLC A;  2UUB K;  3MXJ A;  2Q0R A;  3I8B A;  2HBK A;  3SQ0 A;  1ASU A;  2P9L B;  3DLK A;  2VG6 A;  5AQQ A;  2O8F B;  3ALY A;  1XNQ K;  1Z6R A;  4CER A;  4M3R A;  4CJP A;  3TAF A;  4IO9 L;  3I33 A;  3GE1 A;  1VQK N;  4BC4 A;  1A5W A;  2G8V A;  2QWN A;  1C1A A;  2IGI A;  3V4I A;  4YNQ A;  1NJX A;  4KB0 A;  2E2Q A;  3AVH A;  2W40 A;  4I2Q A;  1T6C A;  4BWM A;  1NKE A;  2IVO A;  3VGL A;  3MXI A;  4J2A A;  3K57 A;  1H1V A;  1TVR A;  3VQC A;  4M3W A;  1HUX A;  3CM6 A;  2O8E A;  2WUS A;  2O8D A;  3ZX3 A;  1Q82 O;  4H5T A;  3S41 A;  1KFD A;  1SKR A;  3SAF A;  4WQ4 A;  1TK5 A;  2HF3 A;  3ZSY A;  1X9M A;  3J80 O;  4K41 A;  1MWM A;  3KTQ A;  3OYA A;  1XWL A;  3PX0 A;  4FWP A;  3DLR A;  4KH5 A;  3OYL A;  3GG4 A;  2I5J A;  3NF9 A;  4KTW A;  5C0Y A;  3WQT A;  3V9Z A;  3E1Y A;  1DT9 A;  4V19 S;  4KHP K;  4KO0 A;  2B5J A;  4CZJ A;  1RDD A;  4CIG A;  3V1O A;  1ATR A;  4YOR A;  3NE6 A;  2BGG A;  3O80 A;  1WSJ A;  3CCQ N;  4DSI A;  1QZ6 A;  3D2E B;  5AQV A;  3G6E N;  3F9K A;  3TWH A;  4CZK A;  3G71 N;  3LL3 A;  3J7Y P;  1C0F A;  1HNV A;  4H5N A;  4N47 A;  4CBW A;  3O3G A;  3L2W A;  2FLO A;  3P38 A;  4O8U A;  3VMF B;  3SQ2 A;  3MCP A;  3RMB A;  4KAZ A;  3MEG A;  4MDA A;  4X62 K;  4FCY A;  1QQO A;  3O9R A;  4FW1 A;  4EHU A;  1SQK A;  4B1Z A;  3S9H A;  4JN4 A;  1RT5 A;  3VF4 A;  4YOW A;  4EZ9 A;  4JI8 K;  4B3R K;  5EU7 A;  3CMA N;  2O8C A;  1QVF M;  4XH5 A;  4GKK K;  5FPE A;  1JL1 A;  3KKR A;  1ASV A;  4BC3 A;  4OLB A;  4JKE A;  3OY9 A;  5LY3 A;  4JKH A;  4FVU A;  1NGB A;  4A61 A;  4BG9 A;  4FJN A;  4WFN L;  4IZ9 A;  3VQD A;  3T1H K;  4NYN A;  1KTQ A;  4M3T A;  1S9E A;  1XMO K;  1DEJ A;  3BZC A;  4CES A;  4N76 A;  3SYZ A;  1RDW X;  2IIR A;  2P51 A;  1VQ9 N;  3OYB A;  4E3S A;  2I7P A;  1LV5 A;  1IKW A;  5LJV A;  3QFP A;  2G8U A;  5EOY A;  3CCV N;  1T8E A;  4DSL A;  4DV1 K;  3SV3 A;  1SZ2 A;  1RFQ A;  4FO0 A;  5SWM A;  4FLV A;  3BGR A;  1WSE A;  3AA3 A;  4B9N A;  1YF5 L;  1YVN A;  3C0B A;  4BC5 A;  4BDZ A;  4BRI A;  3TTD A;  4FJ8 A;  3JXU A;  4O0I A;  2YJF A;  1KVB A;  1UA0 A;  1VSH A;  2QM1 A;  5AJ3 K;  5BRD A;  4QS8 A;  3NHG A;  4RTF D;  4BDP A;  3I56 N;  4NXM K;  4CF1 A;  3MK6 A;  3ZCM A;  3VEX A;  1NJW A;  2ZGY A;  1JCF A;  4R5P A;  2HBJ A;  2ZGZ A;  3VF6 A;  4OO1 J;  3DRR A;  4CJE A;  1UOC A;  1K8K A;  4B08 A;  1NJY A;  1IV0 A;  3QNN A;  2WTU A;  2CGJ A;  4RCH A;  1JLE A;  5AQN A;  2W6K A;  3VQ7 A;  3CCS N;  4BY9 C;  4I6M A;  2FF6 A;  1W2B M;  3NDK A;  1DKG D;  5BRH A;  3KIO A;  4M3U A;  1O1W A;  3HVR A;  2A6A A;  3ASM A;  4FPA A;  4LH5 A;  4RW8 A;  4H0X B;  2EWS A;  5KQ8 A;  3WXK A;  4PKH A;  1SKW A;  3A5O C;  2KFN A;  2B6A A;  1BOT O;  1S1W A;  4JKA A;  3QIN A;  3LM2 A;  5E41 A;  4RWT A;  2P9P B;  3MN5 A;  2FSK A;  5FRO A;  3DLB A;  4G9Z A;  1WOQ A;  3VN5 A;  1QHT A;  1EO1 A;  3SMP A;  3NGZ A;  4H0V B;  3WNF A;  5AQM A;  4DTU A;  4JK8 A;  4JKF A;  4CJ7 A;  3CC7 N;  3THW A;  3H45 C;  4EP4 A;  3DXM B;  4CJW A;  5GIO A;  4NO7 A;  2YJE A;  5LJW A;  1L3S A;  4PL8 A;  1KVA A;  4C1N K;  5AQZ A;  1YJN N;  3TAE A;  1MU2 A;  2YKM A;  1RBR A;  2A5X A;  1RBV A;  3HRG A;  3LDP A;  1V4S A;  2NRT A;  4Z4G A;  4BWJ A;  1WSF A;  4H4O A;  1Q7Y O;  4C8N A;  4BR9 A;  1W9H A;  4CHQ A;  4A59 A;  2W41 A;  2GUI A;  3O1B A;  4WQ5 A;  4BE0 A;  3M3Z A;  3SNN A;  4K8X A;  4FM1 A;  4JNE A;  3BUZ B;  2GV9 A;  2H3G X;  3W3D A;  1OVY A;  2IDO A;  4A5B A;  4JAX A;  3G0Z A;  3ULD A;  3QER A;  3LDN A;  1DLO A;  3HOT A;  3U8X A;  1NG9 A;  4YDU A;  3OS2 A;  1KCF A;  1NK9 A;  3THX A;  3OYI A;  4FL9 A;  3TAM A;  2HBL A;  3CJC A;  1TYQ A;  4JHD B;  2KZZ A;  1TKX A;  3NH1 A;  1HJR A;  2ATQ A;  3OYJ A;  4DUY K;  3SAH A;  3R1X A;  1HNI A;  4NCG A;  2P9L A;  1JLQ A;  4YOU A;  4DFK A;  1Q9X A;  3OYC A;  4B9M A;  2E5L K;  4OJR A;  5BPM A;  1EP4 A;  4ID1 A;  4B9U A;  3MN9 A;  3JAM O;  2XRI A;  1EET A;  4B9Q A;  1BHL A;  3PY8 A;  4CJK A;  2NRZ A;  4AHU A;  3AVL A;  4CZL A;  2Q2R A;  1YXQ A;  2FXU A;  4FWS A;  4FLY A;  2PYL A;  4RW6 A;  4CED A;  1HR0 K;  3HST B;  1BQM A;  4B3M K;  3OYK A;  4YOY A;  3ZX2 A;  1ILY A;  4B9L A;  4BR4 A;  2O8B B;  4DTO A;  1S1V A;  2ASP A;  1L3U A;  1HLU A;  1KFS A;  4RW9 A;  5KPR A;  3WEE A;  1X1P A;  4E89 A;  4CZM A;  3M8S A;  3M8Q A;  4NCB A;  4CHY A;  3RSE B;  5GIN A;  4F2R A;  5ELZ A;  4LF8 K;  5IWA K;  1LCU A;  2E2P A;  3TPQ A;  1IJJ A;  3FFI A;  1T3V A;  1XI1 A;  1LWF A;  4MLH A;  1GLF O;  1M1K O;  4XH1 A;  3H3N O;  2UU9 K;  1XHX A;  1DTT A;  4M3Z A;  4CEB A;  4KB1 A;  3P83 D;  3VEV A;  3CPE A;  4QOZ B;  1C0M A;  1N34 K;  3AAP A;  5JS1 A;  3AA4 A;  4K8Z A;  2Z1G A;  2D0P A;  3I55 N;  4DV0 K;  1NLV A;  3EZW A;  3VER A;  4E7I A;  5AZJ B;  4BRL A;  1JLG A;  1QHA A;  2OAN A;  4H0Y B;  3D2E A;  3V9S A;  1NJZ A;  1S6P A;  5C42 A;  3T1Y K;  4WFB L;  3NH0 A;  3TAP A;  4H0T B;  4YOT A;  1WUA A;  3KK7 A;  2IC3 A;  4CGF A;  4FJ5 A;  3F2K A;  1F21 A;  2LSN A;  4A57 A;  4F8R A;  3HM8 A;  3OJS A;  3WXL A;  4JI7 K;  4Z4E A;  5TKW A;  4W5N A;  3DOK A;  1JLB A;  1KC8 O;  4PA1 A;  4DMN A;  1R59 O;  3BY5 A;  3HP6 A;  5F0X A;  3VEZ A;  3O1W A;  3DLL L;  1K9M O;  3OYM A;  4BRQ A;  4XIU A;  4YOV A;  1RDA A;  3RRG A;  1B9D A;  3TAG A;  1KRP A;  1ZBH A;  2ITM A;  3TAQ A;  1XQS C;  5C2F A;  4BE1 A;  3NF8 A;  4KTZ A;  5GIP A;  3CJ9 A;  2HNZ A;  3IG1 A;  4B3O A;  4KI6 A;  3FE1 A;  3LWM A;  3P31 A;  3AO5 A;  5BPL A;  2E4L A;  3M5R A;  5FLX O;  2RKI A;  3GDQ A;  3SZ2 A;  3O9T A;  1NGF A;  2P5O A;  4HTU A;  4GVM A;  1QSY A;  2ASM A;  3NF7 A;  3CFR A;  4B8A B;  1L3T A;  3V81 A;  3QEX A;  3DRS A;  5AQG A;  1YJ9 N;  4CJ4 A;  4RG8 A;  2BDP A;  4Z4F A;  5AQJ A;  2HHU A;  3VQ8 A;  1W97 L;  3KLE A;  4J2E A;  1BU6 O;  1WSG A;  4OPH A;  2J4R A;  4UY8 O;  2DY4 A;  4EAH D;  2D4W A;  5BN8 A;  4PHT X;  4M3Y A;  2HHQ A;  3RWU A;  3UB5 A;  4JD2 B;  5AZI B;  3ZT3 A;  1WLJ A;  1Y64 A;  2UXC K;  3CM5 A;  5AQL A;  4LFB K;  1XC3 A;  4KH6 A;  1X9W A;  1QSL A;  5HBM A;  3R3L A;  4KHU A;  3H3O B;  4W5Q A;  1VSJ A;  3O9Q A;  1X9J A;  4CBU A;  2BH1 A;  1SUQ A;  4BRK A;  1QSS A;  4CGJ A;  4KV8 A;  4I2P A;  4O5B A;  1SAZ A;  3NVM A;  2HHX A;  4CFC A;  2NUB A;  2E2N A;  5ADX A;  4Z4H A;  4FM0 A;  3CCU N;  1KQS M;  2JWK A;  2V51 B;  3KHY A;  4FJH A;  1MDU B;  2KFZ A;  3DM2 A;  1VSI A;  1KLN A;  2P9P A;  3O08 A;  3IFR A;  2QXL A;  2FBX A;  5CYM A;  3H1V X;  4XH4 A;  3IMX A;  1Z26 A;  5FDL A;  3SAG A;  4E7K A;  3THV A;  2D5R A;  1M90 O;  5CYQ A;  4BC2 A;  2RE2 A;  3NFA A;  1GOB A;  3ENB A;  3O6W A;  3DXM A;  4DTP A;  1Z25 A;  1JKH A;  3Q7C A;  4JV5 K;  3OS1 A;  4Y1D A;  3PIP L;  4LFA K;  5FPM A;  2A1S A;  2G8K A;  4FK2 A;  4M3X A;  5J2P A;  2NRW A;  3D7E O;  5M1O A;  5C24 A;  3AY9 A;  2BUP A;  4CJL A;  3LAK A;  4DLE A;  3V6D A;  3HT3 A;  2UUA K;  3CG7 A;  1K73 O;  3QBX A;  2RN2 A;  5AQF A;  4CJR A;  4OGC A;  4Y1C A;  3ZT2 A;  4GY2 B;  4FJK A;  3O5B A;  4CJF A;  1L5U A;  5HRS A;  3IDH A;  3NVK A;  2YHX A;  4F3T A;  4X65 K;  1YUW A;  1KLM A;  5JS2 A;  2KTQ A;  3FFK B;  4Z94 A;  4H4M A;  2HVH A;  3OJU A;  3CFO A;  5BR8 K;  4CEO A;  3AVJ A;  3NGI A;  1IBM K;  2E6M A;  2F9T A;  1HQU A;  1NU0 A;  2ZJP L;  4DFM A;  2F4V K;  4I9Q A;  4FVM A;  1VQ7 N;  4FK4 A;  1YTU A;  1YAG A;  4JKC A;  3E9L A;  4FJX A;  3WEE B;  4JRP A;  4DSE A;  2B4J A;  1YT3 A;  4CD1 A;  4JHD A;  3QFU A;  1BI4 B;  5CE3 A;  4O4G A;  3VQ5 A;  1NGD A;  3MAQ A;  2QKK A;  4LF6 K;  3RMD A;  4BRN A;  1QZ5 A;  3CCE N;  3D6R A;  2F7T A;  3LDO A;  4CF8 A;  4DU3 A;  5HOO A;  3OTO K;  2QWP A;  3AVN A;  3FZL A;  1NOY A;  1RCH A;  1E4F T;  4B1V A;  3VGK A;  4CGH A;  3TTC A;  4DG1 A;  4FWR A;  1EX4 A;  1GOC A;  3ID8 A;  3P1G A;  3CC2 N;  2RF2 A;  3MX2 A;  1D5A A;  4DV7 K;  5JVH L;  1JLA A;  2A40 A;  3QIO A;  2AJQ A;  3TI0 A;  1ZXO A;  3CJA A;  5HRR A;  2O8B A;  1LWE A;  4IDH A;  4DR1 K;  1HKC A;  3RMC A;  3SV4 A;  4DTJ A;  3SUO A;  1GLD G;  1C1B A;  4DFP A;  1RDC A;  3KLF A;  4YY3 K;  2HST A;  3OYG A;  2HND A;  3RSE A;  3MEC A;  4FLW A;  4J2B A;  1NK6 A;  4JI6 K;  2FSN A;  3GL1 A;  2OPS A;  3ENO A;  4QAG A;  3L3U A;  3Q7B A;  4KHY A;  2A41 A;  1KSP A;  3LAL A;  3QEP A;  2F8T A;  1GLL O;  3DMJ A;  5CZ2 A;  1TK0 A;  1EQY A;  3HXM A;  4HWI A;  3MED A;  1IG8 A;  1S6Q A;  1N8R O;  2I7N A;  2ZJQ L;  3RR7 A;  4EHT A;  2F8S A;  4JK9 A;  1QQN A;  4E19 A;  3V1Q A;  2P9U B;  5AZJ A;  4CW7 B;  2VQF K;  4DV4 K;  1C0T A;  4XEI A;  3KWI A;  4BRH A;  5CY4 A;  1NNE A;  1E3M A;  3AVA A;  2PYJ A;  4OX9 K;  1YTA A;  4NLB A;  1EWR A;  5E84 A;  1Z05 A;  1N5Y A;  5B8H A;  3QEI A;  1JXB A;  2HHH K;  4IOX A;  4BGA A;  2GWJ A;  4BRA A;  4JLH A;  4BGB A;  4O5F A;  4EZ6 A;  4DSF A;  4B8C A;  3ID6 A;  1S1X A;  4AHV A;  1BDG A;  3AVF A;  4Y0W A;  4DR4 K;  1CZB A;  3HZ6 A;  2QWQ A;  4LFC K;  4CJT A;  2BTF A;  4FZX C;  4K43 A;  1Q81 O;  1B92 A;  3KD5 E;  4UQG A;  1RTI A;  3LPT A;  1SL1 A;  1D9D A;  2P9S B;  2HMI A;  3SJH A;  1NGI A;  4K0K K;  2Z1H A;  4JKG B;  4C8O A;  3EN9 A;  4JS5 A;  1XHZ A;  1FXX A; 
#chains in the Genus database with same CATH homology
 4CZG A;  3A5M C;  2VGN A;  3BEX A;  4GVE A;  2QWL A;  4YOU A;  3CI5 A;  3MWT A;  2Q36 A;  4CZF A;  3ZYY X;  2GTD A;  3ENH A;  1BA0 A;  2IVP A;  2A42 A;  2Q1N A;  3L0Q A;  4IEI A;  5AQW A;  5BPM A;  3DWL A;  2Q31 A;  3MN9 A;  4H03 B;  1HPM A;  3C7N B;  4B1X B;  4B9Q A;  1V4T A;  2Q0U A;  2NRZ A;  3LDL A;  4CZL A;  2VYP A;  2FF3 B;  5BN9 A;  2Q2R A;  1YXQ A;  2FXU A;  4FWS A;  2E20 A;  4IWV A;  3CER A;  4K25 A;  4WFA L;  3TSP A;  4AM7 A;  3VTH A;  2NRV A;  3KZB A;  3FZF A;  4KH4 A;  3UKR A;  4DQ8 A;  4YOY A;  3U9D A;  3VOV A;  5E26 A;  3ZX2 A;  1ILY A;  3OA9 A;  2DPN A;  3DXK B;  4BR4 A;  3GBT A;  5KPZ A;  2ASP A;  3MN7 A;  2NRR A;  3FR0 A;  1HLU A;  3H1Q A;  3F9M A;  4JKB A;  4GV3 A;  3CME N;  3P4I A;  3DJC A;  3VF2 A;  5KPR A;  1VQN N;  4NB4 A;  2P9N A;  2E1Y A;  2QWR A;  3ULE B;  4YDU C;  4IJA A;  2V52 B;  3WEE A;  3ZEU A;  4CZM A;  5CR4 A;  4CI6 A;  3AGR A;  3RSE B;  5GIN A;  3L6Q A;  5M1F A;  5ELZ A;  3CJB A;  3OHR A;  3RVC A;  1LCU A;  3W0L A;  2QEX N;  4ISG A;  2E2P A;  3TPQ A;  1IJJ A;  1T3V A;  4EFH A;  5ADX H;  3WXI A;  3ZET A;  2HBM A;  4MLH A;  1GLF O;  3T69 A;  4WF9 L;  5AQP A;  1M1K O;  5AQO A;  4XH1 A;  1GLB G;  3G25 A;  2V7Z A;  3H3N O;  3CPW M;  4FWQ A;  3VEN A;  4C23 A;  1S3X A;  4CZI A;  3EKS A;  3HTV A;  4JD2 A;  5AZI A;  3MWP A;  4BRO A;  1YIT N;  1GLC G;  3U9Z A;  1NGH A;  4FOE A;  3F5T A;  4PKG A;  1HKG A;  3CPE A;  3L4I A;  5EX5 A;  3VEV A;  3QIC A;  4BG8 A;  3AAP A;  3MCA B;  3MMV A;  5AQY A;  3VEO A;  3N4P A;  4PKI A;  4LC9 B;  2D0P A;  3I55 N;  3CC4 N;  1NLV A;  3QDK A;  2AA4 A;  5AQI A;  3EZW A;  3VER A;  3KWG A;  2GEL A;  3SK3 A;  2KKZ A;  2QA4 N;  1KXP A;  3O8M A;  5AZJ B;  4H0Y B;  1QHA A;  2OAN A;  2PFU A;  2QI2 A;  3D2E A;  5TKY A;  5FPN A;  3VPZ A;  4DHY A;  2PAV A;  4WFB L;  2YHW A;  4H0T B;  5BRE A;  5MLC Q;  4YOT A;  1KAY A;  4FSV A;  4QS9 A;  1VQM N;  1WUA A;  4BRL A;  5DM6 L;  3KK7 A;  4CZE A;  5EVZ A;  5EXW A;  4WCE L;  1KAX A;  3F2K A;  1VQO N;  4GV6 A;  1XUP O;  3J7Z O;  4A57 A;  3HM8 A;  2GEM A;  3ATV A;  5KPT A;  4WQ4 C;  3WXL A;  5TKW A;  4GNI A;  1VQ6 N;  2CGK A;  5CHI A;  1KC8 O;  3D2F A;  2YI1 A;  3EL2 A;  1R59 O;  4J8F A;  5F0X A;  5AQS A;  3VEZ A;  3O1W A;  3CF5 L;  4BVP A;  2GWK A;  3DLL L;  3T7Z A;  4CBX A;  1K9M O;  4BRP A;  3GOI A;  4PL7 A;  1TUY A;  4BRQ A;  3MDQ A;  1TUU A;  5GAH P;  4H0P A;  4JKD A;  4YOV A;  3ATU A;  3UKU B;  1TYQ B;  3AAR A;  4ILJ A;  2ITM A;  2HF4 A;  4M63 C;  1NGG A;  1NGE A;  3IKM A;  3WXJ A;  4U67 L;  3MX5 A;  3SLC A;  3TSQ A;  1XQS C;  2Q0R A;  3I8B A;  5C2F A;  2HBK A;  4MLE A;  1MWK A;  2P9L B;  4U7B A;  5AQQ A;  3AAQ A;  4EIA A;  5GIP A;  3CJ9 A;  4BR0 A;  2ZJR L;  1Z6R A;  3O4W A;  1C0G A;  3HI0 A;  4FWO A;  3VEY A;  5AQX A;  4IO9 L;  1HJO A;  3I33 A;  3GE1 A;  1VQK N;  3FE1 A;  4BC4 A;  3LM9 A;  2QWN A;  3P31 A;  4A5A A;  1GLJ O;  5BPL A;  2QWM A;  3M5R A;  2NZT A;  3EE9 A;  3GDQ A;  5JMV A;  1X3M A;  2D1K A;  1NBW A;  2E2Q A;  2NRH A;  3O9U A;  1NGF A;  3O9T A;  1NWK A;  5GAD P;  5JVG L;  3G4S N;  2NNW A;  3E9P A;  5AQH A;  5AQT A;  3HOS A;  2W40 A;  3UKR B;  1T6C A;  4FWN A;  2IVO A;  3VGL A;  1DGK N;  2ASM A;  3CCL N;  1H1V A;  5C12 A;  5AFU A;  1HUX A;  4IEE A;  3CIP A;  1KAZ A;  5AQG A;  1YJ9 N;  2WUS A;  5JIC A;  3ZX3 A;  3FLC O;  4H5T A;  3S41 A;  1Q82 O;  1VQ4 N;  5AQJ A;  3ZEU B;  4BR2 A;  2VCP A;  1RGI A;  2P9K B;  3SAF A;  1YJW N;  2CH6 A;  4WQ4 A;  3WXM B;  1W97 L;  3OBW A;  3IUC A;  4ILG B;  2HF3 A;  3CET A;  3UE5 A;  1BU6 O;  4OPH A;  4K41 A;  2J4R A;  4IXC A;  3ZET B;  4UY8 O;  1MWM A;  3H46 O;  2YX6 A;  4BRG A;  4EAH D;  2D4W A;  4FWP A;  3R9P A;  1T6D A;  4KH5 A;  5BN8 A;  4PHT X;  3GG4 A;  3H6E A;  5C2D A;  3UB5 A;  3BF3 A;  4JD2 B;  5AZI B;  5C0Y A;  3WQT A;  1BA1 A;  1Y64 A;  4IOA L;  3E1Y A;  1DT9 A;  3WT0 A;  5AQL A;  2V7Y A;  1XC3 A;  4KH6 A;  3R3L A;  4CZJ A;  3H3O B;  1ATR A;  4YOR A;  3O9Q A;  1X9J A;  4NLC A;  3O80 A;  4CBU A;  4IFE A;  2BH1 A;  3CCQ N;  4BRK A;  1QZ6 A;  3D2E B;  5AQV A;  3G6E N;  4CZK A;  3G71 N;  3LL3 A;  4ILH A;  1C0F A;  1SAZ A;  4H5N A;  2ZWH A;  5GAG P;  3NVM A;  4CBW A;  3CXC M;  4BQZ A;  3BP8 A;  2FLO A;  3P38 A;  4O8U A;  5AQU A;  2E2N A;  3MCP A;  3VMF B;  4BRC A;  3DXK A;  1U2V A;  2CH5 A;  5ADX A;  5M1K A;  4GV9 A;  4MDA A;  3OBY A;  2JWK A;  3CCU N;  2V51 B;  1KQS M;  3KHY A;  5KQD A;  1QQO A;  3O9R A;  3CD6 N;  2KLA A;  4AF1 A;  1MDU B;  2HMP A;  4EHU A;  3CCJ N;  1SQK A;  4B1Z A;  4JN4 A;  5JLF A;  3VF4 A;  2CGL A;  5HL7 L;  2P9P A;  3D2F B;  2NRX A;  3IFR A;  3O08 A;  4YOW A;  2QXL A;  4BRE A;  1J6Z A;  4E1J A;  3H1V X;  4XH4 A;  1VAZ A;  3IMX A;  3CMA N;  1QVF M;  4XH5 A;  1YIJ N;  5FPE A;  3LDQ A;  4BRD A;  4A2B A;  3SAG A;  4BC3 A;  3M6G A;  3E66 A;  4CD3 A;  1M90 O;  4JKE A;  3C65 A;  4BC2 A;  4DB3 A;  2RE2 A;  5LY3 A;  3DAW A;  4JKH A;  3ENB A;  4FVU A;  1NGB A;  4A61 A;  3O6W A;  5H1S Q;  3DXM A;  4BG9 A;  4JEP A;  4WFN L;  4ISF A;  5F2R A;  4IZ9 A;  3C6A A;  3Q7C A;  1U6Z A;  4R79 A;  3CCR N;  1ZC6 A;  3HBT A;  1G99 A;  3HSC A;  2E1Z A;  3PIP L;  2QWO A;  5FPM A;  1HKB A;  2NRW A;  3D7E O;  1DEJ A;  5M1O A;  3AY9 A;  1RDW X;  3J8A A;  5BRF A;  2BUP A;  3A5N C;  1CZA N;  2IIR A;  3CJ7 A;  1QQM A;  1JCE A;  3K9J A;  1VQ9 N;  1NM1 A;  1P8Z A;  1Q18 A;  2I7P A;  4KBO A;  4FPB A;  4BRF A;  4FWK A;  1K73 O;  5LJV A;  1SS6 A;  3QBX A;  3QFP A;  5AQF A;  3CCM N;  5EOY A;  3CCV N;  4GY2 B;  4K42 A;  3O5B A;  1SZ2 A;  1RFQ A;  4FO0 A;  2ASO A;  4FWL A;  3IDH A;  3NVK A;  2YHX A;  2P9U A;  1YUW A;  2UYT A;  2WC9 A;  1YF5 L;  1YVN A;  4F9O A;  4QS7 A;  3C0B A;  4BC5 A;  3OW2 M;  2A3Z A;  4BRI A;  3FFK B;  3TTD A;  3L4Q A;  4Z94 A;  3JXU A;  5DM7 L;  2YJF A;  1NMD A;  3SMS A;  1ATS A;  1VQ5 N;  4O8K A;  4H5R A;  3FZM A;  2QM1 A;  5BRD A;  3QB0 A;  4QS8 A;  3C6H A;  4RTF D;  4IJN A;  2KHO A;  3I56 N;  1S22 A;  4AM6 A;  2F9T A;  4MO4 A;  1BUP A;  3O9S A;  2ZJP L;  1LOT B;  3A0I X;  3U4L A;  2E2O A;  3EO3 A;  4FWM A;  4ISE A;  1NJI O;  3VES A;  3MK6 A;  1VQ7 N;  1YAG A;  3QBW A;  4JKC A;  3E9L A;  2ZGY A;  2P9N B;  3M1F A;  4M7X A;  3VEX A;  1JCF A;  1ESV A;  3WEE B;  2HBJ A;  2ZGZ A;  3VF6 A;  4OO1 J;  1BG3 A;  1E4G T;  3R8E A;  4CD1 A;  1K8K A;  1YHQ N;  4JHD A;  3QFU A;  5CE3 A;  3FGU A;  2GUP A;  4H5W A;  1NGD A;  2CGJ A;  2P9I A;  2P9S A;  4RCH A;  3CHW A;  5M1N A;  5AQN A;  1S72 N;  1JJ2 M;  4JKG A;  4WQ5 C;  3CCS N;  4BRN A;  3VGM A;  1QZ5 A;  4I6M A;  4BY9 C;  2FF6 A;  1Q86 O;  3CCE N;  1K8A O;  1W2B M;  1GLA G;  3D6R A;  2F7T A;  1DKG D;  4BQL A;  5BRH A;  3LDO A;  4HTL A;  4JK7 A;  4BR5 A;  2F9W A;  5HOO A;  2A6A A;  2QWP A;  5BPN A;  4FPA A;  4DKW A;  3FZL A;  5AQR A;  4B1Y B;  4H0X B;  2Q97 A;  3AGK A;  2GX9 A;  2EWS A;  3C7N A;  1VQL N;  5KQ8 A;  1BO5 O;  3WXK A;  1U2V B;  4IO8 A;  1E4F T;  4PKH A;  4B1V A;  3CJ1 A;  3A5O C;  4BVO A;  5JLH A;  3VGK A;  1BOT O;  3N4Q A;  1ATN A;  3TTC A;  4WYB A;  4JKA A;  2WFB A;  4FWR A;  4MO5 A;  3ID8 A;  3CC2 N;  3LM2 A;  4BRM A;  3MX2 A;  3TTF A;  4RWT A;  5JVH L;  2D0O A;  2P9P B;  2P9K A;  2QTD A;  3MN5 A;  2FSK A;  4FOI A;  2A40 A;  3A8Y A;  1ZXO A;  3CJA A;  4G9Z A;  4L3Q A;  1WOQ A;  3FZH A;  4IDH A;  4B1U B;  1HKC A;  3PLA A;  2OTL N;  1GLE G;  3SMP A;  1EO1 A;  3E9O A;  4H0O A;  4H0V B;  2FSJ A;  1GLD G;  5AQM A;  4M7Y A;  4JK8 A;  5EY4 A;  3ULE A;  2OTJ N;  4JKF A;  5F1X A;  4CJ7 A;  3JS6 A;  2HST A;  3CC7 N;  3FZK A;  3RSE A;  3H45 C;  3DXM B;  2WBN A;  3SBT A;  5GIO A;  4NO7 A;  1HX1 A;  3K9K A;  4A2A A;  2YJE A;  2FSN A;  3GL1 A;  5LJW A;  4PL8 A;  1ZBS A;  3ENO A;  2IVN A;  4B1W B;  4C1N K;  5FPD A;  3Q7B A;  5I9E B;  2A41 A;  5AQZ A;  1YJN N;  2HOE A;  5M1Q A;  3HRG A;  1JCG A;  1RDU A;  2A5X A;  3KVG A;  1V4S A;  3LDP A;  3WUH A;  5C15 A;  2NRT A;  3ZX0 A;  1P90 A;  3EE8 A;  2AP1 A;  4C1N I;  4A62 A;  1VQ8 N;  1GLL O;  1NGA A;  1D4X A;  1EQY A;  2YCH A;  4HWI A;  3WQU A;  1Q7Y O;  1IG8 A;  3PIO L;  3TSU A;  4BR9 A;  3VTI A;  1N8R O;  2I7N A;  1YI2 N;  1OKJ A;  4A59 A;  2ZJQ L;  1MA9 B;  2W41 A;  4EHT A;  1O13 A;  3O1B A;  4JK9 A;  4WQ5 A;  1QQN A;  4H5V A;  4CZH A;  3M3Z A;  3NMU A;  2P9U B;  2ZF5 O;  5AZJ A;  2NLX A;  5GAE P;  3VET A;  2VGM A;  3EKU A;  4JNE A;  4XEI A;  3BUZ B;  5BR9 A;  2E88 A;  2PBD A;  2H3G X;  3KWI A;  3R6M A;  3W3D A;  4BRH A;  5AR0 A;  5C10 A;  4MDB A;  1OVY A;  4NLB A;  4A5B A;  4JAX A;  5E84 A;  3TU5 A;  3P39 A;  1X3N A;  4BR7 A;  1Z05 A;  1NGJ A;  1NGC A;  5B8H A;  2RHK A;  4IOX A;  4BGA A;  2GWJ A;  3VEW A;  4BRA A;  4BGB A;  4O5F A;  3LDN A;  1KD1 O;  3HOT A;  3U8X A;  3ID6 A;  3QML A;  4YDU A;  4IOC L;  1VQP N;  2VWB A;  2JWL A;  5AQK A;  3MN6 A;  1BDG A;  4Y0W A;  2YHY A;  3HZ6 A;  2QWQ A;  1BWF O;  2BTF A;  4FL9 A;  4K43 A;  1Q81 O;  1T44 A;  2QW9 A;  2HBL A;  3CQX A;  3SBG A;  1QVG M;  1K8K B;  3CJC A;  1TYQ A;  4JHD B;  3UKU A;  3A5L C;  4DCH A;  4YOX A;  2P9S B;  2P9I B;  3SJH A;  5M1P A;  1NGI A;  3SAH A;  3BF1 A;  3R1X A;  4JKG B;  5AFU H;  2P9L A;  3EN9 A;  3B8A X;  2E8A A;  3CQY A;  4I6M B;  4OPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...