4G9ZA

Lassa nucleoprotein with dsrna reveals novel mechanism for immune suppression
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
205
Chain Sequence
AMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(P*GP*CP*CP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Viral protein/rna
total genus 55
structure length 205
sequence length 213
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4g9zA01
4GV9A 4FVUA 3MWPA 3MX5A 3MWTA 3MX2A 4GVEA 4GV3A 3R3LA 3Q7BA 4G9ZA 3Q7CA 4GV6A
chains in the Genus database with same CATH superfamily
2E4LA 3O08A 4ZHRA 4CK3A 2O8BA 1NGBA 2NZTA 4CZEA 4GVEA 3KIOA 1VQPN 1HYZA 1TK5A 5AJ3K 4N5SA 2Q2RA 3GBTA 3K5LA 1T44A 5ADXH 3ISNC 1X9SA 4KB0A 4IOAL 1QHAA 4KKOA 1RDAA 2HSTA 1A5VA 3AA4A 3THYA 4MLEA 1U4BA 4KTWA 2HMPA 1EWQA 1SKWA 4L8RB 5B8HA 4ISEA 3PY8A 3H1QA 4HCCA 4C8LA 1YAGA 3IFRA 3WXIA 1T6CA 2D0PA 3P31A 5C12A 1QSYA 4C8MA 1XI1A 4JK7A 1LW0A 3ULEA 3HPOA 1QQNA 4FWRA 2P9PB 2P5GA 4FZXC 5HP1A 5HOOA 1HR0K 4H4OA 1RDBA 4K41A 3RR8A 4IFYA 1D9DA 3D2EB 4JEPA 3OJSA 1WSEA 2P9LA 1YHQN 3HRGA 1HRHA 1WB9A 3VETA 1ZBUA 3RSEB 4C8KA 4EZ9A 1BIUA 3QETA 4DCHA 4IEIA 1JJ2M 5H1SQ 3CCLN 3OBYA 3OYLA 4HUEA 2OZMA 2V52B 3T7ZA 3ULDA 3KD1E 3SK3A 4DG1A 4JI6K 1BISA 4GY2B 4KV8A 1BHLA 3TWHA 1BUPA 2BGGA 1KXPA 1JLCA 2P9NA 2W6LA 1WNSA 4O0JA 3QERA 1L3VA 5AQYA 2X6NA 4FVMA 3E9PA 4L3QA 2YNIA 2V51B 4BACA 1RDWX 4E1JA 4RWTA 2OPRA 1VQ9N 2Q31A 4BROA 2W6KA 4FSVA 4CJ5A 2RKIA 3CIPA 1JLGA 1D8YA 2H3GX 5AQWA 3QNNA 3HZ6A 4CZKA 3KKSA 1Z25A 4H0XB 1K8KA 1RILA 2FBTA 3PIPL 3C7NB 4HTLA 1XMQK 3LM9A 3K9JA 3R8EA 3ZSWA 5C25A 2VWBA 3AO1A 3U9DA 5AQGA 3MXMA 1K8AO 1IBMK 4FK2A 3OW2M 2D4WA 4DV5K 1NJWA 1EXQA 4BR0A 2NRHA 4LF6K 4CZFA 3OYKA 1T03A 3QIPA 2G8UA 4WQ4C 4BDZA 4FPBA 1IKWA 3QEXA 4W5NA 3RMAA 2D0CA 4BVOA 2B4JA 2QWMA 3V9ZA 2A1SA 1Q18A 4RCHA 3V9WA 4BRIA 4BRGA 2JWLA 5KQ8A 2OZSA 4H03B 5T7BA 4DTMA 1U2VA 1YVNA 3IRXA 4FJGA 1WSHA 5BR8K 1NJZA 2WOMA 4CF8A 2FSNA 1XHZA 3DJCA 4PL8A 1YUWA 4B3TK 4G1QA 1T05A 1N33K 3VN5A 4YOUA 1CXUA 1NK8A 1BCOA 1RBUA 2D0BA 3MDQA 2A3ZA 5LL6Z 4JI2K 2OPPA 4WF9L 3A5NC 1ATNA 1YVUA 4DR5K 3RTVA 4NYFA 2QKKA 2F7TA 3JYTA 1S6PA 4FVUA 2WBNA 3ID6A 4LF7K 5AQJA 4AM7A 1NG9A 3KLHA 2O8FB 3HT3A 3MX2A 1WLJA 1SL1A 4CBXA 4DSEA 3LDNA 3U8XA 1UOCA 1OH8A 4K43A 3VA3A 3ZT2A 3SJJA 3L2RA 3VQ9A 3AVCA 1C1AA 1KLMA 3J7AP 3QBWA 2F8TA 1VHXA 2XRIA 4M45A 4B9UA 5ELZA 3PIOL 1WSIA 1MDUB 4N56A 4DR1K 1VQKN 1VSKA 3V1RA 5KQDA 4DV3K 2HBMA 3HK2A 4BC5A 2VWJA 3SI6A 3CQ8A 3ATUA 1YJNN 4F2RA 2OANA 2FC0A 3KK7A 4ISGA 4YOYA 5MLCQ 5JLFA 1S1XA 4NXNK 3CHWA 5LJWA 3OS0A 1TKDA 1ASWA 5GAGP 3NFAA 3JS6A 3CERA 3ATVA 1IG8A 4A5BA 3QNOA 2W41A 4UQGA 4DTUA 1S1UA 2WONA 3VEYA 1TYQB 3DMJA 1HQUA 4XEIA 4W5RA 3DLBA 2P9KA 3KLGA 4NCAA 4CHPA 3J80O 3EKSA 1J5EK 4NLCA 1XUPO 2NLXA 3MWTA 1TK0A 3A2FA 3QO9A 1QQMA 4YDUA 4K8XA 1NKCA 5BRDA 3SAGA 3WQUA 3OTOK 4IEEA 2HHVA 3TTFA 3LDOA 2UU9K 2E2NA 3VGKA 1ZBIA 2Z1GA 3PLAA 2ATQA 3HSTB 1VSLA 4C23A 4IJNA 1KAYA 2UXBK 2BE2A 4OPHA 3VQCA 1REVA 2UUCK 1VQON 3O3GA 1XNRK 3CI5A 5EU7A 1WSGA 4CK2A 5GIPA 3CCVN 1BA1A 4CJPA 2A6AA 1K73O 4H5WA 3DLKA 3V9SA 4B9VA 1L3TA 1KLNA 4M3ZA 2OPSA 3G25A 3THVA 4A57A 1X9MA 4OVLA 1OH7A 2O8CB 4HWIA 2P1JA 3VTHA 3AO2A 3NBPA 5KRTA 3PO4A 5AQSA 4LSLA 2IGIA 3S3OA 4DTRA 3VQBA 2QWPA 2HHUA 5M1KA 3VQ7A 3FZKA 1VSHA 3DYAA 3CYMA 4J2AA 1OVQA 3ID8A 3K5OA 4JD2A 4BDPA 4DFKA 4O8KA 2P9IA 4KH4A 3ZT0A 3KK2A 4AQYK 4DR4K 2YCHA 4B9NA 3F73A 4CCHA 4DHYA 3M8RA 3L4QA 3VF2A 3VA0A 5AQFA 2IVPA 3BZCA 4FZYA 3AA3A 3LP2A 5GINA 1XC3A 3S3NA 3MWPA 4M7YA 1BIZA 5HBMA 4M3YA 2Z1IA 4U7BA 3QMLA 2HOEA 4X66K 3NH2A 5CE3A 3HXMA 2IS3A 5KPRA 3BF1A 4PY5A 1BDGA 3QDKA 1C6VA 2ZGYA 2I7NA 3H1VX 1HKBA 3QBXA 5AQLA 1JLAA 3EY1A 3HOSA 4K0KK 3VQ8A 1LWCA 4JKCA 1IKXA 2YV0X 4JKAA 1YITN 1EETA 3GE1A 4CZJA 1TV6A 1QQOA 5J2PA 1NLVA 3V9UA 3MN7A 2V7YA 1S9EA 4FW2A 1ASUA 4K25A 2ETJA 3P38A 4FPAA 3MN9A 4H4MA 3P1GA 1B92A 2A41A 2FBXA 2ZWHA 3SYZA 4Y0WA 1TAUA 4QS7A 1RDCA 1VSDA 5FPNA 4B08A 4OLBA 3LDPA 3Q7BA 1BI4A 1CZAN 4GVMA 3HVTA 3O1WA 4QS8A 1RDDA 3BUZB 3FZHA 1WN7A 2UXCK 3NDKA 3OBWA 1G15A 5C15A 3J81O 2E2PA 4DU4A 1VQLN 5HRSA 3O80A 3CC4N 2E1YA 1B9FA 4WCEL 5C10A 4H0TB 3QICA 2OCEA 3DXMB 3THXA 1GLJO 4JYAK 4BE0A 4CE9A 1JL2A 3O9QA 3PX6A 4RG8A 2EWSA 2WTUA 1UWBA 3T3FA 3D2FB 3CCQN 4RW6A 4XIUA 3ALYA 4LFBK 4YNQA 4LFCK 4FWOA 1EX4A 2ASMA 4FLZA 3HOTA 3LPUA 3KZBA 4NO7A 4PKHA 4AM6A 3PV8A 3C0BA 4LF5K 3CQYA 3FZFA 5LMUK 2A42A 3DRPA 2FSKA 2QW9A 1X9JA 4JK9A 3CCRN 3EEQA 3K9KA 2O8DA 4E89A 2HB5A 4FJNA 2QXLA 1KRPA 4F4KA 1DT9A 4BRKA 4BG9A 1JXEA 4H8KA 2YHBA 4BRQA 1RT5A 3L3UA 5TKYA 3DAWA 4M63C 4CFCA 4FJJA 4E7IA 4BE1A 4FJHA 1I3AA 4N47A 3BZKA 4BWJA 4WE1A 1Y64A 5BN9A 4KHUA 3CJCA 1SUQA 1RT1A 1TL1A 3CD6N 4FLUA 3LWLA 4FJ7A 4DKWA 1E4GT 1EQYA 1JLBA 1S1WA 3I0RA 2P51A 1NJIO 2QM1A 3HM8A 1SL2A 1GLFO 3MAQA 4DU3A 4FW1A 4CEZA 4KH6A 3CCSN 3SPYA 4OLAA 3LAMA 5IWAK 4FK4A 4EFHA 4A2AA 1TUUA 4CIEA 1X1PA 1UA0A 1W9HA 4N76A 3R3LA 2XY5A 4OPJA 3QFUA 4Y1CA 4B8AB 4JAXA 4CJ3A 5AQTA 1UA1A 4NLBA 4RW4A 5JICA 3AARA 3K2PA 3KKRA 2O4GA 4CGFA 4FXDA 4U67L 5F2RA 3ZT3A 2JGUA 5DMRA 3RRGA 4F3TA 1QQCA 3SZ2A 5EOYA 3ENBA 3T1AA 3VQ4A 4LH4A 3ZSZA 4CGGA 3L0QA 3OYHA 1U6ZA 4FWLA 4BRDA 3MX5A 4PL7A 1Z05A 3WQTA 3SNNA 3JAMO 5J1EA 3M8PA 1UAXA 4A5AA 2FF6A 4DQQA 4ELVA 3L2WA 3ZSQA 4H0YB 3PSFA 3K57A 3MK6A 4CIGA 3DWLA 2IOCA 3OYIA 1RBVA 1IKVA 1J53A 3MCAB 4YOXA 1K6YA 1E4FT 5AZIB 3SJHA 3KLEA 4LFAK 4DV4K 2QWNA 3AO3A 4GV3A 5AQHA 3BY5A 4E7HA 1RT3A 3FFIA 3N4QA 4KRFA 1XWLA 4DLEA 4XH1A 4O5BA 4JKEA 4NCGA 2GX9A 1WSFA 1TL3A 3S41A 3V4IA 3V6DA 4B8CA 4FK0A 2ZJPL 4B1UB 1HX1A 1NGHA 4B1ZA 2DTUA 4FJ9A 3ZSYA 4IFEA 4NB4A 4IBNA 2YX6A 1A5XA 4JI0K 1KC8O 2HHSA 4E0DA 1HPZA 3A5LC 4BC4A 4DR6K 3IG1A 4E1MA 4FYDA 3O9RA 4X65K 3JXUA 2HF3A 3DXKA 3K58A 1NK5A 2HHWA 1IJJA 2YHXA 1Q9XA 3O1BA 3RMDA 4H5RA 4IO8A 3GOIA 4Z4EA 3UKRA 3O8MA 1C0UA 1U48A 2ZGZA 2NRZA 4KHQA 4KHNA 1RTIA 3DI6A 3TTDA 3A8YA 1IH7A 3VERA 3U3GA 2R7YA 4BRLA 3QESA 1TVRA 1C0GA 2W40A 5AQNA 4BC2A 5M1PA 1Q86O 1TAQA 1VK0A 4CFBA 3VQAA 1LOTB 3LL3A 4JKGB 1VSEA 3TAEA 5FPDA 4BC3A 2O4IA 3HM9A 4DV0K 3WEEB 4M3UA 2YNHA 4ZTJA 3UIQA 4EHTA 1NJXA 2ASPA 4CHOA 1KTQA 1ZC6A 2GBZA 4AHSA 4LY7A 5AZJA 1WAJA 4CJRA 2RE2A 3KWIA 4PHTX 4X62K 1RTHA 1E3MA 3QLHA 4AH9A 5DM6L 1NGIA 1QZ6A 1BWFO 1GOBA 3HYFA 4C1NI 1RBSA 5AQKA 4I9LA 2HHTA 3EZWA 4IJAA 5KTQA 3F5TA 4MLHA 3TSUA 4FCYA 2CGLA 2OTLN 5FRMA 2VG6A 1A5WA 2IC3A 1NGEA 3O5BA 3K5NA 1HMVA 2G8HA 2HW3A 4YORA 2IAJA 3H3OB 4ID1A 4BGAA 4IDKA 2OPQA 1C0FA 2BDPA 2YNFA 2ZD1A 4IDHA 3DRSA 3CJ7A 2O8EA 4BR2A 4Z0UA 3L2QA 1VQNN 3FZMA 1W0HA 2QKBA 3O3FA 4OPAA 5I3UA 3OY9A 4CJEA 3JSMA 4OJRA 4CIFA 1TKZA 4BE2A 3AY9A 4AHRA 3OYMA 2OA8A 1QHTA 5EY4A 4B1WB 1VQ5N 2ASOA 1LWEA 4E7JA 4BR7A 4UY8O 4B9MA 4JS4A 2FBYA 2XY8A 3NVKA 2X6SA 2Y1IA 4KH5A 5M1FA 2D0OA 3AVIA 3D45A 1NM1A 1BQMA 4O44A 3MXJA 1SKRA 4CJQA 2HNZA 2QWOA 2RF2A 3SUQA 1MWMA 2HMIA 3O9SA 4JHDA 4KTZA 2CH5A 3O9UA 4CW7B 4JKBA 3MXIA 4FZZA 3AGRA 3VF6A 3CJ1A 4LF8K 2FSJA 3L2VA 1RBRA 2P9SB 1Q8IA 1VQ6N 4DQPA 1T3VA 4FOIA 2E20A 3R1XA 3OYEA 1DKGD 3QEVA 4CF2A 3SAHA 1DTTA 4AHCA 3PUFA 4MDAA 4CD1A 3TU5A 4K42A 4F9OA 4EP5A 5LJVA 4M3WA 2RHKA 4FJKA 2HHHK 3LWMA 3K5MA 4DV6K 4WFAL 3E1YA 1D5AA 3IAYA 4BRCA 5F0XA 3SQ1A 4CZHA 1S22A 3T1YK 2HVHA 3TR8A 2JLEA 3OYFA 1I94K 3PO5A 4OO1J 4KI6A 3NGIA 4CHQA 1YT3A 3TTCA 3CC7N 2YI1A 4Z4GA 4CEFA 1XQSC 4X64K 5I42A 1VRUA 1L5UA 3H08A 4FLXA 2FF3B 4FLWA 3C6HA 1OKJA 1S72N 2PY5A 3HSCA 3L3VA 3OJUA 1Z6RA 3ZEUB 2ZM6K 3S9HA 3EE8A 1NBWA 3MECA 2HBKA 1NJYA 4JN4A 5FROA 1QE1A 5JS1A 3PX0A 2O8BB 4CD3A 2Q36A 2DFHA 4DF4A 4AHTA 5AR0A 3SBTA 2BTFA 4W5TA 3W0LA 4W5OA 4K8ZA 4B3OA 4Z4IA 3P5JA 5AQIA 5E26A 2RPIA 1C1BA 3SUNA 4AILC 3I0SA 1QSLA 3EE9A 3LAKA 1VQ4N 4JI5K 4A62A 3D0PA 3THYB 4N41A 4FJXA 3F9MA 4BRAA 1YI2N 3CCMN 2A1RA 3CJ9A 4BGBA 3RVCA 1DTQA 2BUPA 1BOTO 5C24A 1DEJA 3VQDA 1SZ2A 1M90O 2QEXN 3CETA 3NF7A 5A2QO 3C6TA 1YF5L 3ULEB 3ZETA 4JRPA 3AVHA 2XHBA 2CGJA 5BPMA 3TANA 1SAZA 3AVGA 4I6MA 3ENHA 2E1ZA 3M6GA 3WT0A 4ELUA 3HP6A 5CYMA 2P9LB 2HHQA 1S9GA 3AVFA 3UB5A 3MN6A 2X74A 4BY9C 5KPTA 2PZSA 3CQXA 2QK9A 2P9UA 3M8SA 3GL1A 2F9TA 4DR7K 3H6EA 5GAEP 2GELA 4CECA 1N36K 3OYBA 4BREA 3TSPA 3FZLA 1X9WA 3C65A 4Z94A 2P9NB 4DV1K 4YDUC 4FOEA 2KKZA 2PAVA 1HLUA 1JLFA 4CEDA 3TSQA 3UE5A 4ILJA 4GV6A 2XY7A 1OH5A 3WXKA 1RNHA 4XH5A 3AO4A 3F2KA 1K8KB 1C1CA 3ZX3A 4I7FA 1RT7A 1GLEG 3WNGA 4HVJA 1YTAA 4KFBA 3RWUA 4M41A 3OYNA 1HNIA 4B9TA 3CM6A 3VQPA 3HJFA 2QWQA 2Q1NA 3FR0A 4H5NA 4QAGA 4CEQA 2X78A 1YJWN 1OVYA 3VEVA 3BEXA 1J6ZA 1DLOA 4JI8K 3NF9A 2RN2A 1NGJA 3TAPA 2VYPA 3UKUA 1YIJN 1WAFA 1LWFA 2VWKA 4KHYA 1Q9YA 3CM5A 1TUYA 1KQSM 3KTQA 3O6WA 3GDQA 2E88A 1NK9A 5FDLA 4IZ9A 2DFEA 1VQ7N 4E1NA 5BPNA 4YY3K 4FM1A 4CJLA 4C1NK 3TPQA 1U2VB 1FKPA 4C8NA 2E8AA 3OA9A 3ZT1A 4I2PA 5AQVA 4RW8A 3CMAN 4DWIA 1N32K 3TI0A 4QS9A 3M5RA 4BRNA 1IV0A 4B3MK 3C6UA 3G4SN 1JLEA 4DFPA 3NF6A 4FWPA 3U9ZA 3ZT4A 1HNVA 4YOTA 3L2UA 4PA1A 3W3DA 3LP1A 1U49A 2P9PA 3ZX0A 3LDSA 3CJBA 3NGZA 1W97L 2D1KA 3CF5L 3DLRA 3D2EA 1KFDA 3VQQA 4B9SA 4Q5VA 3WNEA 2Z1JA 3SLCA 4CEEA 1IBKK 5GIOA 2KLAA 3NMUA 1VAZA 4EHUA 4IO9L 1NGFA 3CFPA 3RSEA 1KFSA 3DLLL 4DV7K 4Z4FA 3LANA 2VQFK 2PYLA 3IMXA 5C2FA 4RW9A 3M8QA 3WXLA 4CBWA 4CJKA 5AQQA 4CZLA 3TAQA 1W2BM 2DFFA 3VGLA 5HLFA 2E2QA 3B6PA 4TSXA 3KLIA 4CJ7A 3HL8A 1OH6A 5LY3A 1HQEA 1G99A 2NRWA 3D7EO 2GUIA 3KHYA 1GOCA 4FWQA 3AAQA 4RW7A 2HHXA 2Q3SA 4BQZA 3SQ0A 2YKNA 4JV5K 2FXUA 1WBBA 3U3YA 1GLAG 2P9KB 4CF0A 1N5YA 4DFJA 1QSSA 4M7XA 3ZSOA 2E5LK 2Y1JA 2VGNA 1QTMA 4G9ZA 1RBTA 1IBLK 2HBJA 1SL0A 3CFOA 1M1KO 2QWRA 3NH1A 4CJSA 5LMNK 4CGDA 4EIAA 2Z1HA 3I8DA 2VGMA 3D6RA 4OKEA 5CHIA 4DLGA 4DTPA 1HNXK 1S1VA 3OS2A 1ATSA 3B8AX 4DUZK 4CGJA 5J2MA 2ITMA 3I33A 3J8AA 4PQUA 2LSNA 2VG5A 3BF3A 1LAVA 3G0ZA 1KVCA 2YNGA 1QZ5A 4B3SK 3CXCM 2KW4A 3OYCA 4BG8A 2G8VA 1GLDG 1KD1O 3NCIA 4FM0A 4BDYA 1O13A 5D3GA 2F8SA 4OKKA 3TAGA 1NMDA 5BRHA 3TARA 4ICLA 3O3HA 2HNYA 4O8UA 2IVNA 1IKYA 2AP1A 3E9LA 3WNHA 4JNEA 3HVRA 3DM2A 4GV9A 3LPTA 4JD2B 5CZ2A 3CCEN 2P9IB 2V7ZA 1T7PA 3OHRA 2O8FA 1F21A 4I2QA 4BQLA 2PYJA 4JKDA 1J54A 4WQ5C 3G71N 3ZSXA 4BR9A 2NRRA 5SZTA 2JWKA 4H5VA 3VENA 4EP4A 4NYNA 2GWKA 2YJFA 1XNQK 2YKMA 4IFVA 2P5OA 1NGGA 3KVGA 5AQZA 3CC2N 3SAFA 1WBDA 3AVJA 1NGDA 1FXXA 2KZMA 4CJ4A 2OYQA 4E7KA 3NAEA 2EX3A 2VG7A 2B6AA 1BGXT 4DR3K 1RGIA 4A59A 1Y97A 3QEWA 4M3XA 4J2EA 3VESA 1J9AA 3HP9A 2QXFA 4ILGB 1QVGM 4KPYA 3VEXA 1S1TA 5KPZA 3N4PA 3A5MC 3BGRA 5JVGL 1LW2A 5KGXA 4HUGA 1ZBLA 1R0AA 3SUOA 1TKTA 3HTVA 4B1YB 1TYQA 5K14A 1C0MA 4KTQA 3VPZA 3B6OA 3OYJA 1EKEA 2W42A 4KREA 3LZIA 1BI4B 2NRTA 4JI3K 3AA2A 5FLXO 3KJVA 2HVIA 5AQPA 4C8OA 1IO2A 4M3RA 4ID5A 4HUFA 2G8KA 4JK8A 1N34K 1XC9A 3MEDA 4IWVA 1SKSA 4PUOA 3EKUA 1RDUA 3SUPA 5HRPA 1HKCA 4GKJK 1RTDA 5JS2A 3THXB 3C6AA 1CZ9A 4CERA 4CEOA 3QEIA 4FO0A 2WFBA 1RT4A 3PX4A 2GWJA 3ASMA 4DV2K 2PBDA 4B9QA 1HYVA 4YOVA 4R79A 3P39A 3E9OA 1RFQA 1DGKN 5FPMA 1RTJA 1B9DA 5JLHA 5FRNA 2O8CA 3MEEA 5EVZA 3IUCA 3SBGA 4CGIA 4CGHA 3T1HK 2ZJQL 1NK0A 1XHXA 1ATRA 4CJWA 3A5OC 1S6QA 3VEZA 3WXJA 4WQ4A 2F4VK 4DS5A 1FK9A 2BANA 4IOCL 2QI2A 4BWMA 4DU1A 3DLHA 1ILYA 2NUBA 3CCUN 1FJGK 4QOZB 3SQ4A 4FLVA 2O8DB 4GW6A 3I56N 3F9KA 3OYAA 1H1VA 4WFBL 3NHGA 4B9LA 3SPZA 1SV5A 4DF8A 1TGOA 4OX9K 3J7ZO 3SQ2A 1VQ8N 3PSIA 2YJEA 3ZSRA 1SQKA 5BR9A 4F3OA 1QS4A 4DQ8A 3THWA 3SV3A 3T69A 3C94A 5HRRA 4FWSA 2CH6A 3TABA 3ZLJA 4JKFA 4ELTA 3O4WA 5AQMA 3R6MA 4XH4A 1BO5O 5C2DA 2NRXA 3AVLA 3V1QA 1U04A 1HJOA 2I7PA 5GAHP 2YHWA 1GOAA 4MDBA 4FJ5A 1NK4A 1BG3A 3K59A 4LC9B 4CJFA 2BH1A 3LP0A 4O0IA 1VRTA 3M3ZA 3NGYA 5F1XA 4YOWA 4PKGA 3FFKB 4FWKA 4MO4A 3HPGA 4DSFA 3CJAA 4CJTA 1CLQA 4JS5A 4CZMA 2QA4N 4FJIA 4E3SA 3NE6A 3L6QA 3VEWA 4MFBA 2ITGA 3HPHA 3EO3A 1ZBHA 1RCHA 2IIRA 3AA5X 4A61A 3HO1A 1N6QA 2D5RA 5BRFA 5EXWA 3LDQA 4FLTA 1JCGA 4LF9K 4CBUA 1LV5A 4IG3A 1WUAA 1LAWA 2E6LA 1FW6A 2HF4A 3DXMA 4A2BA 4FM2A 1V4TA 2ZJRL 1V4SA 4ZTFA 5BPLA 4B1VA 4BR4A 4BR5A 4EAHD 3LM2A 1KVBA 3D2FA 1ZBSA 4AF1A 1NK7A 3E66A 4WYBA 2YHYA 4CI6A 4DR2K 1NU0A 1Z26A 3QIOA 4H0PA 4I9QA 4Q0BA 4V19S 1S5JA 2CGKA 4Z4HA 4KB1A 4BRHA 2IVOA 3CPEA 3DOLA 3R9PA 2NNWA 4B3RK 3C95A 4CZIA 3GG4A 2OTJN 1VSFA 1D9FA 5JMVA 1HNZK 3VOVA 2NRVA 4Y1DA 3DXKB 4DUYK 2UXDK 4CFDA 3LZJA 4DSIA 1SS6A 5I9EB 3H46O 4M3TA 1L3UA 4CJVA 4AHVA 2KQ2A 1Q81O 3K0SA 1HKGA 4DFMA 4ISFA 2ZQBA 2E6MA 3DLGA 3UKRB 1ZBFA 4DB3A 5EX5A 2GEMA 1IG9A 1VSIA 5C0YA 4FWNA 3CMEN 4HHTA 3MMVA 2DY4A 1BQNA 3DOKA 3VMFB 4DTXA 2J4RA 3QEPA 1NWKA 4DQRA 1ESVA 4KHWA 1T6DA 4OKJA 1VQMN 1O1WA 5HROA 1VSJA 3V1OA 3I8BA 4AHUA 1KVAA 4KBOA 4E19A 1ZXOA 2F96A 5E41A 2G8WA 4O5FA 4DS4A 5BN8A 1JCEA 3O4NA 4FJLA 4YFUA 1YJ9N 4FWMA 5AZJB 4DTNA 3ZX2A 1TKXA 3T19A 4B1XB 1U47A 3SV4A 3BP8A 1RT2A 1HJRA 1HPMA 1KAZA 2A5XA 1R59O 3OYDA 4DMNA 3OS1A 2F9WA 4LD0A 3NH0A 2KFZA 1BU6O 5TKWA 3ZSVA 4RTFD 3DRRA 3M1FA 3FE1A 4KO0A 1C0TA 3O4QA 1L3SA 3VQEA 3VEOA 3OVNA 5AQRA 2O8EB 2WUSA 2GUPA 1JL1A 5AZIA 1JCFA 4DTSA 3LALA 5M1QA 2KTQA 2G8IA 3V9XA 3EZ5A 5AQXA 4YHHK 1P8ZA 4FJMA 5DM7L 3P83D 3KLFA 5HRNA 1J5OA 1JLQA 3J7YP 3NVMA 3THWB 3VQ6A 3TAFA 4CESA 3EYZA 3WNFA 5AFUA 1X3MA 4CZGA 2KZZA 4LSNA 1WOQA 4JHDB 3RMCA 3ZCMA 1BCMA 5M1NA 4CF9A 3CG7A 2E2OA 4GKKK 3HBTA 1GLBG 3NF8A 3MCPA 4KAZA 3MN5A 4MQ3A 3AVKA 3FGUA 3QFPA 3KD5E 3AO5A 3H3NO 2EHGA 4F8RA 4CHNA 3G6EN 5JVHL 3RRHA 1NOYA 4DQIA 4PKIA 3VF4A 1D4XA 3TAMA 4HCBA 2I5JA 2D0AA 3CPWM 5DK5A 1MA9B 5KRSA 1W7AA 4DQSA 3IDHA 5KGWA 4CK1A 1N8RO 4OPKA 5IT9O 3VGMA 4ILHA 4J2BA 4H0OA 1ITGA 3OYGA 2IDOA 2KHOA 1HUXA 3SCXA 5J2NA 1NGCA 2FLOA 5CZ1A 4JKGA 3CCJN 3WEEA 1NK6A 4IKFA 3ITHA 1ZYQA 4F2SA 1FKOA 1EO1A 5KI6A 4QCLA 3L8BA 3SMSA 1KAXA 2WC9A 1MWKA 4H5TA 4BRPA 3AGKA 3KK1A 4KHPK 4GNIA 4KI4A 3CFRA 4DSJA 3EN9A 4BVPA 2ZE2A 4H0VB 4JI4K 1NGAA 4J8FA 3H45C 4BRFA 3AVNA 4CF1A 5HL7L 2VQEK 1GLLO 4PWDA 5E84A 4DTJA 1YTUA 5AFUH 4NXMK 1EWRA 3A0IX 4IXCA 3G10A 4CEBA 4DSLA 3VQ5A 5FPEA 4HTUA 4IOXA 1T8EA 2QWLA 3SMPA 4KHSA 5BREA 3S3MA 4FJ8A 4JI7K 1NKEA 3C7NA 2AJQA 3ENOA 2ZF5O 2A40A 1CZBA 5CY4A 4FL9A 3O9TA 4GMJB 2Q0UA 4CFAA 1U45A 1ASVA 2GV9A 1Q82O 4JKHA 5M1OA 5C42A 2Q0RA 3KWGA 3ZYYX 4CEAA 1MU2A 1S3XA 3HI0A 3WXMB 4OGEA 1EP4A 4EZ6A 3ZETB 1BA0A 4DSKA 2B5JA 2PFUA 1NOZA 4WFNL 3EL2A 4NCBA 1LCUA 4I6MB 1NNEA 2AA4A 5AQOA 3LP3A 3LDLA 4E7LA 2HNDA 3AVAA 4J2DA 4BRMA 2UUAK 1NMNA 3AAPA 3AVBA 4IG0A 4O4GA 5ADXA 2P9SA 2P9UB 1YXQA 3FLCO 4M42A 5J2QA 2YHAA 1X3NA 3I55N 1JXBA 5CR4A 1CXQA 2UYTA 5AQUA 3MEGA 1KCFA 4WQ5A 3IS9A 4MO5A 4W5QA 4JRQA 3V81A 3IKMA 4OGCA 1I39A 2Q97A 4CHZA 1GLCG 2FBVA 4FLYA 3DLEA 5GADP 3KK3A 3L4IA 3U6FA 1JKHA 4JLHA 4CVNE 1VSMA 1NKBA 4LH5A 4CJUA 2VCPA 2XY6A 1K9MO 4DTOA 1XMOK 2DPNA 3P4IA 3BDPA 3AVMA 2UUBK 3AV9A 4O55A 1TK8A 3VTIA 4Z4CA 1HYSA 4CHYA 4R5PA 3RMBA 2G8FA 3Q7CA 2GTDA 1KSPA 2HBLA 1QVFM 1BL3A 1HNWK 4LF4K 3U4LA 2QTDA 1P90A 3RR7A 1Q7YO 1RT6A 4JI1K 3ZEUA 3WUHA 3QINA 5CYQA 3UKUB 3QB0A 2XO7A 5SWMA 3E01A 1WSJA 2KFNA
chains in the Genus database with same CATH topology
3GL1A 3O08A 2F9TA 4FWOA 2ASMA 3H6EA 4LC9B 5GAEP 2GELA 3HOTA 1NGBA 2BH1A 3KZBA 2NZTA 4NO7A 4CZEA 4GVEA 4PKHA 4AM6A 3C0BA 1VQPN 4BREA 3TSPA 3M3ZA 3FZLA 3CQYA 3FZFA 2Q2RA 3C65A 3GBTA 4Z94A 1T44A 2P9NB 2A42A 5ADXH 5F1XA 4YOWA 4PKGA 3FFKB 4FWKA 4MO4A 1QHAA 4YDUC 4FOEA 2KKZA 2PAVA 2FSKA 1HLUA 2HSTA 2QW9A 3CJAA 1X9JA 4JK9A 3CCRN 3TSQA 3K9KA 3UE5A 4MLEA 4CZMA 2QA4N 2HMPA 4ILJA 4GV6A 3L6QA 3VEWA 5B8HA 4ISEA 2QXLA 3H1QA 1YAGA 3IFRA 3EO3A 3WXIA 1T6CA 3WXKA 1DT9A 2D0PA 2IIRA 4XH5A 4BRKA 3F2KA 3P31A 4BG9A 5C12A 1K8KB 3ZX3A 4A61A 1GLEG 4BRQA 5TKYA 3DAWA 4JK7A 4M63C 5BRFA 5EXWA 3ULEA 1QQNA 4FWRA 2P9PB 3LDQA 1JCGA 5HOOA 1Y64A 5BN9A 4K41A 4CBUA 3CJCA 1WUAA 2HF4A 3DXMA 3CD6N 3D2EB 4JEPA 4A2BA 4DKWA 1E4GT 1EQYA 2QWQA 1V4TA 2Q1NA 3FR0A 4H5NA 2ZJRL 1YJWN 1OVYA 3VEVA 1V4SA 2P9LA 1J6ZA 3BEXA 5BPLA 1YHQN 4B1VA 2QM1A 1NJIO 3HM8A 4BR4A 3HRGA 1GLFO 4BR5A 4EAHD 1NGJA 3LM2A 2VYPA 4KH6A 3CCSN 3UKUA 3D2FA 1YIJN 1ZBSA 3VETA 4AF1A 3RSEB 3E66A 4WYBA 2YHYA 1TUYA 1KQSM 4EFHA 4A2AA 3O6WA 1TUUA 4IEIA 4DCHA 3GDQA 3OBYA 5H1SQ 1JJ2M 3CCLN 4CI6A 2E88A 2V52B 3R3LA 4H0PA 4IZ9A 3QFUA 3T7ZA 1VQ7N 4JAXA 5AQTA 2CGKA 4IOAL 3SK3A 4NLBA 4BRHA 5BPNA 5JICA 2IVOA 3AARA 3CPEA 3R9PA 4GY2B 2NNWA 4C1NK 1BUPA 3TPQA 4CZIA 1KXPA 3GG4A 1U2VB 5F2RA 4U67L 2P9NA 2OTJN 2E8AA 5JMVA 3VOVA 3OA9A 5EOYA 3ENBA 2NRVA 3E9PA 5AQYA 3DXKB 4L3QA 5AQVA 2V51B 1RDWX 4E1JA 3CMAN 3L0QA 1U6ZA 4FWLA 1SS6A 5I9EB 4RWTA 1VQ9N 2Q31A 3H46O 4BROA 4BRDA 3MX5A 4QS9A 1Z05A 3M5RA 4FSVA 3WQTA 4PL7A 4BRNA 3CIPA 1Q81O 1HKGA 3G4SN 2H3GX 5AQWA 4A5AA 3HZ6A 2FF6A 4FWPA 4ISFA 4CZKA 3U9ZA 3UKRB 4H0XB 1K8KA 4DB3A 4YOTA 5EX5A 2GEMA 4H0YB 3W3DA 5C0YA 3PIPL 3C7NB 3MK6A 4FWNA 4HTLA 3CMEN 3LM9A 3DWLA 2P9PA 3K9JA 3MMVA 3R8EA 3ZX0A 3CJBA 3VMFB 2VWBA 3MCAB 3U9DA 1W97L 2D1KA 4YOXA 3CF5L 5AQGA 2J4RA 1K8AO 1NWKA 1E4FT 5AZIB 3SJHA 3D2EA 3OW2M 1ESVA 2D4WA 2QWNA 4GV3A 4BR0A 1T6DA 5AQHA 2NRHA 3SLCA 4CZFA 5GIOA 2KLAA 3N4QA 3NMUA 1VQMN 4XH1A 1VAZA 4JKEA 4EHUA 4IO9L 1NGFA 2GX9A 3S41A 3I8BA 3RSEA 4WQ4C 2ZJPL 3DLLL 4FPBA 4KBOA 1ZXOA 4B1UB 4O5FA 5BN8A 1HX1A 1NGHA 1JCEA 4B1ZA 4BVOA 4IFEA 1YJ9N 2QWMA 4NB4A 4FWMA 2YX6A 1Q18A 4RCHA 5AZJB 4BRIA 1KC8O 3IMXA 3ZX2A 2JWLA 4BRGA 3A5LC 5C2FA 4BC4A 5KQ8A 3WXLA 4H03B 4B1XB 5AQQA 4CBWA 4CZLA 1U2VA 1YVNA 1W2BM 3BP8A 3O9RA 3JXUA 3VGLA 2HF3A 3DXKA 2E2QA 1HPMA 1KAZA 2A5XA 2FSNA 1IJJA 4CJ7A 2YHXA 3DJCA 4PL8A 1R59O 1YUWA 3O1BA 5LY3A 2F9WA 4YOUA 1G99A 2NRWA 3D7EO 4H5RA 4IO8A 3MDQA 3GOIA 2A3ZA 3UKRA 3KHYA 1BU6O 5TKWA 4WF9L 3A5NC 1ATNA 4RTFD 4FWQA 3O8MA 2ZGZA 2NRZA 3AAQA 3M1FA 3FE1A 4BQZA 2F7TA 2FXUA 4FVUA 1GLAG 3VEOA 2P9KB 2WBNA 5AQRA 2WUSA 2GUPA 3A8YA 3ID6A 3TTDA 3VERA 5AQJA 4AM7A 5AZIA 4M7XA 4BRLA 1JCFA 1C0GA 3MX2A 2W40A 5AQNA 4BC2A 5M1QA 5M1PA 1Q86O 2VGNA 4CBXA 4G9ZA 3LDNA 3U8XA 5AQXA 1P8ZA 2HBJA 4K43A 1LOTB 3LL3A 4JKGB 5DM7L 5FPDA 1M1KO 4BC3A 2QWRA 3WEEB 3NVMA 3QBWA 4EIAA 4EHTA 2VGMA 3D6RA 5CHIA 5AFUA 2ASPA 1X3MA 5ELZA 4CZGA 1ZC6A 3PIOL 1ATSA 3B8AX 5AZJA 1MDUB 1WOQA 1VQKN 4JHDB 2ITMA 2RE2A 3KWIA 4PHTX 5M1NA 3I33A 3J8AA 5KQDA 2E2OA 2HBMA 4BC5A 3BF3A 1NGIA 5DM6L 1QZ6A 1BWFO 4C1NI 3HBTA 5AQKA 1GLBG 3ATUA 3EZWA 4IJAA 1QZ5A 2OANA 3KK7A 1YJNN 4ISGA 3F5TA 3MCPA 4MLHA 5MLCQ 3TSUA 5JLFA 3MN5A 4BG8A 4YOYA 3CXCM 3FGUA 3QFPA 2CGLA 2OTLN 1GLDG 3H3NO 1KD1O 3CHWA 1O13A 3G6EN 5JVHL 5LJWA 1NGEA 3O5BA 1NMDA 4PKIA 5BRHA 5GAGP 3VF4A 3JS6A 4YORA 3CERA 3ATVA 1IG8A 1D4XA 3H3OB 4A5BA 4O8UA 2W41A 2IVNA 4BGAA 2AP1A 3E9LA 3CPWM 4JNEA 1MA9B 1C0FA 1TYQB 3VEYA 4XEIA 3IDHA 4GV9A 4IDHA 2P9KA 3CJ7A 4JD2B 3CCEN 4BR2A 1N8RO 1VQNN 3FZMA 2P9IB 2V7ZA 3VGMA 3EKSA 4OPAA 4NLCA 1XUPO 3OHRA 2NLXA 4ILHA 3MWTA 4H0OA 3AY9A 2KHOA 1QQMA 1HUXA 4YDUA 4BQLA 5EY4A 4JKDA 4B1WB 1VQ5N 2ASOA 1NGCA 2FLOA 5BRDA 3WQUA 4JKGA 4WQ5C 3SAGA 4BR7A 3G71N 4UY8O 4BR9A 2NRRA 3CCJN 2JWKA 3NVKA 4IEEA 4H5VA 3TTFA 3WEEA 3VENA 3LDOA 4KH5A 2GWKA 5M1FA 2YJFA 2D0OA 2E2NA 3VGKA 1NM1A 1EO1A 3PLAA 1NGGA 3SMSA 1KAXA 2WC9A 4C23A 1MWKA 4H5TA 4BRPA 3AGKA 4IJNA 1KAYA 2QWOA 3KVGA 4OPHA 4GNIA 1MWMA 5AQZA 3O9SA 4JHDA 1VQON 2CH5A 3O9UA 3EN9A 3SAFA 3CC2N 4JKBA 3CI5A 1NGDA 3AGRA 4BVPA 3VF6A 5GIPA 3CCVN 1BA1A 3CJ1A 4H0VB 2A6AA 2FSJA 1NGAA 4J8FA 4H5WA 3H45C 4BRFA 5HL7L 1K73O 1GLLO 2P9SB 1VQ6N 5E84A 1RGIA 1T3VA 3G25A 4FOIA 5AFUH 4A59A 4A57A 2E20A 3R1XA 1DKGD 3VESA 3A0IX 4HWIA 4ILGB 1QVGM 3VTHA 4IXCA 3VEXA 3SAHA 4MDAA 5KPZA 4CD1A 3TU5A 5AQSA 5FPEA 4K42A 4IOXA 2QWLA 3N4PA 4F9OA 3SMPA 5LJVA 3A5MC 2RHKA 5BREA 5JVGL 2QWPA 3C7NA 5M1KA 3ENOA 3HTVA 4B1YB 3FZKA 1TYQA 2ZF5O 4WFAL 3E1YA 2A40A 4FL9A 3ID8A 4BRCA 3O9TA 2Q0UA 3VPZA 4JD2A 5F0XA 4CZHA 1S22A 4O8KA 2P9IA 4KH4A 2YCHA 1Q82O 4JKHA 5M1OA 4DHYA 2Q0RA 3KWGA 2NRTA 3L4QA 3VF2A 5AQFA 2IVPA 3ZYYX 4OO1J 1S3XA 3HI0A 3WXMB 5AQPA 3TTCA 5GINA 3CC7N 1XC3A 2YI1A 3MWPA 4JK8A 3ZETB 1BA0A 4M7YA 2PFUA 1XQSC 4IWVA 4WFNL 3EKUA 1RDUA 3EL2A 1HKCA 1LCUA 4U7BA 4I6MB 3QMLA 3C6AA 2AA4A 5AQOA 2HOEA 3LDLA 2WFBA 4FO0A 2FF3B 1S72N 3C6HA 1OKJA 2GWJA 5CE3A 3HSCA 4BRMA 1Z6RA 3ZEUB 2PBDA 4B9QA 3EE8A 1NBWA 5KPRA 4YOVA 3AAPA 4R79A 2HBKA 3BF1A 3P39A 4JN4A 3E9OA 1RFQA 1DGKN 2P9SA 2P9UB 5FPMA 5ADXA 1BDGA 1YXQA 3FLCO 2ZGYA 3QDKA 2I7NA 3H1VX 1HKBA 3QBXA 5AQLA 5JLHA 3HOSA 1X3NA 4JKCA 4CD3A 4JKAA 2Q36A 5EVZA 3I55N 3IUCA 5CR4A 2UYTA 5AQUA 3SBGA 1YITN 3GE1A 5AR0A 4CZJA 3SBTA 2ZJQL 1QQOA 2BTFA 3W0LA 4WQ5A 1NLVA 1ATRA 4MO5A 3MN7A 3A5OC 2V7YA 5AQIA 3VEZA 3WXJA 4WQ4A 5E26A 3IKMA 4K25A 2Q97A 3P38A 4FPAA 3MN9A 3EE9A 4IOCL 2QI2A 1VQ4N 1GLCG 4A62A 1ILYA 2A41A 3CCUN 3F9MA 2ZWHA 4BRAA 4Y0WA 5GADP 1YI2N 3L4IA 3CCMN 4QS7A 3CJ9A 3I56N 4BGBA 5FPNA 3RVCA 2BUPA 1H1VA 3LDPA 4WFBL 3Q7BA 1BOTO 1CZAN 2VCPA 1DEJA 3O1WA 4QS8A 3BUZB 1K9MO 1SZ2A 3FZHA 2DPNA 1M90O 3CETA 3P4IA 2QEXN 3OBWA 3J7ZO 5C15A 3ULEB 1YF5L 3ZETA 1VQ8N 2E2PA 2YJEA 3VTIA 1SQKA 5BR9A 1VQLN 4DQ8A 3O80A 3T69A 3CC4N 2E1YA 3Q7CA 4WCEL 2CGJA 2GTDA 5BPMA 4H0TB 5C10A 3QICA 2HBLA 4FWSA 1QVFM 2CH6A 3DXMB 1SAZA 4I6MA 3ENHA 1GLJO 4JKFA 2E1ZA 3M6GA 3WT0A 3U4LA 3O4WA 5AQMA 2QTDA 3R6MA 2P9LB 4XH4A 1BO5O 1P90A 3O9QA 1Q7YO 5C2DA 2NRXA 3ZEUA 2EWSA 3UB5A 3MN6A 3WUHA 1HJOA 2I7PA 4BY9C 3UKUB 3D2FB 2YHWA 5GAHP 3QB0A 4MDBA 3CCQN 5KPTA 3CQXA 2P9UA 1BG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV9 A;  4FVU A;  3MWP A;  3MX5 A;  3MWT A;  3MX2 A;  4GVE A;  4GV3 A;  3R3L A;  3Q7B A;  4G9Z A;  3Q7C A;  4GV6 A; 
#chains in the Genus database with same CATH topology
 2E4L A;  3O08 A;  4ZHR A;  4CK3 A;  2O8B A;  1NGB A;  2NZT A;  4CZE A;  4GVE A;  3KIO A;  1VQP N;  1HYZ A;  1TK5 A;  5AJ3 K;  4N5S A;  2Q2R A;  3GBT A;  3K5L A;  1T44 A;  5ADX H;  3ISN C;  1X9S A;  4KB0 A;  4IOA L;  1QHA A;  4KKO A;  1RDA A;  2HST A;  1A5V A;  3AA4 A;  3THY A;  4MLE A;  1U4B A;  4KTW A;  2HMP A;  1EWQ A;  1SKW A;  4L8R B;  5B8H A;  4ISE A;  3PY8 A;  3H1Q A;  4HCC A;  4C8L A;  1YAG A;  3IFR A;  3WXI A;  1T6C A;  2D0P A;  3P31 A;  5C12 A;  1QSY A;  4C8M A;  1XI1 A;  4JK7 A;  1LW0 A;  3ULE A;  3HPO A;  1QQN A;  4FWR A;  2P9P B;  2P5G A;  4FZX C;  5HP1 A;  5HOO A;  1HR0 K;  4H4O A;  1RDB A;  4K41 A;  3RR8 A;  4IFY A;  1D9D A;  3D2E B;  4JEP A;  3OJS A;  1WSE A;  2P9L A;  1YHQ N;  3HRG A;  1HRH A;  1WB9 A;  3VET A;  1ZBU A;  3RSE B;  4C8K A;  4EZ9 A;  1BIU A;  3QET A;  4DCH A;  4IEI A;  1JJ2 M;  5H1S Q;  3CCL N;  3OBY A;  3OYL A;  4HUE A;  2OZM A;  2V52 B;  3T7Z A;  3ULD A;  3KD1 E;  3SK3 A;  4DG1 A;  4JI6 K;  1BIS A;  4GY2 B;  4KV8 A;  1BHL A;  3TWH A;  1BUP A;  2BGG A;  1KXP A;  1JLC A;  2P9N A;  2W6L A;  1WNS A;  4O0J A;  3QER A;  1L3V A;  5AQY A;  2X6N A;  4FVM A;  3E9P A;  4L3Q A;  2YNI A;  2V51 B;  4BAC A;  1RDW X;  4E1J A;  4RWT A;  2OPR A;  1VQ9 N;  2Q31 A;  4BRO A;  2W6K A;  4FSV A;  4CJ5 A;  2RKI A;  3CIP A;  1JLG A;  1D8Y A;  2H3G X;  5AQW A;  3QNN A;  3HZ6 A;  4CZK A;  3KKS A;  1Z25 A;  4H0X B;  1K8K A;  1RIL A;  2FBT A;  3PIP L;  3C7N B;  4HTL A;  1XMQ K;  3LM9 A;  3K9J A;  3R8E A;  3ZSW A;  5C25 A;  2VWB A;  3AO1 A;  3U9D A;  5AQG A;  3MXM A;  1K8A O;  1IBM K;  4FK2 A;  3OW2 M;  2D4W A;  4DV5 K;  1NJW A;  1EXQ A;  4BR0 A;  2NRH A;  4LF6 K;  4CZF A;  3OYK A;  1T03 A;  3QIP A;  2G8U A;  4WQ4 C;  4BDZ A;  4FPB A;  1IKW A;  3QEX A;  4W5N A;  3RMA A;  2D0C A;  4BVO A;  2B4J A;  2QWM A;  3V9Z A;  2A1S A;  1Q18 A;  4RCH A;  3V9W A;  4BRI A;  4BRG A;  2JWL A;  5KQ8 A;  2OZS A;  4H03 B;  5T7B A;  4DTM A;  1U2V A;  1YVN A;  3IRX A;  4FJG A;  1WSH A;  5BR8 K;  1NJZ A;  2WOM A;  4CF8 A;  2FSN A;  1XHZ A;  3DJC A;  4PL8 A;  1YUW A;  4B3T K;  4G1Q A;  1T05 A;  1N33 K;  3VN5 A;  4YOU A;  1CXU A;  1NK8 A;  1BCO A;  1RBU A;  2D0B A;  3MDQ A;  2A3Z A;  5LL6 Z;  4JI2 K;  2OPP A;  4WF9 L;  3A5N C;  1ATN A;  1YVU A;  4DR5 K;  3RTV A;  4NYF A;  2QKK A;  2F7T A;  3JYT A;  1S6P A;  4FVU A;  2WBN A;  3ID6 A;  4LF7 K;  5AQJ A;  4AM7 A;  1NG9 A;  3KLH A;  2O8F B;  3HT3 A;  3MX2 A;  1WLJ A;  1SL1 A;  4CBX A;  4DSE A;  3LDN A;  3U8X A;  1UOC A;  1OH8 A;  4K43 A;  3VA3 A;  3ZT2 A;  3SJJ A;  3L2R A;  3VQ9 A;  3AVC A;  1C1A A;  1KLM A;  3J7A P;  3QBW A;  2F8T A;  1VHX A;  2XRI A;  4M45 A;  4B9U A;  5ELZ A;  3PIO L;  1WSI A;  1MDU B;  4N56 A;  4DR1 K;  1VQK N;  1VSK A;  3V1R A;  5KQD A;  4DV3 K;  2HBM A;  3HK2 A;  4BC5 A;  2VWJ A;  3SI6 A;  3CQ8 A;  3ATU A;  1YJN N;  4F2R A;  2OAN A;  2FC0 A;  3KK7 A;  4ISG A;  4YOY A;  5MLC Q;  5JLF A;  1S1X A;  4NXN K;  3CHW A;  5LJW A;  3OS0 A;  1TKD A;  1ASW A;  5GAG P;  3NFA A;  3JS6 A;  3CER A;  3ATV A;  1IG8 A;  4A5B A;  3QNO A;  2W41 A;  4UQG A;  4DTU A;  1S1U A;  2WON A;  3VEY A;  1TYQ B;  3DMJ A;  1HQU A;  4XEI A;  4W5R A;  3DLB A;  2P9K A;  3KLG A;  4NCA A;  4CHP A;  3J80 O;  3EKS A;  1J5E K;  4NLC A;  1XUP O;  2NLX A;  3MWT A;  1TK0 A;  3A2F A;  3QO9 A;  1QQM A;  4YDU A;  4K8X A;  1NKC A;  5BRD A;  3SAG A;  3WQU A;  3OTO K;  4IEE A;  2HHV A;  3TTF A;  3LDO A;  2UU9 K;  2E2N A;  3VGK A;  1ZBI A;  2Z1G A;  3PLA A;  2ATQ A;  3HST B;  1VSL A;  4C23 A;  4IJN A;  1KAY A;  2UXB K;  2BE2 A;  4OPH A;  3VQC A;  1REV A;  2UUC K;  1VQO N;  3O3G A;  1XNR K;  3CI5 A;  5EU7 A;  1WSG A;  4CK2 A;  5GIP A;  3CCV N;  1BA1 A;  4CJP A;  2A6A A;  1K73 O;  4H5W A;  3DLK A;  3V9S A;  4B9V A;  1L3T A;  1KLN A;  4M3Z A;  2OPS A;  3G25 A;  3THV A;  4A57 A;  1X9M A;  4OVL A;  1OH7 A;  2O8C B;  4HWI A;  2P1J A;  3VTH A;  3AO2 A;  3NBP A;  5KRT A;  3PO4 A;  5AQS A;  4LSL A;  2IGI A;  3S3O A;  4DTR A;  3VQB A;  2QWP A;  2HHU A;  5M1K A;  3VQ7 A;  3FZK A;  1VSH A;  3DYA A;  3CYM A;  4J2A A;  1OVQ A;  3ID8 A;  3K5O A;  4JD2 A;  4BDP A;  4DFK A;  4O8K A;  2P9I A;  4KH4 A;  3ZT0 A;  3KK2 A;  4AQY K;  4DR4 K;  2YCH A;  4B9N A;  3F73 A;  4CCH A;  4DHY A;  3M8R A;  3L4Q A;  3VF2 A;  3VA0 A;  5AQF A;  2IVP A;  3BZC A;  4FZY A;  3AA3 A;  3LP2 A;  5GIN A;  1XC3 A;  3S3N A;  3MWP A;  4M7Y A;  1BIZ A;  5HBM A;  4M3Y A;  2Z1I A;  4U7B A;  3QML A;  2HOE A;  4X66 K;  3NH2 A;  5CE3 A;  3HXM A;  2IS3 A;  5KPR A;  3BF1 A;  4PY5 A;  1BDG A;  3QDK A;  1C6V A;  2ZGY A;  2I7N A;  3H1V X;  1HKB A;  3QBX A;  5AQL A;  1JLA A;  3EY1 A;  3HOS A;  4K0K K;  3VQ8 A;  1LWC A;  4JKC A;  1IKX A;  2YV0 X;  4JKA A;  1YIT N;  1EET A;  3GE1 A;  4CZJ A;  1TV6 A;  1QQO A;  5J2P A;  1NLV A;  3V9U A;  3MN7 A;  2V7Y A;  1S9E A;  4FW2 A;  1ASU A;  4K25 A;  2ETJ A;  3P38 A;  4FPA A;  3MN9 A;  4H4M A;  3P1G A;  1B92 A;  2A41 A;  2FBX A;  2ZWH A;  3SYZ A;  4Y0W A;  1TAU A;  4QS7 A;  1RDC A;  1VSD A;  5FPN A;  4B08 A;  4OLB A;  3LDP A;  3Q7B A;  1BI4 A;  1CZA N;  4GVM A;  3HVT A;  3O1W A;  4QS8 A;  1RDD A;  3BUZ B;  3FZH A;  1WN7 A;  2UXC K;  3NDK A;  3OBW A;  1G15 A;  5C15 A;  3J81 O;  2E2P A;  4DU4 A;  1VQL N;  5HRS A;  3O80 A;  3CC4 N;  2E1Y A;  1B9F A;  4WCE L;  5C10 A;  4H0T B;  3QIC A;  2OCE A;  3DXM B;  3THX A;  1GLJ O;  4JYA K;  4BE0 A;  4CE9 A;  1JL2 A;  3O9Q A;  3PX6 A;  4RG8 A;  2EWS A;  2WTU A;  1UWB A;  3T3F A;  3D2F B;  3CCQ N;  4RW6 A;  4XIU A;  3ALY A;  4LFB K;  4YNQ A;  4LFC K;  4FWO A;  1EX4 A;  2ASM A;  4FLZ A;  3HOT A;  3LPU A;  3KZB A;  4NO7 A;  4PKH A;  4AM6 A;  3PV8 A;  3C0B A;  4LF5 K;  3CQY A;  3FZF A;  5LMU K;  2A42 A;  3DRP A;  2FSK A;  2QW9 A;  1X9J A;  4JK9 A;  3CCR N;  3EEQ A;  3K9K A;  2O8D A;  4E89 A;  2HB5 A;  4FJN A;  2QXL A;  1KRP A;  4F4K A;  1DT9 A;  4BRK A;  4BG9 A;  1JXE A;  4H8K A;  2YHB A;  4BRQ A;  1RT5 A;  3L3U A;  5TKY A;  3DAW A;  4M63 C;  4CFC A;  4FJJ A;  4E7I A;  4BE1 A;  4FJH A;  1I3A A;  4N47 A;  3BZK A;  4BWJ A;  4WE1 A;  1Y64 A;  5BN9 A;  4KHU A;  3CJC A;  1SUQ A;  1RT1 A;  1TL1 A;  3CD6 N;  4FLU A;  3LWL A;  4FJ7 A;  4DKW A;  1E4G T;  1EQY A;  1JLB A;  1S1W A;  3I0R A;  2P51 A;  1NJI O;  2QM1 A;  3HM8 A;  1SL2 A;  1GLF O;  3MAQ A;  4DU3 A;  4FW1 A;  4CEZ A;  4KH6 A;  3CCS N;  3SPY A;  4OLA A;  3LAM A;  5IWA K;  4FK4 A;  4EFH A;  4A2A A;  1TUU A;  4CIE A;  1X1P A;  1UA0 A;  1W9H A;  4N76 A;  3R3L A;  2XY5 A;  4OPJ A;  3QFU A;  4Y1C A;  4B8A B;  4JAX A;  4CJ3 A;  5AQT A;  1UA1 A;  4NLB A;  4RW4 A;  5JIC A;  3AAR A;  3K2P A;  3KKR A;  2O4G A;  4CGF A;  4FXD A;  4U67 L;  5F2R A;  3ZT3 A;  2JGU A;  5DMR A;  3RRG A;  4F3T A;  1QQC A;  3SZ2 A;  5EOY A;  3ENB A;  3T1A A;  3VQ4 A;  4LH4 A;  3ZSZ A;  4CGG A;  3L0Q A;  3OYH A;  1U6Z A;  4FWL A;  4BRD A;  3MX5 A;  4PL7 A;  1Z05 A;  3WQT A;  3SNN A;  3JAM O;  5J1E A;  3M8P A;  1UAX A;  4A5A A;  2FF6 A;  4DQQ A;  4ELV A;  3L2W A;  3ZSQ A;  4H0Y B;  3PSF A;  3K57 A;  3MK6 A;  4CIG A;  3DWL A;  2IOC A;  3OYI A;  1RBV A;  1IKV A;  1J53 A;  3MCA B;  4YOX A;  1K6Y A;  1E4F T;  5AZI B;  3SJH A;  3KLE A;  4LFA K;  4DV4 K;  2QWN A;  3AO3 A;  4GV3 A;  5AQH A;  3BY5 A;  4E7H A;  1RT3 A;  3FFI A;  3N4Q A;  4KRF A;  1XWL A;  4DLE A;  4XH1 A;  4O5B A;  4JKE A;  4NCG A;  2GX9 A;  1WSF A;  1TL3 A;  3S41 A;  3V4I A;  3V6D A;  4B8C A;  4FK0 A;  2ZJP L;  4B1U B;  1HX1 A;  1NGH A;  4B1Z A;  2DTU A;  4FJ9 A;  3ZSY A;  4IFE A;  4NB4 A;  4IBN A;  2YX6 A;  1A5X A;  4JI0 K;  1KC8 O;  2HHS A;  4E0D A;  1HPZ A;  3A5L C;  4BC4 A;  4DR6 K;  3IG1 A;  4E1M A;  4FYD A;  3O9R A;  4X65 K;  3JXU A;  2HF3 A;  3DXK A;  3K58 A;  1NK5 A;  2HHW A;  1IJJ A;  2YHX A;  1Q9X A;  3O1B A;  3RMD A;  4H5R A;  4IO8 A;  3GOI A;  4Z4E A;  3UKR A;  3O8M A;  1C0U A;  1U48 A;  2ZGZ A;  2NRZ A;  4KHQ A;  4KHN A;  1RTI A;  3DI6 A;  3TTD A;  3A8Y A;  1IH7 A;  3VER A;  3U3G A;  2R7Y A;  4BRL A;  3QES A;  1TVR A;  1C0G A;  2W40 A;  5AQN A;  4BC2 A;  5M1P A;  1Q86 O;  1TAQ A;  1VK0 A;  4CFB A;  3VQA A;  1LOT B;  3LL3 A;  4JKG B;  1VSE A;  3TAE A;  5FPD A;  4BC3 A;  2O4I A;  3HM9 A;  4DV0 K;  3WEE B;  4M3U A;  2YNH A;  4ZTJ A;  3UIQ A;  4EHT A;  1NJX A;  2ASP A;  4CHO A;  1KTQ A;  1ZC6 A;  2GBZ A;  4AHS A;  4LY7 A;  5AZJ A;  1WAJ A;  4CJR A;  2RE2 A;  3KWI A;  4PHT X;  4X62 K;  1RTH A;  1E3M A;  3QLH A;  4AH9 A;  5DM6 L;  1NGI A;  1QZ6 A;  1BWF O;  1GOB A;  3HYF A;  4C1N I;  1RBS A;  5AQK A;  4I9L A;  2HHT A;  3EZW A;  4IJA A;  5KTQ A;  3F5T A;  4MLH A;  3TSU A;  4FCY A;  2CGL A;  2OTL N;  5FRM A;  2VG6 A;  1A5W A;  2IC3 A;  1NGE A;  3O5B A;  3K5N A;  1HMV A;  2G8H A;  2HW3 A;  4YOR A;  2IAJ A;  3H3O B;  4ID1 A;  4BGA A;  4IDK A;  2OPQ A;  1C0F A;  2BDP A;  2YNF A;  2ZD1 A;  4IDH A;  3DRS A;  3CJ7 A;  2O8E A;  4BR2 A;  4Z0U A;  3L2Q A;  1VQN N;  3FZM A;  1W0H A;  2QKB A;  3O3F A;  4OPA A;  5I3U A;  3OY9 A;  4CJE A;  3JSM A;  4OJR A;  4CIF A;  1TKZ A;  4BE2 A;  3AY9 A;  4AHR A;  3OYM A;  2OA8 A;  1QHT A;  5EY4 A;  4B1W B;  1VQ5 N;  2ASO A;  1LWE A;  4E7J A;  4BR7 A;  4UY8 O;  4B9M A;  4JS4 A;  2FBY A;  2XY8 A;  3NVK A;  2X6S A;  2Y1I A;  4KH5 A;  5M1F A;  2D0O A;  3AVI A;  3D45 A;  1NM1 A;  1BQM A;  4O44 A;  3MXJ A;  1SKR A;  4CJQ A;  2HNZ A;  2QWO A;  2RF2 A;  3SUQ A;  1MWM A;  2HMI A;  3O9S A;  4JHD A;  4KTZ A;  2CH5 A;  3O9U A;  4CW7 B;  4JKB A;  3MXI A;  4FZZ A;  3AGR A;  3VF6 A;  3CJ1 A;  4LF8 K;  2FSJ A;  3L2V A;  1RBR A;  2P9S B;  1Q8I A;  1VQ6 N;  4DQP A;  1T3V A;  4FOI A;  2E20 A;  3R1X A;  3OYE A;  1DKG D;  3QEV A;  4CF2 A;  3SAH A;  1DTT A;  4AHC A;  3PUF A;  4MDA A;  4CD1 A;  3TU5 A;  4K42 A;  4F9O A;  4EP5 A;  5LJV A;  4M3W A;  2RHK A;  4FJK A;  2HHH K;  3LWM A;  3K5M A;  4DV6 K;  4WFA L;  3E1Y A;  1D5A A;  3IAY A;  4BRC A;  5F0X A;  3SQ1 A;  4CZH A;  1S22 A;  3T1Y K;  2HVH A;  3TR8 A;  2JLE A;  3OYF A;  1I94 K;  3PO5 A;  4OO1 J;  4KI6 A;  3NGI A;  4CHQ A;  1YT3 A;  3TTC A;  3CC7 N;  2YI1 A;  4Z4G A;  4CEF A;  1XQS C;  4X64 K;  5I42 A;  1VRU A;  1L5U A;  3H08 A;  4FLX A;  2FF3 B;  4FLW A;  3C6H A;  1OKJ A;  1S72 N;  2PY5 A;  3HSC A;  3L3V A;  3OJU A;  1Z6R A;  3ZEU B;  2ZM6 K;  3S9H A;  3EE8 A;  1NBW A;  3MEC A;  2HBK A;  1NJY A;  4JN4 A;  5FRO A;  1QE1 A;  5JS1 A;  3PX0 A;  2O8B B;  4CD3 A;  2Q36 A;  2DFH A;  4DF4 A;  4AHT A;  5AR0 A;  3SBT A;  2BTF A;  4W5T A;  3W0L A;  4W5O A;  4K8Z A;  4B3O A;  4Z4I A;  3P5J A;  5AQI A;  5E26 A;  2RPI A;  1C1B A;  3SUN A;  4AIL C;  3I0S A;  1QSL A;  3EE9 A;  3LAK A;  1VQ4 N;  4JI5 K;  4A62 A;  3D0P A;  3THY B;  4N41 A;  4FJX A;  3F9M A;  4BRA A;  1YI2 N;  3CCM N;  2A1R A;  3CJ9 A;  4BGB A;  3RVC A;  1DTQ A;  2BUP A;  1BOT O;  5C24 A;  1DEJ A;  3VQD A;  1SZ2 A;  1M90 O;  2QEX N;  3CET A;  3NF7 A;  5A2Q O;  3C6T A;  1YF5 L;  3ULE B;  3ZET A;  4JRP A;  3AVH A;  2XHB A;  2CGJ A;  5BPM A;  3TAN A;  1SAZ A;  3AVG A;  4I6M A;  3ENH A;  2E1Z A;  3M6G A;  3WT0 A;  4ELU A;  3HP6 A;  5CYM A;  2P9L B;  2HHQ A;  1S9G A;  3AVF A;  3UB5 A;  3MN6 A;  2X74 A;  4BY9 C;  5KPT A;  2PZS A;  3CQX A;  2QK9 A;  2P9U A;  3M8S A;  3GL1 A;  2F9T A;  4DR7 K;  3H6E A;  5GAE P;  2GEL A;  4CEC A;  1N36 K;  3OYB A;  4BRE A;  3TSP A;  3FZL A;  1X9W A;  3C65 A;  4Z94 A;  2P9N B;  4DV1 K;  4YDU C;  4FOE A;  2KKZ A;  2PAV A;  1HLU A;  1JLF A;  4CED A;  3TSQ A;  3UE5 A;  4ILJ A;  4GV6 A;  2XY7 A;  1OH5 A;  3WXK A;  1RNH A;  4XH5 A;  3AO4 A;  3F2K A;  1K8K B;  1C1C A;  3ZX3 A;  4I7F A;  1RT7 A;  1GLE G;  3WNG A;  4HVJ A;  1YTA A;  4KFB A;  3RWU A;  4M41 A;  3OYN A;  1HNI A;  4B9T A;  3CM6 A;  3VQP A;  3HJF A;  2QWQ A;  2Q1N A;  3FR0 A;  4H5N A;  4QAG A;  4CEQ A;  2X78 A;  1YJW N;  1OVY A;  3VEV A;  3BEX A;  1J6Z A;  1DLO A;  4JI8 K;  3NF9 A;  2RN2 A;  1NGJ A;  3TAP A;  2VYP A;  3UKU A;  1YIJ N;  1WAF A;  1LWF A;  2VWK A;  4KHY A;  1Q9Y A;  3CM5 A;  1TUY A;  1KQS M;  3KTQ A;  3O6W A;  3GDQ A;  2E88 A;  1NK9 A;  5FDL A;  4IZ9 A;  2DFE A;  1VQ7 N;  4E1N A;  5BPN A;  4YY3 K;  4FM1 A;  4CJL A;  4C1N K;  3TPQ A;  1U2V B;  1FKP A;  4C8N A;  2E8A A;  3OA9 A;  3ZT1 A;  4I2P A;  5AQV A;  4RW8 A;  3CMA N;  4DWI A;  1N32 K;  3TI0 A;  4QS9 A;  3M5R A;  4BRN A;  1IV0 A;  4B3M K;  3C6U A;  3G4S N;  1JLE A;  4DFP A;  3NF6 A;  4FWP A;  3U9Z A;  3ZT4 A;  1HNV A;  4YOT A;  3L2U A;  4PA1 A;  3W3D A;  3LP1 A;  1U49 A;  2P9P A;  3ZX0 A;  3LDS A;  3CJB A;  3NGZ A;  1W97 L;  2D1K A;  3CF5 L;  3DLR A;  3D2E A;  1KFD A;  3VQQ A;  4B9S A;  4Q5V A;  3WNE A;  2Z1J A;  3SLC A;  4CEE A;  1IBK K;  5GIO A;  2KLA A;  3NMU A;  1VAZ A;  4EHU A;  4IO9 L;  1NGF A;  3CFP A;  3RSE A;  1KFS A;  3DLL L;  4DV7 K;  4Z4F A;  3LAN A;  2VQF K;  2PYL A;  3IMX A;  5C2F A;  4RW9 A;  3M8Q A;  3WXL A;  4CBW A;  4CJK A;  5AQQ A;  4CZL A;  3TAQ A;  1W2B M;  2DFF A;  3VGL A;  5HLF A;  2E2Q A;  3B6P A;  4TSX A;  3KLI A;  4CJ7 A;  3HL8 A;  1OH6 A;  5LY3 A;  1HQE A;  1G99 A;  2NRW A;  3D7E O;  2GUI A;  3KHY A;  1GOC A;  4FWQ A;  3AAQ A;  4RW7 A;  2HHX A;  2Q3S A;  4BQZ A;  3SQ0 A;  2YKN A;  4JV5 K;  2FXU A;  1WBB A;  3U3Y A;  1GLA G;  2P9K B;  4CF0 A;  1N5Y A;  4DFJ A;  1QSS A;  4M7X A;  3ZSO A;  2E5L K;  2Y1J A;  2VGN A;  1QTM A;  4G9Z A;  1RBT A;  1IBL K;  2HBJ A;  1SL0 A;  3CFO A;  1M1K O;  2QWR A;  3NH1 A;  4CJS A;  5LMN K;  4CGD A;  4EIA A;  2Z1H A;  3I8D A;  2VGM A;  3D6R A;  4OKE A;  5CHI A;  4DLG A;  4DTP A;  1HNX K;  1S1V A;  3OS2 A;  1ATS A;  3B8A X;  4DUZ K;  4CGJ A;  5J2M A;  2ITM A;  3I33 A;  3J8A A;  4PQU A;  2LSN A;  2VG5 A;  3BF3 A;  1LAV A;  3G0Z A;  1KVC A;  2YNG A;  1QZ5 A;  4B3S K;  3CXC M;  2KW4 A;  3OYC A;  4BG8 A;  2G8V A;  1GLD G;  1KD1 O;  3NCI A;  4FM0 A;  4BDY A;  1O13 A;  5D3G A;  2F8S A;  4OKK A;  3TAG A;  1NMD A;  5BRH A;  3TAR A;  4ICL A;  3O3H A;  2HNY A;  4O8U A;  2IVN A;  1IKY A;  2AP1 A;  3E9L A;  3WNH A;  4JNE A;  3HVR A;  3DM2 A;  4GV9 A;  3LPT A;  4JD2 B;  5CZ2 A;  3CCE N;  2P9I B;  2V7Z A;  1T7P A;  3OHR A;  2O8F A;  1F21 A;  4I2Q A;  4BQL A;  2PYJ A;  4JKD A;  1J54 A;  4WQ5 C;  3G71 N;  3ZSX A;  4BR9 A;  2NRR A;  5SZT A;  2JWK A;  4H5V A;  3VEN A;  4EP4 A;  4NYN A;  2GWK A;  2YJF A;  1XNQ K;  2YKM A;  4IFV A;  2P5O A;  1NGG A;  3KVG A;  5AQZ A;  3CC2 N;  3SAF A;  1WBD A;  3AVJ A;  1NGD A;  1FXX A;  2KZM A;  4CJ4 A;  2OYQ A;  4E7K A;  3NAE A;  2EX3 A;  2VG7 A;  2B6A A;  1BGX T;  4DR3 K;  1RGI A;  4A59 A;  1Y97 A;  3QEW A;  4M3X A;  4J2E A;  3VES A;  1J9A A;  3HP9 A;  2QXF A;  4ILG B;  1QVG M;  4KPY A;  3VEX A;  1S1T A;  5KPZ A;  3N4P A;  3A5M C;  3BGR A;  5JVG L;  1LW2 A;  5KGX A;  4HUG A;  1ZBL A;  1R0A A;  3SUO A;  1TKT A;  3HTV A;  4B1Y B;  1TYQ A;  5K14 A;  1C0M A;  4KTQ A;  3VPZ A;  3B6O A;  3OYJ A;  1EKE A;  2W42 A;  4KRE A;  3LZI A;  1BI4 B;  2NRT A;  4JI3 K;  3AA2 A;  5FLX O;  3KJV A;  2HVI A;  5AQP A;  4C8O A;  1IO2 A;  4M3R A;  4ID5 A;  4HUF A;  2G8K A;  4JK8 A;  1N34 K;  1XC9 A;  3MED A;  4IWV A;  1SKS A;  4PUO A;  3EKU A;  1RDU A;  3SUP A;  5HRP A;  1HKC A;  4GKJ K;  1RTD A;  5JS2 A;  3THX B;  3C6A A;  1CZ9 A;  4CER A;  4CEO A;  3QEI A;  4FO0 A;  2WFB A;  1RT4 A;  3PX4 A;  2GWJ A;  3ASM A;  4DV2 K;  2PBD A;  4B9Q A;  1HYV A;  4YOV A;  4R79 A;  3P39 A;  3E9O A;  1RFQ A;  1DGK N;  5FPM A;  1RTJ A;  1B9D A;  5JLH A;  5FRN A;  2O8C A;  3MEE A;  5EVZ A;  3IUC A;  3SBG A;  4CGI A;  4CGH A;  3T1H K;  2ZJQ L;  1NK0 A;  1XHX A;  1ATR A;  4CJW A;  3A5O C;  1S6Q A;  3VEZ A;  3WXJ A;  4WQ4 A;  2F4V K;  4DS5 A;  1FK9 A;  2BAN A;  4IOC L;  2QI2 A;  4BWM A;  4DU1 A;  3DLH A;  1ILY A;  2NUB A;  3CCU N;  1FJG K;  4QOZ B;  3SQ4 A;  4FLV A;  2O8D B;  4GW6 A;  3I56 N;  3F9K A;  3OYA A;  1H1V A;  4WFB L;  3NHG A;  4B9L A;  3SPZ A;  1SV5 A;  4DF8 A;  1TGO A;  4OX9 K;  3J7Z O;  3SQ2 A;  1VQ8 N;  3PSI A;  2YJE A;  3ZSR A;  1SQK A;  5BR9 A;  4F3O A;  1QS4 A;  4DQ8 A;  3THW A;  3SV3 A;  3T69 A;  3C94 A;  5HRR A;  4FWS A;  2CH6 A;  3TAB A;  3ZLJ A;  4JKF A;  4ELT A;  3O4W A;  5AQM A;  3R6M A;  4XH4 A;  1BO5 O;  5C2D A;  2NRX A;  3AVL A;  3V1Q A;  1U04 A;  1HJO A;  2I7P A;  5GAH P;  2YHW A;  1GOA A;  4MDB A;  4FJ5 A;  1NK4 A;  1BG3 A;  3K59 A;  4LC9 B;  4CJF A;  2BH1 A;  3LP0 A;  4O0I A;  1VRT A;  3M3Z A;  3NGY A;  5F1X A;  4YOW A;  4PKG A;  3FFK B;  4FWK A;  4MO4 A;  3HPG A;  4DSF A;  3CJA A;  4CJT A;  1CLQ A;  4JS5 A;  4CZM A;  2QA4 N;  4FJI A;  4E3S A;  3NE6 A;  3L6Q A;  3VEW A;  4MFB A;  2ITG A;  3HPH A;  3EO3 A;  1ZBH A;  1RCH A;  2IIR A;  3AA5 X;  4A61 A;  3HO1 A;  1N6Q A;  2D5R A;  5BRF A;  5EXW A;  3LDQ A;  4FLT A;  1JCG A;  4LF9 K;  4CBU A;  1LV5 A;  4IG3 A;  1WUA A;  1LAW A;  2E6L A;  1FW6 A;  2HF4 A;  3DXM A;  4A2B A;  4FM2 A;  1V4T A;  2ZJR L;  1V4S A;  4ZTF A;  5BPL A;  4B1V A;  4BR4 A;  4BR5 A;  4EAH D;  3LM2 A;  1KVB A;  3D2F A;  1ZBS A;  4AF1 A;  1NK7 A;  3E66 A;  4WYB A;  2YHY A;  4CI6 A;  4DR2 K;  1NU0 A;  1Z26 A;  3QIO A;  4H0P A;  4I9Q A;  4Q0B A;  4V19 S;  1S5J A;  2CGK A;  4Z4H A;  4KB1 A;  4BRH A;  2IVO A;  3CPE A;  3DOL A;  3R9P A;  2NNW A;  4B3R K;  3C95 A;  4CZI A;  3GG4 A;  2OTJ N;  1VSF A;  1D9F A;  5JMV A;  1HNZ K;  3VOV A;  2NRV A;  4Y1D A;  3DXK B;  4DUY K;  2UXD K;  4CFD A;  3LZJ A;  4DSI A;  1SS6 A;  5I9E B;  3H46 O;  4M3T A;  1L3U A;  4CJV A;  4AHV A;  2KQ2 A;  1Q81 O;  3K0S A;  1HKG A;  4DFM A;  4ISF A;  2ZQB A;  2E6M A;  3DLG A;  3UKR B;  1ZBF A;  4DB3 A;  5EX5 A;  2GEM A;  1IG9 A;  1VSI A;  5C0Y A;  4FWN A;  3CME N;  4HHT A;  3MMV A;  2DY4 A;  1BQN A;  3DOK A;  3VMF B;  4DTX A;  2J4R A;  3QEP A;  1NWK A;  4DQR A;  1ESV A;  4KHW A;  1T6D A;  4OKJ A;  1VQM N;  1O1W A;  5HRO A;  1VSJ A;  3V1O A;  3I8B A;  4AHU A;  1KVA A;  4KBO A;  4E19 A;  1ZXO A;  2F96 A;  5E41 A;  2G8W A;  4O5F A;  4DS4 A;  5BN8 A;  1JCE A;  3O4N A;  4FJL A;  4YFU A;  1YJ9 N;  4FWM A;  5AZJ B;  4DTN A;  3ZX2 A;  1TKX A;  3T19 A;  4B1X B;  1U47 A;  3SV4 A;  3BP8 A;  1RT2 A;  1HJR A;  1HPM A;  1KAZ A;  2A5X A;  1R59 O;  3OYD A;  4DMN A;  3OS1 A;  2F9W A;  4LD0 A;  3NH0 A;  2KFZ A;  1BU6 O;  5TKW A;  3ZSV A;  4RTF D;  3DRR A;  3M1F A;  3FE1 A;  4KO0 A;  1C0T A;  3O4Q A;  1L3S A;  3VQE A;  3VEO A;  3OVN A;  5AQR A;  2O8E B;  2WUS A;  2GUP A;  1JL1 A;  5AZI A;  1JCF A;  4DTS A;  3LAL A;  5M1Q A;  2KTQ A;  2G8I A;  3V9X A;  3EZ5 A;  5AQX A;  4YHH K;  1P8Z A;  4FJM A;  5DM7 L;  3P83 D;  3KLF A;  5HRN A;  1J5O A;  1JLQ A;  3J7Y P;  3NVM A;  3THW B;  3VQ6 A;  3TAF A;  4CES A;  3EYZ A;  3WNF A;  5AFU A;  1X3M A;  4CZG A;  2KZZ A;  4LSN A;  1WOQ A;  4JHD B;  3RMC A;  3ZCM A;  1BCM A;  5M1N A;  4CF9 A;  3CG7 A;  2E2O A;  4GKK K;  3HBT A;  1GLB G;  3NF8 A;  3MCP A;  4KAZ A;  3MN5 A;  4MQ3 A;  3AVK A;  3FGU A;  3QFP A;  3KD5 E;  3AO5 A;  3H3N O;  2EHG A;  4F8R A;  4CHN A;  3G6E N;  5JVH L;  3RRH A;  1NOY A;  4DQI A;  4PKI A;  3VF4 A;  1D4X A;  3TAM A;  4HCB A;  2I5J A;  2D0A A;  3CPW M;  5DK5 A;  1MA9 B;  5KRS A;  1W7A A;  4DQS A;  3IDH A;  5KGW A;  4CK1 A;  1N8R O;  4OPK A;  5IT9 O;  3VGM A;  4ILH A;  4J2B A;  4H0O A;  1ITG A;  3OYG A;  2IDO A;  2KHO A;  1HUX A;  3SCX A;  5J2N A;  1NGC A;  2FLO A;  5CZ1 A;  4JKG A;  3CCJ N;  3WEE A;  1NK6 A;  4IKF A;  3ITH A;  1ZYQ A;  4F2S A;  1FKO A;  1EO1 A;  5KI6 A;  4QCL A;  3L8B A;  3SMS A;  1KAX A;  2WC9 A;  1MWK A;  4H5T A;  4BRP A;  3AGK A;  3KK1 A;  4KHP K;  4GNI A;  4KI4 A;  3CFR A;  4DSJ A;  3EN9 A;  4BVP A;  2ZE2 A;  4H0V B;  4JI4 K;  1NGA A;  4J8F A;  3H45 C;  4BRF A;  3AVN A;  4CF1 A;  5HL7 L;  2VQE K;  1GLL O;  4PWD A;  5E84 A;  4DTJ A;  1YTU A;  5AFU H;  4NXM K;  1EWR A;  3A0I X;  4IXC A;  3G10 A;  4CEB A;  4DSL A;  3VQ5 A;  5FPE A;  4HTU A;  4IOX A;  1T8E A;  2QWL A;  3SMP A;  4KHS A;  5BRE A;  3S3M A;  4FJ8 A;  4JI7 K;  1NKE A;  3C7N A;  2AJQ A;  3ENO A;  2ZF5 O;  2A40 A;  1CZB A;  5CY4 A;  4FL9 A;  3O9T A;  4GMJ B;  2Q0U A;  4CFA A;  1U45 A;  1ASV A;  2GV9 A;  1Q82 O;  4JKH A;  5M1O A;  5C42 A;  2Q0R A;  3KWG A;  3ZYY X;  4CEA A;  1MU2 A;  1S3X A;  3HI0 A;  3WXM B;  4OGE A;  1EP4 A;  4EZ6 A;  3ZET B;  1BA0 A;  4DSK A;  2B5J A;  2PFU A;  1NOZ A;  4WFN L;  3EL2 A;  4NCB A;  1LCU A;  4I6M B;  1NNE A;  2AA4 A;  5AQO A;  3LP3 A;  3LDL A;  4E7L A;  2HND A;  3AVA A;  4J2D A;  4BRM A;  2UUA K;  1NMN A;  3AAP A;  3AVB A;  4IG0 A;  4O4G A;  5ADX A;  2P9S A;  2P9U B;  1YXQ A;  3FLC O;  4M42 A;  5J2Q A;  2YHA A;  1X3N A;  3I55 N;  1JXB A;  5CR4 A;  1CXQ A;  2UYT A;  5AQU A;  3MEG A;  1KCF A;  4WQ5 A;  3IS9 A;  4MO5 A;  4W5Q A;  4JRQ A;  3V81 A;  3IKM A;  4OGC A;  1I39 A;  2Q97 A;  4CHZ A;  1GLC G;  2FBV A;  4FLY A;  3DLE A;  5GAD P;  3KK3 A;  3L4I A;  3U6F A;  1JKH A;  4JLH A;  4CVN E;  1VSM A;  1NKB A;  4LH5 A;  4CJU A;  2VCP A;  2XY6 A;  1K9M O;  4DTO A;  1XMO K;  2DPN A;  3P4I A;  3BDP A;  3AVM A;  2UUB K;  3AV9 A;  4O55 A;  1TK8 A;  3VTI A;  4Z4C A;  1HYS A;  4CHY A;  4R5P A;  3RMB A;  2G8F A;  3Q7C A;  2GTD A;  1KSP A;  2HBL A;  1QVF M;  1BL3 A;  1HNW K;  4LF4 K;  3U4L A;  2QTD A;  1P90 A;  3RR7 A;  1Q7Y O;  1RT6 A;  4JI1 K;  3ZEU A;  3WUH A;  3QIN A;  5CYQ A;  3UKU B;  3QB0 A;  2XO7 A;  5SWM A;  3E01 A;  1WSJ A;  2KFN A; 
#chains in the Genus database with same CATH homology
 3GL1 A;  3O08 A;  2F9T A;  4FWO A;  2ASM A;  3H6E A;  4LC9 B;  5GAE P;  2GEL A;  3HOT A;  1NGB A;  2BH1 A;  3KZB A;  2NZT A;  4NO7 A;  4CZE A;  4GVE A;  4PKH A;  4AM6 A;  3C0B A;  1VQP N;  4BRE A;  3TSP A;  3M3Z A;  3FZL A;  3CQY A;  3FZF A;  2Q2R A;  3C65 A;  3GBT A;  4Z94 A;  1T44 A;  2P9N B;  2A42 A;  5ADX H;  5F1X A;  4YOW A;  4PKG A;  3FFK B;  4FWK A;  4MO4 A;  1QHA A;  4YDU C;  4FOE A;  2KKZ A;  2PAV A;  2FSK A;  1HLU A;  2HST A;  2QW9 A;  3CJA A;  1X9J A;  4JK9 A;  3CCR N;  3TSQ A;  3K9K A;  3UE5 A;  4MLE A;  4CZM A;  2QA4 N;  2HMP A;  4ILJ A;  4GV6 A;  3L6Q A;  3VEW A;  5B8H A;  4ISE A;  2QXL A;  3H1Q A;  1YAG A;  3IFR A;  3EO3 A;  3WXI A;  1T6C A;  3WXK A;  1DT9 A;  2D0P A;  2IIR A;  4XH5 A;  4BRK A;  3F2K A;  3P31 A;  4BG9 A;  5C12 A;  1K8K B;  3ZX3 A;  4A61 A;  1GLE G;  4BRQ A;  5TKY A;  3DAW A;  4JK7 A;  4M63 C;  5BRF A;  5EXW A;  3ULE A;  1QQN A;  4FWR A;  2P9P B;  3LDQ A;  1JCG A;  5HOO A;  1Y64 A;  5BN9 A;  4K41 A;  4CBU A;  3CJC A;  1WUA A;  2HF4 A;  3DXM A;  3CD6 N;  3D2E B;  4JEP A;  4A2B A;  4DKW A;  1E4G T;  1EQY A;  2QWQ A;  1V4T A;  2Q1N A;  3FR0 A;  4H5N A;  2ZJR L;  1YJW N;  1OVY A;  3VEV A;  1V4S A;  2P9L A;  1J6Z A;  3BEX A;  5BPL A;  1YHQ N;  4B1V A;  2QM1 A;  1NJI O;  3HM8 A;  4BR4 A;  3HRG A;  1GLF O;  4BR5 A;  4EAH D;  1NGJ A;  3LM2 A;  2VYP A;  4KH6 A;  3CCS N;  3UKU A;  3D2F A;  1YIJ N;  1ZBS A;  3VET A;  4AF1 A;  3RSE B;  3E66 A;  4WYB A;  2YHY A;  1TUY A;  1KQS M;  4EFH A;  4A2A A;  3O6W A;  1TUU A;  4IEI A;  4DCH A;  3GDQ A;  3OBY A;  5H1S Q;  1JJ2 M;  3CCL N;  4CI6 A;  2E88 A;  2V52 B;  3R3L A;  4H0P A;  4IZ9 A;  3QFU A;  3T7Z A;  1VQ7 N;  4JAX A;  5AQT A;  2CGK A;  4IOA L;  3SK3 A;  4NLB A;  4BRH A;  5BPN A;  5JIC A;  2IVO A;  3AAR A;  3CPE A;  3R9P A;  4GY2 B;  2NNW A;  4C1N K;  1BUP A;  3TPQ A;  4CZI A;  1KXP A;  3GG4 A;  1U2V B;  5F2R A;  4U67 L;  2P9N A;  2OTJ N;  2E8A A;  5JMV A;  3VOV A;  3OA9 A;  5EOY A;  3ENB A;  2NRV A;  3E9P A;  5AQY A;  3DXK B;  4L3Q A;  5AQV A;  2V51 B;  1RDW X;  4E1J A;  3CMA N;  3L0Q A;  1U6Z A;  4FWL A;  1SS6 A;  5I9E B;  4RWT A;  1VQ9 N;  2Q31 A;  3H46 O;  4BRO A;  4BRD A;  3MX5 A;  4QS9 A;  1Z05 A;  3M5R A;  4FSV A;  3WQT A;  4PL7 A;  4BRN A;  3CIP A;  1Q81 O;  1HKG A;  3G4S N;  2H3G X;  5AQW A;  4A5A A;  3HZ6 A;  2FF6 A;  4FWP A;  4ISF A;  4CZK A;  3U9Z A;  3UKR B;  4H0X B;  1K8K A;  4DB3 A;  4YOT A;  5EX5 A;  2GEM A;  4H0Y B;  3W3D A;  5C0Y A;  3PIP L;  3C7N B;  3MK6 A;  4FWN A;  4HTL A;  3CME N;  3LM9 A;  3DWL A;  2P9P A;  3K9J A;  3MMV A;  3R8E A;  3ZX0 A;  3CJB A;  3VMF B;  2VWB A;  3MCA B;  3U9D A;  1W97 L;  2D1K A;  4YOX A;  3CF5 L;  5AQG A;  2J4R A;  1K8A O;  1NWK A;  1E4F T;  5AZI B;  3SJH A;  3D2E A;  3OW2 M;  1ESV A;  2D4W A;  2QWN A;  4GV3 A;  4BR0 A;  1T6D A;  5AQH A;  2NRH A;  3SLC A;  4CZF A;  5GIO A;  2KLA A;  3N4Q A;  3NMU A;  1VQM N;  4XH1 A;  1VAZ A;  4JKE A;  4EHU A;  4IO9 L;  1NGF A;  2GX9 A;  3S41 A;  3I8B A;  3RSE A;  4WQ4 C;  2ZJP L;  3DLL L;  4FPB A;  4KBO A;  1ZXO A;  4B1U B;  4O5F A;  5BN8 A;  1HX1 A;  1NGH A;  1JCE A;  4B1Z A;  4BVO A;  4IFE A;  1YJ9 N;  2QWM A;  4NB4 A;  4FWM A;  2YX6 A;  1Q18 A;  4RCH A;  5AZJ B;  4BRI A;  1KC8 O;  3IMX A;  3ZX2 A;  2JWL A;  4BRG A;  3A5L C;  5C2F A;  4BC4 A;  5KQ8 A;  3WXL A;  4H03 B;  4B1X B;  5AQQ A;  4CBW A;  4CZL A;  1U2V A;  1YVN A;  1W2B M;  3BP8 A;  3O9R A;  3JXU A;  3VGL A;  2HF3 A;  3DXK A;  2E2Q A;  1HPM A;  1KAZ A;  2A5X A;  2FSN A;  1IJJ A;  4CJ7 A;  2YHX A;  3DJC A;  4PL8 A;  1R59 O;  1YUW A;  3O1B A;  5LY3 A;  2F9W A;  4YOU A;  1G99 A;  2NRW A;  3D7E O;  4H5R A;  4IO8 A;  3MDQ A;  3GOI A;  2A3Z A;  3UKR A;  3KHY A;  1BU6 O;  5TKW A;  4WF9 L;  3A5N C;  1ATN A;  4RTF D;  4FWQ A;  3O8M A;  2ZGZ A;  2NRZ A;  3AAQ A;  3M1F A;  3FE1 A;  4BQZ A;  2F7T A;  2FXU A;  4FVU A;  1GLA G;  3VEO A;  2P9K B;  2WBN A;  5AQR A;  2WUS A;  2GUP A;  3A8Y A;  3ID6 A;  3TTD A;  3VER A;  5AQJ A;  4AM7 A;  5AZI A;  4M7X A;  4BRL A;  1JCF A;  1C0G A;  3MX2 A;  2W40 A;  5AQN A;  4BC2 A;  5M1Q A;  5M1P A;  1Q86 O;  2VGN A;  4CBX A;  4G9Z A;  3LDN A;  3U8X A;  5AQX A;  1P8Z A;  2HBJ A;  4K43 A;  1LOT B;  3LL3 A;  4JKG B;  5DM7 L;  5FPD A;  1M1K O;  4BC3 A;  2QWR A;  3WEE B;  3NVM A;  3QBW A;  4EIA A;  4EHT A;  2VGM A;  3D6R A;  5CHI A;  5AFU A;  2ASP A;  1X3M A;  5ELZ A;  4CZG A;  1ZC6 A;  3PIO L;  1ATS A;  3B8A X;  5AZJ A;  1MDU B;  1WOQ A;  1VQK N;  4JHD B;  2ITM A;  2RE2 A;  3KWI A;  4PHT X;  5M1N A;  3I33 A;  3J8A A;  5KQD A;  2E2O A;  2HBM A;  4BC5 A;  3BF3 A;  1NGI A;  5DM6 L;  1QZ6 A;  1BWF O;  4C1N I;  3HBT A;  5AQK A;  1GLB G;  3ATU A;  3EZW A;  4IJA A;  1QZ5 A;  2OAN A;  3KK7 A;  1YJN N;  4ISG A;  3F5T A;  3MCP A;  4MLH A;  5MLC Q;  3TSU A;  5JLF A;  3MN5 A;  4BG8 A;  4YOY A;  3CXC M;  3FGU A;  3QFP A;  2CGL A;  2OTL N;  1GLD G;  3H3N O;  1KD1 O;  3CHW A;  1O13 A;  3G6E N;  5JVH L;  5LJW A;  1NGE A;  3O5B A;  1NMD A;  4PKI A;  5BRH A;  5GAG P;  3VF4 A;  3JS6 A;  4YOR A;  3CER A;  3ATV A;  1IG8 A;  1D4X A;  3H3O B;  4A5B A;  4O8U A;  2W41 A;  2IVN A;  4BGA A;  2AP1 A;  3E9L A;  3CPW M;  4JNE A;  1MA9 B;  1C0F A;  1TYQ B;  3VEY A;  4XEI A;  3IDH A;  4GV9 A;  4IDH A;  2P9K A;  3CJ7 A;  4JD2 B;  3CCE N;  4BR2 A;  1N8R O;  1VQN N;  3FZM A;  2P9I B;  2V7Z A;  3VGM A;  3EKS A;  4OPA A;  4NLC A;  1XUP O;  3OHR A;  2NLX A;  4ILH A;  3MWT A;  4H0O A;  3AY9 A;  2KHO A;  1QQM A;  1HUX A;  4YDU A;  4BQL A;  5EY4 A;  4JKD A;  4B1W B;  1VQ5 N;  2ASO A;  1NGC A;  2FLO A;  5BRD A;  3WQU A;  4JKG A;  4WQ5 C;  3SAG A;  4BR7 A;  3G71 N;  4UY8 O;  4BR9 A;  2NRR A;  3CCJ N;  2JWK A;  3NVK A;  4IEE A;  4H5V A;  3TTF A;  3WEE A;  3VEN A;  3LDO A;  4KH5 A;  2GWK A;  5M1F A;  2YJF A;  2D0O A;  2E2N A;  3VGK A;  1NM1 A;  1EO1 A;  3PLA A;  1NGG A;  3SMS A;  1KAX A;  2WC9 A;  4C23 A;  1MWK A;  4H5T A;  4BRP A;  3AGK A;  4IJN A;  1KAY A;  2QWO A;  3KVG A;  4OPH A;  4GNI A;  1MWM A;  5AQZ A;  3O9S A;  4JHD A;  1VQO N;  2CH5 A;  3O9U A;  3EN9 A;  3SAF A;  3CC2 N;  4JKB A;  3CI5 A;  1NGD A;  3AGR A;  4BVP A;  3VF6 A;  5GIP A;  3CCV N;  1BA1 A;  3CJ1 A;  4H0V B;  2A6A A;  2FSJ A;  1NGA A;  4J8F A;  4H5W A;  3H45 C;  4BRF A;  5HL7 L;  1K73 O;  1GLL O;  2P9S B;  1VQ6 N;  5E84 A;  1RGI A;  1T3V A;  3G25 A;  4FOI A;  5AFU H;  4A59 A;  4A57 A;  2E20 A;  3R1X A;  1DKG D;  3VES A;  3A0I X;  4HWI A;  4ILG B;  1QVG M;  3VTH A;  4IXC A;  3VEX A;  3SAH A;  4MDA A;  5KPZ A;  4CD1 A;  3TU5 A;  5AQS A;  5FPE A;  4K42 A;  4IOX A;  2QWL A;  3N4P A;  4F9O A;  3SMP A;  5LJV A;  3A5M C;  2RHK A;  5BRE A;  5JVG L;  2QWP A;  3C7N A;  5M1K A;  3ENO A;  3HTV A;  4B1Y B;  3FZK A;  1TYQ A;  2ZF5 O;  4WFA L;  3E1Y A;  2A40 A;  4FL9 A;  3ID8 A;  4BRC A;  3O9T A;  2Q0U A;  3VPZ A;  4JD2 A;  5F0X A;  4CZH A;  1S22 A;  4O8K A;  2P9I A;  4KH4 A;  2YCH A;  1Q82 O;  4JKH A;  5M1O A;  4DHY A;  2Q0R A;  3KWG A;  2NRT A;  3L4Q A;  3VF2 A;  5AQF A;  2IVP A;  3ZYY X;  4OO1 J;  1S3X A;  3HI0 A;  3WXM B;  5AQP A;  3TTC A;  5GIN A;  3CC7 N;  1XC3 A;  2YI1 A;  3MWP A;  4JK8 A;  3ZET B;  1BA0 A;  4M7Y A;  2PFU A;  1XQS C;  4IWV A;  4WFN L;  3EKU A;  1RDU A;  3EL2 A;  1HKC A;  1LCU A;  4U7B A;  4I6M B;  3QML A;  3C6A A;  2AA4 A;  5AQO A;  2HOE A;  3LDL A;  2WFB A;  4FO0 A;  2FF3 B;  1S72 N;  3C6H A;  1OKJ A;  2GWJ A;  5CE3 A;  3HSC A;  4BRM A;  1Z6R A;  3ZEU B;  2PBD A;  4B9Q A;  3EE8 A;  1NBW A;  5KPR A;  4YOV A;  3AAP A;  4R79 A;  2HBK A;  3BF1 A;  3P39 A;  4JN4 A;  3E9O A;  1RFQ A;  1DGK N;  2P9S A;  2P9U B;  5FPM A;  5ADX A;  1BDG A;  1YXQ A;  3FLC O;  2ZGY A;  3QDK A;  2I7N A;  3H1V X;  1HKB A;  3QBX A;  5AQL A;  5JLH A;  3HOS A;  1X3N A;  4JKC A;  4CD3 A;  4JKA A;  2Q36 A;  5EVZ A;  3I55 N;  3IUC A;  5CR4 A;  2UYT A;  5AQU A;  3SBG A;  1YIT N;  3GE1 A;  5AR0 A;  4CZJ A;  3SBT A;  2ZJQ L;  1QQO A;  2BTF A;  3W0L A;  4WQ5 A;  1NLV A;  1ATR A;  4MO5 A;  3MN7 A;  3A5O C;  2V7Y A;  5AQI A;  3VEZ A;  3WXJ A;  4WQ4 A;  5E26 A;  3IKM A;  4K25 A;  2Q97 A;  3P38 A;  4FPA A;  3MN9 A;  3EE9 A;  4IOC L;  2QI2 A;  1VQ4 N;  1GLC G;  4A62 A;  1ILY A;  2A41 A;  3CCU N;  3F9M A;  2ZWH A;  4BRA A;  4Y0W A;  5GAD P;  1YI2 N;  3L4I A;  3CCM N;  4QS7 A;  3CJ9 A;  3I56 N;  4BGB A;  5FPN A;  3RVC A;  2BUP A;  1H1V A;  3LDP A;  4WFB L;  3Q7B A;  1BOT O;  1CZA N;  2VCP A;  1DEJ A;  3O1W A;  4QS8 A;  3BUZ B;  1K9M O;  1SZ2 A;  3FZH A;  2DPN A;  1M90 O;  3CET A;  3P4I A;  2QEX N;  3OBW A;  3J7Z O;  5C15 A;  3ULE B;  1YF5 L;  3ZET A;  1VQ8 N;  2E2P A;  2YJE A;  3VTI A;  1SQK A;  5BR9 A;  1VQL N;  4DQ8 A;  3O80 A;  3T69 A;  3CC4 N;  2E1Y A;  3Q7C A;  4WCE L;  2CGJ A;  2GTD A;  5BPM A;  4H0T B;  5C10 A;  3QIC A;  2HBL A;  4FWS A;  1QVF M;  2CH6 A;  3DXM B;  1SAZ A;  4I6M A;  3ENH A;  1GLJ O;  4JKF A;  2E1Z A;  3M6G A;  3WT0 A;  3U4L A;  3O4W A;  5AQM A;  2QTD A;  3R6M A;  2P9L B;  4XH4 A;  1BO5 O;  1P90 A;  3O9Q A;  1Q7Y O;  5C2D A;  2NRX A;  3ZEU A;  2EWS A;  3UB5 A;  3MN6 A;  3WUH A;  1HJO A;  2I7P A;  4BY9 C;  3UKU B;  3D2F B;  2YHW A;  5GAH P;  3QB0 A;  4MDB A;  3CCQ N;  5KPT A;  3CQX A;  2P9U A;  1BG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...