4G9ZA

Lassa nucleoprotein with dsrna reveals novel mechanism for immune suppression
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
205
Chain Sequence
b'AMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSTPRVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(P*GP*CP*CP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Viral protein/rna
total genus 55
structure length 205
sequence length 213
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4g9zA01
3MX5A 3MWPA 4GVEA 4FVUA 4GV3A 3Q7BA 3MX2A 4GV9A 3MWTA 4GV6A 4G9ZA 3Q7CA 3R3LA
chains in the Genus database with same CATH superfamily
1SKRA 3HPOA 4DQIA 3OYNA 3HM9A 4BR4A 4CJLA 3TI0A 4F8RA 2VWJA 5AZIA 1J53A 3M8PA 4CD3A 2Y1JA 4ISEA 1SL2A 4DV0K 4MLEA 3RSEB 2GWJA 1DGKN 3NH2A 3D2EA 2RE2A 4EZ9A 4OLAA 2A1RA 3KWGA 3DXMA 4W5RA 5BPNA 2HHWA 1BI4B 1VSIA 4IOCL 2H3GX 3K9JA 4K42A 4OKKA 2V52B 2ASOA 1BQNA 1XC3A 4KPYA 4I9QA 2PFUA 5LMNK 4FZYA 1VQ7N 3QBXA 4IFVA 2HHQA 3KK3A 2KFNA 2O8EB 1W2BM 1C0GA 3NGYA 1NKBA 1IBMK 1LOTB 3A5MC 3F5TA 5AQVA 4FLTA 5GAHP 1S6QA 3BF3A 1TAUA 3VEWA 4BC2A 1QQOA 4B08A 3KK2A 1Z25A 1UOCA 4RG8A 3ZT2A 4GV9A 3LALA 3OYAA 2HHHK 4CEAA 4CZMA 4N56A 4BE2A 1SL0A 2HOEA 4IBNA 3VQ8A 3O9QA 1J6ZA 1JLCA 4BC4A 4CW7B 3HL8A 2QWQA 4RW7A 5KRTA 4Q5VA 2ATQA 2YHWA 4BRFA 2JGUA 4B8AB 5E41A 4BC5A 1V4TA 4Z4HA 1BQMA 1LWEA 4FOIA 3NCIA 1X9JA 4KFBA 3H1VX 3CC2N 4WQ4A 4Y1CA 2YX6A 1HLUA 1GOAA 4FJKA 4LD0A 3O4QA 2W40A 3AO2A 4DMNA 4CF0A 2O8BB 1O1WA 3PUFA 3PY8A 4DTUA 3CQYA 1KTQA 5AQRA 4IDKA 2D0CA 4BRAA 3MX5A 1HYSA 3KVGA 4CFAA 1WSGA 4JEPA 3CHWA 4CIFA 2NNWA 1NOYA 2P9NB 3UB5A 1FXXA 2WUSA 1KVCA 4IFYA 1ASVA 1BUPA 1S1TA 4OPHA 4AHSA 3SAGA 4B3OA 1RT6A 4FJJA 4OPJA 2R7YA 1ZYQA 3P4IA 1SS6A 3THYA 2V7ZA 1IJJA 3OS0A 3D2EB 4B1VA 1TL1A 2VQEK 3M8RA 1X1PA 1E3MA 4HUFA 3B6PA 3DXMB 3EKUA 2O8FB 4Y0WA 1NK8A 3QICA 3EN9A 1D4XA 3KLIA 1JLBA 4CK2A 3HSTB 2X6SA 3LZIA 4WFAL 2ZGZA 3KWIA 2VQFK 4B9SA 2PYLA 1OH6A 3QB0A 3SPZA 2BGGA 4L3QA 4IKFA 5SWMA 4DV4K 5AQKA 3KD1E 4YORA 1FKPA 4CJ5A 1BISA 5BPMA 4AHUA 3T1YK 4DU3A 1X9WA 3KIOA 4PWDA 4M7XA 5M1QA 4CJVA 3AGKA 1RT5A 1IBKK 5AQNA 3CCLN 5M1FA 4WFBL 3P5JA 4B3MK 3BEXA 4YOYA 4BR2A 4KREA 3CCMN 4LSNA 2YHAA 1S1XA 3HOSA 4PQUA 4F3OA 3GE1A 5DK5A 4QCLA 4JN4A 4DFKA 3U3YA 1Q9YA 3KKSA 4BQZA 3HVTA 4FW1A 3LP1A 3IUCA 2CGKA 5B8HA 3CFPA 3WQTA 1NNEA 1MWMA 2HVHA 2F4VK 4MDAA 4DV7K 4O55A 1TK5A 3UKUB 5BRFA 1C0UA 1NGBA 3VTIA 3C95A 4CGIA 3MCPA 2P9UA 4GNIA 2IGIA 4KBOA 2BANA 2F9TA 1U47A 3CPEA 4DS5A 3MMVA 1DTQA 4FJ7A 3FFIA 3IRXA 1NGDA 3O4WA 4KTWA 3ULDA 4DU4A 3THWA 4BR0A 3TTCA 4X62K 2E5LK 4JAXA 4DTOA 1QS4A 1XQSC 3LDQA 4IXCA 4JKFA 1D9DA 4B1UB 3TSUA 5M1PA 2QWNA 2YHBA 3K9KA 4CHQA 4OO1J 2HMIA 3V9ZA 4H4OA 3G6EN 3OYKA 4F2RA 4I6MB 3THYB 3AVHA 2QKKA 3THVA 2Y1IA 2RPIA 4WE1A 4E1NA 3I55N 4L8RB 1OH5A 1L3TA 5AR0A 3DXKA 3QO9A 1RFQA 3C6HA 2NUBA 3FZKA 1TYQB 4LF4K 4HHTA 4OKJA 1KQSM 3L2WA 3CYMA 3JXUA 4M3XA 3DWLA 4WYBA 2Q0UA 3C6TA 4JI6K 2O8DA 3ZSWA 2VG7A 4IJAA 5BN8A 4YY3K 3VF6A 3MECA 3ENHA 3WXLA 3RWUA 3IG1A 2XRIA 3ID6A 4OGCA 3DRRA 3RVCA 3U3GA 4JI2K 2UXBK 2FC0A 4BRGA 3MXIA 1Q86O 1EWQA 4YOVA 4LY7A 2BE2A 3ENOA 1VQMN 3ZT3A 3NH0A 4CK1A 1CZAN 3NVKA 1NLVA 1A5XA 4CVNE 4DQSA 5C15A 5EU7A 1VSFA 2A41A 3D2FA 1JKHA 3S3NA 2JLEA 3G0ZA 4QS7A 4FYDA 1KAXA 1KAZA 3HTVA 1QSLA 2B6AA 3RMBA 4IO8A 2P9PB 3RMAA 3CJAA 1XHZA 2F96A 1UA1A 3LPTA 4HWIA 4FWSA 4CF8A 1SQKA 3EZWA 4GMJB 3C0BA 2KTQA 2Z1JA 2HHTA 2P9LA 1W97L 2VG6A 5AZJB 3I8DA 1Q18A 1VSHA 1TVRA 3THWB 5GIPA 5EX5A 1TK8A 4H0OA 1HPZA 3LDOA 1GLEG 4B9QA 3BUZB 5C10A 2YJFA 4C8OA 3L2VA 3KK7A 3VEYA 4FLUA 3QEIA 3OYCA 3WXJA 3I56N 5HRPA 3U8XA 4B1WB 3N4QA 3NF9A 3O9RA 5FPNA 2F9WA 1D9FA 1SUQA 4WCEL 5AQMA 4JKGA 5ADXH 5AQWA 1M90O 3F2KA 3S3OA 3DXKB 3R8EA 4AF1A 3TTFA 3SQ0A 4BGAA 2IVPA 1RBUA 3BF1A 1Q7YO 4WQ5C 4MO4A 1CZBA 1SAZA 1LWCA 1VQ4N 4FVUA 3VF4A 1K8KA 3QDKA 3SCXA 3OW2M 2IIRA 2OCEA 1L5UA 4B1XB 3IMXA 2O8DB 1U48A 3MEGA 4M63C 5AQPA 1VSKA 3KLEA 3CJ9A 4BGBA 2V7YA 4FWRA 3DJCA 3FLCO 4H0TB 4KHSA 4YOUA 5EY4A 3HVRA 1BA1A 3ZX3A 3O08A 2BH1A 3FR0A 4FK0A 1C0MA 1RTDA 4J2EA 1VQ8N 4JKCA 3SYZA 3MN9A 4H4MA 1ESVA 1DLOA 3VQ9A 3ZX2A 3VETA 3H6EA 2O4GA 5F2RA 1IG9A 2PBDA 1EXQA 3ZSZA 4AHRA 3L0QA 1S6PA 4CFBA 1W0HA 3P31A 4CBXA 4CECA 3DLBA 1XMOK 1GLFO 4DUZK 5FDLA 3ZSYA 4FLYA 1KC8O 1N32K 1OVYA 4JI1K 2ITGA 4A57A 1QZ6A 3TAQA 4C8NA 1BCOA 2IVOA 4QAGA 4CJQA 4I7FA 5LL6Z 4E19A 1YTUA 3VESA 1ZC6A 2D0AA 4K41A 5A2QO 2NRXA 1W9HA 4BR5A 3OYIA 3E9PA 2YNHA 3RSEA 2A42A 4LH4A 4JI3K 3PIPL 3VOVA 3T3FA 3CMEN 4A61A 1WSFA 4I2PA 4PKIA 2OANA 3CCEN 2OPPA 1RDAA 2Q36A 2IDOA 3CCQN 1DEJA 3CPWM 4M7YA 3TSQA 3CCUN 4GKKK 1EWRA 1BIUA 4NB4A 1CZ9A 2D0PA 4QOZB 1TKZA 3ALYA 3DMJA 1IV0A 3OYGA 2ETJA 2JWLA 4A62A 2O8EA 1VQON 2VWKA 4W5NA 5HBMA 3VGMA 3R1XA 5K14A 4ELVA 5AQLA 4DTPA 2KQ2A 5SZTA 3HI0A 4H5WA 3H46O 3M1FA 3OYFA 1NK6A 2HHUA 4BE0A 5KPTA 2G8IA 1EKEA 4FK2A 4B3SK 1CXQA 1HKBA 1VRUA 4CF1A 4KB1A 1GLAG 3WUHA 3AO5A 3BGRA 1N36K 2HVIA 2GTDA 1ILYA 1YITN 2E20A 3DLEA 3AO4A 3VQ7A 2GX9A 4RW6A 3U4LA 3AVGA 2NLXA 4MFBA 2EX3A 2Q97A 4CZGA 1L3UA 3CFOA 5HL7L 3H45C 1VQ5N 3ZT0A 4YFUA 3V9WA 3AVAA 4BWJA 3L2RA 1A5WA 4KKOA 1RDCA 3KJVA 1SV5A 4E89A 5LY3A 3AAPA 1QQNA 1KLNA 1FW6A 3N4PA 3PSFA 5AQYA 1NK5A 1WSIA 1Q81O 1NGIA 2ZJPL 3MAQA 4LF7K 1HQEA 4HCBA 3HK2A 2KLAA 4HCCA 4IWVA 3PX0A 3VF2A 3QNNA 2ZJRL 4K8XA 3O3GA 5F1XA 1L3SA 2P9NA 4V19S 3DOLA 1CXUA 1Z6RA 1B9FA 4OVLA 4E7JA 3SAFA 4H5TA 5MLCQ 4DFPA 3Q7BA 5HOOA 2FBYA 2VYPA 3ZEUB 4EAHD 1TAQA 1GLBG 3K58A 3A5NC 3RMDA 3F9KA 2KZMA 1QSYA 4C8LA 4BDPA 2O8FA 4FO0A 2P9SA 3WNFA 2P5OA 4IJNA 1P90A 1JL1A 5GIOA 5IWAK 1QHTA 3DLRA 4RW4A 4Z4IA 1BL3A 1RBVA 5JS2A 3VPZA 4X66K 5ADXA 1DKGD 5JS1A 3I33A 1J54A 3IAYA 2IS3A 1WSHA 1IKWA 3NF8A 4ICLA 2UUBK 4PL8A 3DLKA 3E9LA 3EO3A 1BG3A 5CYQA 1LWFA 4CZFA 2AJQA 2IOCA 4O0JA 5BR8K 3C7NA 1NJZA 1TKXA 2W41A 1BCMA 1SKSA 1JLQA 1K6YA 3GL1A 3TAEA 1WSEA 3ASMA 4FJXA 4ILGB 1JLEA 4AHVA 4I2QA 3CJBA 5FPEA 4JLHA 1YF5L 4N41A 3NDKA 1ZBSA 3AVKA 4BVOA 1K9MO 4CJSA 5KPZA 1K73O 1NGFA 4EZ6A 1SZ2A 4BRIA 5GINA 3LL3A 4M45A 2E2NA 2JWKA 1J5EK 2UU9K 5I9EB 1HMVA 4MO5A 1MU2A 4FPAA 3LM9A 3SQ1A 1G99A 1YJNN 4JKDA 3UKUA 2QWRA 4DQRA 1V4SA 3L8BA 4IG0A 3A2FA 1RT2A 4G9ZA 2Z1GA 4UY8O 4I9LA 1RT1A 4CFCA 2OA8A 1NJIO 1T6CA 2YJEA 4WQ5A 4DV5K 3O6WA 4F4KA 1VRTA 4Z4FA 1OKJA 2E4LA 4LFAK 5KGWA 3E01A 2PYJA 2O4IA 1ASUA 2UYTA 4DTMA 4B9VA 1S1VA 1KVAA 3MXMA 4K25A 3FFKB 1RDWX 4CZIA 3GDQA 3AAQA 3MEEA 4I6MA 3SZ2A 4M3UA 3M5RA 4JKBA 5AQSA 2I7PA 3EYZA 3D7EO 3W0LA 4HUEA 2P9SB 3LAKA 4DLGA 4HTLA 4DLEA 4FLXA 4E7HA 1TYQA 4CD1A 2KKZA 5C2FA 3K59A 3EZ5A 4B9MA 3G25A 1SKWA 1NOZA 1RT7A 1HYZA 1UWBA 3L3VA 2UUAK 3H3OB 3HYFA 5GAEP 4CBUA 3AY9A 3WQUA 5J2QA 2YHXA 2QTDA 3FE1A 4FJLA 3GG4A 3C7NB 4QS9A 3ZYYX 3LM2A 1ATNA 3PO4A 1OVQA 3HSCA 4J8FA 3G4SN 4CBWA 4DR2K 1Q9XA 3LDLA 4GV6A 4CJ7A 2ASMA 4JI4K 3OY9A 2OZSA 3O9UA 1YUWA 3MXJA 2YI1A 5AQUA 1KD1O 3VA0A 4FJMA 2GWKA 2ZWHA 2NZTA 4CJKA 2QKBA 1HYVA 4H0VB 4Z4GA 1ZBHA 4CEQA 4DTSA 1VK0A 3QEWA 3D6RA 3VMFB 2W6LA 1LW2A 1FJGK 1P8ZA 5F0XA 4X65K 3HBTA 1QVGM 1B9DA 1T05A 5I3UA 2P9PA 3H08A 4BRMA 3LP2A 4WF9L 2WTUA 4C23A 2GBZA 1HR0K 1KXPA 2ZF5O 3DYAA 5AZJA 1DT9A 3LPUA 1W7AA 1YVUA 3WXIA 2GELA 3HP9A 2HHSA 1RDBA 4N5SA 4R5PA 1OH7A 3MWPA 4BQLA 4YNQA 1GOBA 1NGCA 3OJUA 5C2DA 3TR8A 3TWHA 1NMNA 2CGLA 4BRLA 4DR1K 4YOXA 2QK9A 2DPNA 4KB0A 2I5JA 4KTQA 2HNZA 4DUYK 5C42A 1NWKA 1I3AA 4NCGA 1LW0A 4B1YB 3IS9A 1ZXOA 5EXWA 2QXFA 4JHDA 3TTDA 3AVLA 4KHWA 4CJ3A 2FBXA 4PL7A 4DTRA 1WUAA 1HNXK 1TUUA 1QQCA 3NHGA 4DR7K 4FVMA 1XNRK 1C1AA 3VQEA 5FLXO 3KZBA 3EE9A 5KQDA 2D0OA 1YAGA 5M1NA 4JI0K 3VQBA 1VSMA 3GBTA 5C24A 4AM6A 1BDGA 1VQKN 3O1WA 4CJFA 4DV3K 2IVNA 3MN6A 2O8CB 3I8BA 4DV1K 4DHYA 3P38A 3QETA 1Q82O 1UA0A 3CQ8A 2FSJA 3RTVA 3SV3A 4CHOA 2PY5A 3HT3A 4FXDA 3VEOA 4ELTA 1RTJA 1NJXA 3T1HK 3S3MA 2YHYA 3G10A 4BACA 2Q2RA 2GUIA 3DRSA 1Z05A 1K8AO 3ZSXA 3AA3A 4KHPK 1H1VA 4FW2A 3J7AP 2RN2A 3V1QA 5GADP 4DFMA 3OYHA 1J9AA 2I7NA 2NRRA 1VSEA 4EIAA 1YI2N 4BROA 3J7ZO 4CZKA 4NYNA 4O0IA 1JXEA 3CETA 3J7YP 3ZSOA 1XHXA 5CHIA 4M42A 2OZMA 3B6OA 4CIGA 3LP3A 2E2PA 4Z0UA 3CC7N 4FWMA 1T8EA 5KRSA 2CH6A 3TAFA 1UAXA 1VQ9N 3I0RA 3MN5A 4B1ZA 3QESA 3PX6A 1G15A 1YHQN 3PX4A 5TKYA 3WEEA 1BHLA 3QBWA 3L3UA 2OPRA 5AFUH 5BREA 1RT4A 1WNSA 1XC9A 4CGGA 3L6QA 4B9UA 1REVA 3ZETA 1GLJO 4FWNA 3QEXA 4K0KK 4JHDB 1E4FT 1VQLN 2KZZA 1RBSA 4DFJA 5JMVA 3ITHA 5HRRA 2P9IB 1S9EA 4DWIA 4H0XB 4K8ZA 2Z1IA 4IFEA 3VA3A 1NGEA 3BY5A 3RR8A 4LF9K 2DFFA 4CI6A 2ZGYA 4W5TA 3WNGA 1LAVA 4A5BA 4AM7A 1VQNN 3JAMO 3HZ6A 1U2VA 3E1YA 4W5OA 3L4QA 4E3SA 3V9XA 5KQ8A 1N34K 1VAZA 1HRHA 4OKEA 3QMLA 3BP8A 4CJ4A 2EWSA 2A40A 3OTOK 1HKGA 3T7ZA 3VQ6A 3VTHA 2ZD1A 3NMUA 2DFEA 3KK1A 4AHCA 4CEBA 5FPDA 3CJ7A 3FZFA 1IO2A 4FLWA 3SBTA 1TUYA 4RW9A 4NXMK 4CHZA 4MLHA 2E88A 4YDUC 4CFDA 1JJ2M 4FWOA 4A2BA 2X78A 3CJ1A 2HF4A 4KAZA 5AQIA 1IBLK 2A6AA 3AA2A 4O4GA 4O8KA 3ZSRA 4FJIA 3VN5A 3ZT1A 4GV3A 4CEFA 3LWLA 4IEIA 5FRMA 2D0BA 3WXMB 3OYMA 1KCFA 1NGHA 3R9PA 5JVGL 4C1NI 3HXMA 2IC3A 5AQOA 3A5OC 4NLCA 3QERA 4CJTA 4YHHK 2J4RA 2KFZA 3WEEB 4F9OA 3QNOA 3TAGA 5AQGA 2VGMA 3VQ4A 3ZEUA 3CI5A 5C12A 4JS4A 1WBBA 2F8SA 3ZETB 1VQ6N 2XY7A 4H0YB 3HPHA 3QEPA 1RNHA 4GY2B 3TSPA 3J80O 4ZHRA 3NH1A 4FJNA 1BA0A 3ZT4A 4DS4A 4PHTX 5BRHA 5BRDA 5HLFA 2QI2A 3W3DA 4CZLA 4FWQA 3T19A 1QVFM 3KLFA 1S5JA 1MA9B 1S3XA 1JL2A 4C8MA 2UXCK 2G8FA 3VENA 1EO1A 3CC4N 5KPRA 3DAWA 3K2PA 5JLFA 3CFRA 4HVJA 4E0DA 2XY5A 1XUPO 1U2VB 1YXQA 5GAGP 3SJHA 1S1UA 2Q0RA 3AVBA 2ZQBA 4IO9L 4IDHA 4CJUA 4BC3A 3V9SA 3SPYA 3JSMA 1J5OA 1C0FA 2HF3A 4KHYA 4E1JA 4FSVA 2XO7A 3EEQA 4IG3A 4BRNA 4B9TA 1JCEA 1JLAA 4DQPA 2BDPA 4BWMA 3TABA 3OS2A 4M3YA 3V1OA 3LAMA 3OYJA 4BDZA 2Q3SA 1NU0A 4EP5A 1EX4A 3UE5A 4DTNA 1FKOA 4DR5K 2E6MA 3SMSA 4FLZA 4EFHA 5CR4A 3ID8A 1GLCG 4DSLA 4J2AA 4HTUA 4ELUA 3KLGA 3EE8A 4CHPA 2QW9A 2DTUA 3C94A 4BRPA 1S9GA 1HX1A 4MDBA 1CLQA 4XIUA 5C0YA 2AA4A 4DV2K 3SUNA 3LDPA 3AA5X 1HNIA 4JYAK 3HP6A 2XHBA 1C1CA 3HJFA 3A0IX 1HPMA 2HW3A 1NK0A 3VQQA 3PSIA 3NE6A 1BU6O 2X74A 2P1JA 1TV6A 2AP1A 4FL9A 1N8RO 2WONA 5BPLA 4BRQA 4CIEA 1YTAA 5HROA 3SQ4A 4B3TK 3M3ZA 2FF3B 5AFUA 4JV5K 3NBPA 3KD5E 3ULEA 3L2QA 1HNVA 1Y64A 3O80A 3C6AA 5CY4A 4M41A 2F7TA 5AQXA 4CEEA 5H1SQ 3SNNA 4ZTFA 3CCRN 1WLJA 1IKVA 1R59O 4DKWA 3RRGA 4U67L 4A2AA 3ATVA 2DY4A 3T1AA 4IOXA 4BREA 2RHKA 4QS8A 2B5JA 3D45A 3O9TA 1ZBLA 4GVEA 4DQ8A 3WXKA 5HRNA 1ITGA 1U04A 2BTFA 3LP0A 1QSSA 3CMAN 1LCUA 3AO3A 4A59A 4DSKA 4JKEA 3SUPA 3OS1A 2E1YA 4Z4EA 4FWPA 3K5LA 1KSPA 1S1WA 5HRSA 3AVJA 3Q7CA 4OJRA 4ILJA 4O44A 2HB5A 2NRHA 2NRTA 4FLVA 1BWFO 4FWLA 1HJRA 4RCHA 5J1EA 1GLLO 1M1KO 4H5VA 4JRQA 2HNYA 4CZJA 1QQMA 5LMUK 4TSXA 5J2MA 3U9ZA 3CF5L 4FPBA 4FM0A 4H8KA 4DB3A 3DLGA 3JYTA 2XY8A 4HUGA 1IKYA 3OBWA 4DR3K 1X3NA 3ATUA 3NAEA 3CD6N 3NF6A 5M1OA 3OYDA 3AA4A 3VQ5A 3DRPA 2PAVA 2ZE2A 1WOQA 2FBTA 1YVNA 3TPQA 3ZX0A 2HHVA 2IAJA 4BR9A 3VERA 5KTQA 2A5XA 3B8AX 4C1NK 1ZBUA 2HBJA 4CHNA 2OPSA 3UKRB 4LF8K 1N5YA 2YCHA 1XMQK 4NCBA 4LF5K 4BG8A 4AH9A 3OYBA 3THXB 4K43A 5AQJA 4CEOA 4DU1A 4N47A 2QXLA 4ISFA 2BUPA 1SL1A 1KVBA 3BDPA 3SV4A 5E84A 4PUOA 4LH5A 2HBKA 3ENBA 1VSLA 4KH5A 3VEZA 3M8QA 4NO7A 3JS6A 3ULEB 3K5MA 4LC9B 3NFAA 1C6VA 4BRDA 3G71N 3SMPA 1ZBFA 2WBNA 3H1QA 2OTLN 1NGJA 1QHAA 3MEDA 3OBYA 4XEIA 4H0PA 5AZIB 4YDUA 4JK7A 4CK3A 3U9DA 3QEVA 5AQFA 1N33K 4YOTA 2VCPA 5CE3A 3D0PA 2WC9A 3HM8A 5JICA 2V51B 4JD2A 3R3LA 2YNGA 4GVMA 3VQPA 3CCSN 4IOAL 3SUOA 3LWMA 3P83D 5AQZA 2O8CA 3C65A 1XI1A 1TL3A 3BZCA 3TU5A 3S41A 1Z26A 3O8MA 3EKSA 1NJYA 1NKCA 2CH5A 1DTTA 2ITMA 4RWTA 2XY6A 4NXNK 1HQUA 4DV6K 2E1ZA 2NRWA 1U49A 1BGXT 2NRZA 3RRHA 1NGAA 1T6DA 2CGJA 4CHYA 1NM1A 3O1BA 2EHGA 3HRGA 4CJRA 4JKHA 4U7BA 1NK9A 5DM6L 3L2UA 3A5LC 1KFSA 1HUXA 4YOWA 2G8UA 3RMCA 4B9LA 4J2DA 1HKCA 1BIZA 3AVNA 1NGGA 3AO1A 4FOEA 4XH1A 1NK4A 4GKJK 4ZTJA 3J8AA 2YKNA 1BOTO 1NG9A 1HJOA 1T3VA 2HSTA 5JLHA 1RCHA 3CQXA 3O4NA 1U45A 4N76A 4CESA 4CJPA 3IDHA 4CGDA 1JCGA 2YV0X 4PKHA 3CM6A 3MDQA 3VEXA 2OTJN 2VWBA 1XNQK 4BRHA 1JLFA 3SUQA 2RF2A 5E26A 3T69A 2FBVA 4Y1DA 3O3HA 3O3FA 1T7PA 4LF6K 3SI6A 2P51A 3P39A 4CZEA 3MWTA 3VEVA 1HNWK 3VQAA 1RTHA 4O8UA 1TK0A 1B92A 2PZSA 3OYLA 4OGEA 4RTFD 1RGIA 4BDYA 1JXBA 5T7BA 4BE1A 3DLHA 4DSEA 5I42A 1U4BA 4PY5A 2P9IA 3QIOA 2W6KA 3VGLA 1X9SA 4E7LA 1RTIA 1HNZK 4JI8K 3A8YA 1RBTA 4IZ9A 4XH4A 4FK4A 1JLGA 1WSJA 4JD2B 4CF2A 4W5QA 3L4IA 4EP4A 4DSFA 4KHNA 4J2BA 1BO5O 2ASPA 3QINA 2E2OA 3AARA 4PA1A 4CGFA 3V1RA 1IG8A 4AILC 3IKMA 4KHQA 2HMPA 2KHOA 3O5BA 3SLCA 3K5OA 1EETA 4PKGA 1S72N 4KHUA 4DF8A 3AVFA 4RW8A 5TKWA 1NJWA 3KTQA 1YT3A 5FRNA 3E66A 1I39A 1A5VA 3FZHA 4Z4CA 2E2QA 3VQCA 3OHRA 5CYMA 4C8KA 4CF9A 1R0AA 4FZXC 4OX9K 3IFRA 4DSIA 4H5NA 4NCAA 4CGJA 4KTZA 4NLBA 4JRPA 5LJVA 3TANA 4FCYA 2B4JA 1ATSA 3PIOL 3HO1A 4DCHA 4ILHA 1QZ5A 4GW6A 3ISNC 4KRFA 3RR7A 3QLHA 3WT0A 3NF7A 3HPGA 5DMRA 4BG9A 3E9OA 2HBLA 1IH7A 3FGUA 5IT9O 5FPMA 2FSKA 3PO5A 2UXDK 4JNEA 3TARA 4IEEA 3CXCM 4B3RK 3P1GA 5CZ2A 5LJWA 3CM5A 4G1QA 4JKAA 3FZMA 2P9KA 3V9UA 2HHXA 4FJ8A 4AHTA 1NKEA 4KI4A 3TAPA 1ATRA 4DR4K 2HNDA 3CG7A 1WB9A 4BRKA 1U6ZA 2P9UB 5KGXA 2QM1A 1EQYA 4FWKA 5J2PA 4F3TA 1Y97A 2G8HA 3ZSVA 4CERA 4XH5A 4Q0BA 5C25A 4B8CA 4ID5A 2A1SA 4OPAA 1S22A 2QWMA 2G8VA 1LAWA 1E4GT 3NVMA 4E7KA 1TKDA 4WQ4C 4CE9A 4EHUA 2QWOA 5EVZA 3AGRA 4M3ZA 2FLOA 1D5AA 4ID1A 1VQPN 1D8YA 3K57A 4KV8A 3OYEA 1ASWA 3I0SA 3CCVN 3NGZA 2F8TA 3QFPA 1TGOA 4CEZA 1X3MA 2QWLA 3LANA 3PLAA 2E8AA 3UIQA 4KI6A 4FZZA 2FXUA 3WNHA 4H5RA 3V4IA 4UQGA 5ELZA 1KFDA 1T44A 1LV5A 2Z1HA 4DQQA 2E6LA 3J81O 1MDUB 3V81A 4CGHA 3QFUA 3MX2A 1RBRA 1RDDA 5J2NA 2VG5A 3FZLA 1QE1A 4H03B 1OH8A 4M3RA 1O13A 2NRVA 2VGNA 5AJ3K 3K0SA 3OJSA 2OPQA 4KH4A 5DM7L 1TKTA 2WFBA 1VHXA 3CIPA 4FJHA 2QEXN 5HP1A 4CCHA 4FJ9A 1MWKA 3C6UA 3CCJN 3D2FB 4AQYK 3F9MA 4B9NA 2ZJQL 5BR9A 1WAFA 3HOTA 4O5FA 3H3NO 5FROA 3CJCA 1KAYA 3AVMA 3BZKA 1NBWA 3KLHA 1EP4A 5CZ1A 2P9KB 3VQDA 5M1KA 3PV8A 1N6QA 1NK7A 4JS5A 3LZJA 1ZBIA 2GV9A 4M3TA 3AVIA 3SQ2A 2FF6A 3V6DA 3ZLJA 4CEDA 4DSJA 2FSNA 3NGIA 1T03A 2P9LB 2RKIA 2WOMA 3OVNA 4E1MA 2ZM6K 4DTJA 1QTMA 5AQTA 1WBDA 3SBGA 2P5GA 1FK9A 4R79A 4DTXA 5EOYA 2GEMA 3M8SA 1JCFA 1GOCA 5AQHA 3R6MA 4MQ3A 2GUPA 3ZSQA 4JK9A 4BVPA 3M6GA 4FJGA 1C1BA 3WNEA 4LFBK 3F73A 4FM2A 1BI4A 4WFNL 1WAJA 4F2SA 2G8KA 3O9SA 4KH6A 4LSLA 3DLLL 4NYFA 3LDSA 1YJ9N 3LDNA 4JKGB 4Z94A 3SJJA 3MN7A 4DR6K 4JI7K 4BRCA 1YJWN 3DOKA 4LFCK 3AV9A 1I94K 1WN7A 3OA9A 2QWPA 3GOIA 3DI6A 5BN9A 1NMDA 3EY1A 1K8KB 2YKMA 2YNFA 1XWLA 2DFHA 5AQQA 4CJEA 2Q1NA 4CZHA 2LSNA 2G8WA 3KHYA 3AVCA 4OPKA 5D3GA 1RDUA 2D5RA 1KLMA 2KW4A 3VGKA 1RT3A 4JI5K 4CJWA 2QA4N 3U6FA 2D4WA 4BY9C 2Q31A 4ISGA 3TAMA 3S9HA 1RILA 4O5BA 4DF4A 5JVHL 2X6NA 4FJ5A 4BR7A 2UUCK 4X64K 3MCAB 3K5NA 1F21A 3UKRA 4M3WA 4KO0A 1C0TA 1VSDA 4DG1A 3DM2A 1L3VA 1VSJA 5KI6A 1IKXA 3THXA 2OYQA 2O8BA 4OLBA 1GLDG 2A3ZA 3CERA 1YIJN 2YNIA 2D1KA 3SK3A 3QIPA 3KKRA 4A5AA 4EHTA 1X9MA 2HBMA 3MK6A 4E7IA 4FM1A 3EL2A 3SAHA 2W42A 1Q8IA 3ZCMA 4JK8A 1KRPA
chains in the Genus database with same CATH topology
1K8AO 4BR4A 3O8MA 3P31A 4CBXA 3EKSA 1H1VA 5AZIA 2CH5A 2ITMA 4RWTA 4CD3A 5GADP 4ISEA 1GLFO 4MLEA 2E1ZA 3RSEB 2GWJA 1DGKN 2NRWA 1KC8O 1OVYA 2NRZA 2I7NA 4A57A 1QZ6A 2NRRA 2RE2A 1NGAA 3D2EA 4EIAA 1YI2N 1T6DA 4BROA 2CGJA 3KWGA 3DXMA 2IVOA 1NM1A 4CZKA 3J7ZO 5BPNA 3O1BA 3CETA 3HRGA 4IOCL 3VESA 1ZC6A 2H3GX 4K41A 4JKHA 4U7BA 2NRXA 3K9JA 4K42A 4BR5A 5DM6L 2V52B 5CHIA 2ASOA 3E9PA 3A5LC 3RSEA 1HUXA 2A42A 4YOWA 1XC3A 1HKCA 3PIPL 2E2PA 2PFUA 1NGGA 4FOEA 4XH1A 3VOVA 3CC7N 1VQ7N 4FWMA 3QBXA 3CMEN 4A61A 2CH6A 3J8AA 1VQ9N 1BOTO 3MN5A 1HJOA 4PKIA 2OANA 1T3VA 3CCEN 4B1ZA 2HSTA 1W2BM 2Q36A 1C0GA 5JLHA 1LOTB 3A5MC 3CCQN 3F5TA 1DEJA 5AQVA 3CPWM 4M7YA 1YHQN 3CQXA 3TSQA 5GAHP 3CCUN 3BF3A 5TKYA 3WEEA 3QBWA 3VEWA 4BC2A 1QQOA 5AFUH 4NB4A 5BREA 3IDHA 1JCGA 4GV9A 2D0PA 3L6QA 4PKHA 3ZETA 1GLJO 3MDQA 3VEXA 4CZMA 2JWLA 2VWBA 2HOEA 2OTJN 4FWNA 4A62A 1VQON 4JHDB 1E4FT 4BRHA 1VQLN 3VGMA 3O9QA 1J6ZA 3R1XA 4BC4A 5JMVA 5E26A 5AQLA 3T69A 2QWQA 2P9IB 2YHWA 3HI0A 4H0XB 4BRFA 4H5WA 3H46O 3M1FA 4BC5A 1V4TA 3P39A 4FOIA 4CZEA 3MWTA 3VEVA 1X9JA 5KPTA 4IFEA 3H1VX 3CC2N 4WQ4A 1NGEA 4O8UA 1HKBA 4CI6A 2ZGYA 2YX6A 1HLUA 4RTFD 1GLAG 3WUHA 4A5BA 4AM7A 1RGIA 1VQNN 3HZ6A 1U2VA 3E1YA 2GTDA 2P9IA 3L4QA 1ILYA 1YITN 2W40A 2E20A 3VGLA 5KQ8A 1VAZA 2GX9A 3U4LA 2NLXA 3QMLA 3BP8A 3A8YA 3CQYA 2EWSA 5AQRA 4IZ9A 2Q97A 4XH4A 4CZGA 2A40A 5HL7L 3H45C 1VQ5N 4BRAA 4JD2B 1HKGA 3MX5A 3T7ZA 3L4IA 3KVGA 3VTHA 4JEPA 1BO5O 3CHWA 2ASPA 2NNWA 2P9NB 3NMUA 2E2OA 3AARA 3UB5A 5LY3A 2WUSA 1IG8A 3AAPA 1QQNA 5FPDA 3CJ7A 3FZFA 3N4PA 3IKMA 5AQYA 2HMPA 1BUPA 1TUYA 2KHOA 3SBTA 3O5BA 4OPHA 3SLCA 4MLHA 2E88A 4YDUC 1JJ2M 4PKGA 1Q81O 1NGIA 4FWOA 3SAGA 2ZJPL 1S72N 4A2BA 2KLAA 3P4IA 4IWVA 1SS6A 2V7ZA 3VF2A 1IJJA 3D2EB 4B1VA 2ZJRL 5F1XA 5TKWA 3CJ1A 2HF4A 3DXMB 2P9NA 3E66A 3EKUA 5AQIA 3FZHA 1Z6RA 2A6AA 4O8KA 4Y0WA 3QICA 2E2QA 3EN9A 1D4XA 3SAFA 3OHRA 4H5TA 5MLCQ 4GV3A 3Q7BA 5HOOA 4WFAL 2ZGZA 3KWIA 4IEIA 2VYPA 3ZEUB 4EAHD 3WXMB 3IFRA 1GLBG 1NGHA 3QB0A 4H5NA 3R9PA 3A5NC 4NLBA 5LJVA 5JVGL 4C1NI 4L3QA 1ATSA 3PIOL 4FO0A 5AQKA 5AQOA 2P9SA 4YORA 4DCHA 4ILHA 1QZ5A 1P90A 3A5OC 4IJNA 4NLCA 5BPMA 5GIOA 4M7XA 3WT0A 4BG9A 2J4RA 5M1QA 3E9OA 2HBLA 3WEEB 4F9OA 3AGKA 3FGUA 5AQGA 2VGMA 3ZEUA 5AQNA 5FPMA 2FSKA 3CI5A 5C12A 4JNEA 3CCLN 5M1FA 4WFBL 3VPZA 3BEXA 5ADXA 4IEEA 4YOYA 3CXCM 4BR2A 1DKGD 3I33A 3ZETB 3CCMN 1VQ6N 5LJWA 3HOSA 4H0YB 4PL8A 4JKAA 3GE1A 3E9LA 3EO3A 2P9KA 3FZMA 4GY2B 1BG3A 3TSPA 4JN4A 1ATRA 4CZFA 1BA0A 4PHTX 5BRHA 5BRDA 4BQZA 2QI2A 3W3DA 4CZLA 4FWQA 1QVFM 3C7NA 4BRKA 1U6ZA 1MA9B 2P9UB 1S3XA 2W41A 1VQ8N 3GL1A 2QM1A 1EQYA 3IUCA 4FWKA 3VENA 2CGKA 1EO1A 3CC4N 5KPRA 4ILGB 5B8HA 3WQTA 1MWMA 3DAWA 4XH5A 5JLFA 4MDAA 3CJBA 5FPEA 1YF5L 1XUPO 1ZBSA 1U2VB 1YXQA 3UKUB 3SJHA 4BVOA 5GAGP 5BRFA 1K9MO 2Q0RA 4OPAA 4IO9L 4IDHA 1S22A 1NGBA 3VTIA 5KPZA 2QWMA 1K73O 1NGFA 4BC3A 3MCPA 1SZ2A 2P9UA 4GNIA 4BRIA 3LL3A 5GINA 4KBOA 1C0FA 1E4GT 2F9TA 3NVMA 3CPEA 2E2NA 2JWKA 3MMVA 4WQ4C 2HF3A 1NGDA 5I9EB 3O4WA 4MO5A 4EHUA 2QWOA 4E1JA 4FSVA 4FPAA 5EVZA 4BRNA 4BR0A 3LM9A 1JCEA 3TTCA 1G99A 3AGRA 4JAXA 4JKDA 1YJNN 2FLOA 3UKUA 1VQPN 2QWRA 1V4SA 1XQSC 4IXCA 3LDQA 4JKFA 4B1UB 3TSUA 4G9ZA 5M1PA 2QWNA 3CCVN 3K9KA 4OO1J 4UY8O 3QFPA 3UE5A 1X3MA 2QWLA 3G6EN 3PLAA 1NJIO 2E8AA 3SMSA 1T6CA 2YJEA 4WQ5A 3O6WA 4I6MB 5CR4A 4EFHA 3ID8A 1GLCG 2FXUA 3EE8A 4H5RA 2QW9A 5ELZA 1OKJA 1T44A 4BRPA 1HX1A 4MDBA 1MDUB 5C0YA 2AA4A 3I55N 3QFUA 2UYTA 3MX2A 3DXKA 5AR0A 1RFQA 3C6HA 3FZKA 4K25A 3FFKB 1RDWX 3FZLA 4CZIA 4H03B 1TYQB 3LDPA 3GDQA 3AAQA 1O13A 4I6MA 2NRVA 3M5RA 4JKBA 3A0IX 5AQSA 2VGNA 2I7PA 1KQSM 1HPMA 3D7EO 3JXUA 3W0LA 1BU6O 2P9SB 4KH4A 5DM7L 2AP1A 4FL9A 2WFBA 4HTLA 3DWLA 1N8RO 4WYBA 2Q0UA 3CIPA 5BPLA 2QEXN 4IJAA 5BN8A 3VF6A 4BRQA 1TYQA 1MWKA 3ENHA 3WXLA 3CCJN 3D2FB 4CD1A 3F9MA 2KKZA 3M3ZA 2ZJQL 2FF3B 5AFUA 5BR9A 5C2FA 3ID6A 3HOTA 4O5FA 3G25A 3ULEA 3RVCA 3H3NO 3CJCA 1KAYA 1Y64A 1NBWA 3H3OB 4BRGA 5GAEP 2P9KB 4CBUA 1Q86O 4YOVA 3AY9A 3O80A 3C6AA 3ENOA 5M1KA 1VQMN 2F7TA 5AQXA 5H1SQ 3WQUA 1CZAN 3NVKA 3CCRN 1NLVA 2YHXA 2QTDA 3FE1A 5C15A 2A41A 1R59O 3D2FA 3GG4A 4DKWA 3C7NB 4QS9A 3ZYYX 3LM2A 4U67L 1ATNA 2FF6A 4A2AA 3ATVA 3HSCA 4J8FA 3G4SN 4CBWA 4IOXA 4QS7A 2FSNA 4BREA 3LDLA 1KAXA 1KAZA 2RHKA 3HTVA 2ASMA 4QS8A 4CJ7A 4GV6A 2P9LB 3O9TA 3O9UA 4GVEA 4DQ8A 3WXKA 1YUWA 5AQTA 2YI1A 2BTFA 5AQUA 3SBGA 1KD1O 4R79A 2GWKA 2ZWHA 3CMAN 1LCUA 2NZTA 4IO8A 2P9PB 4JKEA 3CJAA 4A59A 5EOYA 2GEMA 4H0VB 2E1YA 4HWIA 1JCFA 4FWSA 5AQHA 3R6MA 4FWPA 1SQKA 3EZWA 2GUPA 4BVPA 4JK9A 3D6RA 3M6GA 3C0BA 3Q7CA 3VMFB 4ILJA 2NRHA 2NRTA 2P9LA 1W97L 1BWFO 5AZJB 4FWLA 1Q18A 4RCHA 1P8ZA 5F0XA 1GLLO 3HBTA 4WFNL 5GIPA 1QVGM 5EX5A 1M1KO 4H0OA 3LDOA 4H5VA 3O9SA 4KH6A 2P9PA 4BRMA 3DLLL 4CZJA 1GLEG 1QQMA 1YJ9N 3LDNA 4JKGB 3U9ZA 4B9QA 4Z94A 3MN7A 4FPBA 4WF9L 3CF5L 3BUZB 4C23A 4BRCA 1KXPA 2ZF5O 1YJWN 5C10A 4DB3A 2YJFA 3OBWA 3KK7A 5AZJA 1DT9A 3VEYA 3WXIA 2GELA 1X3NA 3ATUA 3OA9A 3WXJA 3MWPA 3CD6N 4BQLA 3I56N 2QWPA 1NGCA 3GOIA 5M1OA 5C2DA 5BN9A 1NMDA 3U8XA 1K8KB 2CGLA 4B1WB 3N4QA 4BRLA 3O9RA 5FPNA 2F9WA 5AQQA 4WCEL 2PAVA 5AQMA 4YOXA 4JKGA 1WOQA 5ADXH 2DPNA 1YVNA 2Q1NA 5AQWA 3F2KA 3TPQA 3ZX0A 4CZHA 1M90O 3DXKB 4BR9A 3R8EA 3VERA 3TTFA 4AF1A 1NWKA 3KHYA 4BGAA 2A5XA 4B1YB 3B8AX 1ZXOA 2IVPA 4C1NK 5EXWA 4JHDA 3BF1A 1RDUA 3TTDA 1Q7YO 4WQ5C 2HBJA 4MO4A 4PL7A 3UKRB 1SAZA 1WUAA 1TUUA 1VQ4N 4FVUA 3VGKA 3VF4A 1K8KA 2YCHA 3QDKA 4BG8A 3KZBA 3EE9A 4K43A 5AQJA 3OW2M 2IIRA 5KQDA 2QXLA 4ISFA 2BUPA 2D0OA 2QA4N 2D4WA 1YAGA 4B1XB 2Q31A 5M1NA 3IMXA 4ISGA 4BY9C 5E84A 3GBTA 4M63C 5AQPA 5JVHL 2HBKA 3ENBA 4AM6A 3CJ9A 4KH5A 3VEZA 4BGBA 4NO7A 1BDGA 4BR7A 1VQKN 2V7YA 3JS6A 4FWRA 3DJCA 3FLCO 3MCAB 3O1WA 4H0TB 3UKRA 4YOUA 3ULEB 5EY4A 2IVNA 3MN6A 4LC9B 3I8BA 1BA1A 3ZX3A 3G71N 4BRDA 4DHYA 3O08A 2BH1A 3FR0A 2WBNA 3H1QA 3P38A 3SMPA 2OTLN 1Q82O 1NGJA 1QHAA 3OBYA 4XEIA 4JKCA 4H0PA 1GLDG 5AZIB 2FSJA 4JK7A 2A3ZA 4YDUA 3MN9A 3CERA 3U9DA 1YIJN 5AQFA 1ESVA 2D1KA 4YOTA 2VCPA 3SK3A 5CE3A 2WC9A 3HM8A 3ZX2A 5JICA 2V51B 3VETA 3H6EA 4A5AA 4EHTA 3VEOA 2HBMA 3R3LA 4JD2A 3CCSN 3MK6A 5F2RA 4IOAL 2PBDA 3EL2A 2YHYA 2Q2RA 5AQZA 3SAHA 3C65A 4JK8A 3TU5A 3L0QA 3S41A 1Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX5 A;  3MWP A;  4GVE A;  4FVU A;  4GV3 A;  3Q7B A;  3MX2 A;  4GV9 A;  3MWT A;  4GV6 A;  4G9Z A;  3Q7C A;  3R3L A; 
#chains in the Genus database with same CATH topology
 1SKR A;  3HPO A;  4DQI A;  3OYN A;  3HM9 A;  4BR4 A;  4CJL A;  3TI0 A;  4F8R A;  2VWJ A;  5AZI A;  1J53 A;  3M8P A;  4CD3 A;  2Y1J A;  4ISE A;  1SL2 A;  4DV0 K;  4MLE A;  3RSE B;  2GWJ A;  1DGK N;  3NH2 A;  3D2E A;  2RE2 A;  4EZ9 A;  4OLA A;  2A1R A;  3KWG A;  3DXM A;  4W5R A;  5BPN A;  2HHW A;  1BI4 B;  1VSI A;  4IOC L;  2H3G X;  3K9J A;  4K42 A;  4OKK A;  2V52 B;  2ASO A;  1BQN A;  1XC3 A;  4KPY A;  4I9Q A;  2PFU A;  5LMN K;  4FZY A;  1VQ7 N;  3QBX A;  4IFV A;  2HHQ A;  3KK3 A;  2KFN A;  2O8E B;  1W2B M;  1C0G A;  3NGY A;  1NKB A;  1IBM K;  1LOT B;  3A5M C;  3F5T A;  5AQV A;  4FLT A;  5GAH P;  1S6Q A;  3BF3 A;  1TAU A;  3VEW A;  4BC2 A;  1QQO A;  4B08 A;  3KK2 A;  1Z25 A;  1UOC A;  4RG8 A;  3ZT2 A;  4GV9 A;  3LAL A;  3OYA A;  2HHH K;  4CEA A;  4CZM A;  4N56 A;  4BE2 A;  1SL0 A;  2HOE A;  4IBN A;  3VQ8 A;  3O9Q A;  1J6Z A;  1JLC A;  4BC4 A;  4CW7 B;  3HL8 A;  2QWQ A;  4RW7 A;  5KRT A;  4Q5V A;  2ATQ A;  2YHW A;  4BRF A;  2JGU A;  4B8A B;  5E41 A;  4BC5 A;  1V4T A;  4Z4H A;  1BQM A;  1LWE A;  4FOI A;  3NCI A;  1X9J A;  4KFB A;  3H1V X;  3CC2 N;  4WQ4 A;  4Y1C A;  2YX6 A;  1HLU A;  1GOA A;  4FJK A;  4LD0 A;  3O4Q A;  2W40 A;  3AO2 A;  4DMN A;  4CF0 A;  2O8B B;  1O1W A;  3PUF A;  3PY8 A;  4DTU A;  3CQY A;  1KTQ A;  5AQR A;  4IDK A;  2D0C A;  4BRA A;  3MX5 A;  1HYS A;  3KVG A;  4CFA A;  1WSG A;  4JEP A;  3CHW A;  4CIF A;  2NNW A;  1NOY A;  2P9N B;  3UB5 A;  1FXX A;  2WUS A;  1KVC A;  4IFY A;  1ASV A;  1BUP A;  1S1T A;  4OPH A;  4AHS A;  3SAG A;  4B3O A;  1RT6 A;  4FJJ A;  4OPJ A;  2R7Y A;  1ZYQ A;  3P4I A;  1SS6 A;  3THY A;  2V7Z A;  1IJJ A;  3OS0 A;  3D2E B;  4B1V A;  1TL1 A;  2VQE K;  3M8R A;  1X1P A;  1E3M A;  4HUF A;  3B6P A;  3DXM B;  3EKU A;  2O8F B;  4Y0W A;  1NK8 A;  3QIC A;  3EN9 A;  1D4X A;  3KLI A;  1JLB A;  4CK2 A;  3HST B;  2X6S A;  3LZI A;  4WFA L;  2ZGZ A;  3KWI A;  2VQF K;  4B9S A;  2PYL A;  1OH6 A;  3QB0 A;  3SPZ A;  2BGG A;  4L3Q A;  4IKF A;  5SWM A;  4DV4 K;  5AQK A;  3KD1 E;  4YOR A;  1FKP A;  4CJ5 A;  1BIS A;  5BPM A;  4AHU A;  3T1Y K;  4DU3 A;  1X9W A;  3KIO A;  4PWD A;  4M7X A;  5M1Q A;  4CJV A;  3AGK A;  1RT5 A;  1IBK K;  5AQN A;  3CCL N;  5M1F A;  4WFB L;  3P5J A;  4B3M K;  3BEX A;  4YOY A;  4BR2 A;  4KRE A;  3CCM N;  4LSN A;  2YHA A;  1S1X A;  3HOS A;  4PQU A;  4F3O A;  3GE1 A;  5DK5 A;  4QCL A;  4JN4 A;  4DFK A;  3U3Y A;  1Q9Y A;  3KKS A;  4BQZ A;  3HVT A;  4FW1 A;  3LP1 A;  3IUC A;  2CGK A;  5B8H A;  3CFP A;  3WQT A;  1NNE A;  1MWM A;  2HVH A;  2F4V K;  4MDA A;  4DV7 K;  4O55 A;  1TK5 A;  3UKU B;  5BRF A;  1C0U A;  1NGB A;  3VTI A;  3C95 A;  4CGI A;  3MCP A;  2P9U A;  4GNI A;  2IGI A;  4KBO A;  2BAN A;  2F9T A;  1U47 A;  3CPE A;  4DS5 A;  3MMV A;  1DTQ A;  4FJ7 A;  3FFI A;  3IRX A;  1NGD A;  3O4W A;  4KTW A;  3ULD A;  4DU4 A;  3THW A;  4BR0 A;  3TTC A;  4X62 K;  2E5L K;  4JAX A;  4DTO A;  1QS4 A;  1XQS C;  3LDQ A;  4IXC A;  4JKF A;  1D9D A;  4B1U B;  3TSU A;  5M1P A;  2QWN A;  2YHB A;  3K9K A;  4CHQ A;  4OO1 J;  2HMI A;  3V9Z A;  4H4O A;  3G6E N;  3OYK A;  4F2R A;  4I6M B;  3THY B;  3AVH A;  2QKK A;  3THV A;  2Y1I A;  2RPI A;  4WE1 A;  4E1N A;  3I55 N;  4L8R B;  1OH5 A;  1L3T A;  5AR0 A;  3DXK A;  3QO9 A;  1RFQ A;  3C6H A;  2NUB A;  3FZK A;  1TYQ B;  4LF4 K;  4HHT A;  4OKJ A;  1KQS M;  3L2W A;  3CYM A;  3JXU A;  4M3X A;  3DWL A;  4WYB A;  2Q0U A;  3C6T A;  4JI6 K;  2O8D A;  3ZSW A;  2VG7 A;  4IJA A;  5BN8 A;  4YY3 K;  3VF6 A;  3MEC A;  3ENH A;  3WXL A;  3RWU A;  3IG1 A;  2XRI A;  3ID6 A;  4OGC A;  3DRR A;  3RVC A;  3U3G A;  4JI2 K;  2UXB K;  2FC0 A;  4BRG A;  3MXI A;  1Q86 O;  1EWQ A;  4YOV A;  4LY7 A;  2BE2 A;  3ENO A;  1VQM N;  3ZT3 A;  3NH0 A;  4CK1 A;  1CZA N;  3NVK A;  1NLV A;  1A5X A;  4CVN E;  4DQS A;  5C15 A;  5EU7 A;  1VSF A;  2A41 A;  3D2F A;  1JKH A;  3S3N A;  2JLE A;  3G0Z A;  4QS7 A;  4FYD A;  1KAX A;  1KAZ A;  3HTV A;  1QSL A;  2B6A A;  3RMB A;  4IO8 A;  2P9P B;  3RMA A;  3CJA A;  1XHZ A;  2F96 A;  1UA1 A;  3LPT A;  4HWI A;  4FWS A;  4CF8 A;  1SQK A;  3EZW A;  4GMJ B;  3C0B A;  2KTQ A;  2Z1J A;  2HHT A;  2P9L A;  1W97 L;  2VG6 A;  5AZJ B;  3I8D A;  1Q18 A;  1VSH A;  1TVR A;  3THW B;  5GIP A;  5EX5 A;  1TK8 A;  4H0O A;  1HPZ A;  3LDO A;  1GLE G;  4B9Q A;  3BUZ B;  5C10 A;  2YJF A;  4C8O A;  3L2V A;  3KK7 A;  3VEY A;  4FLU A;  3QEI A;  3OYC A;  3WXJ A;  3I56 N;  5HRP A;  3U8X A;  4B1W B;  3N4Q A;  3NF9 A;  3O9R A;  5FPN A;  2F9W A;  1D9F A;  1SUQ A;  4WCE L;  5AQM A;  4JKG A;  5ADX H;  5AQW A;  1M90 O;  3F2K A;  3S3O A;  3DXK B;  3R8E A;  4AF1 A;  3TTF A;  3SQ0 A;  4BGA A;  2IVP A;  1RBU A;  3BF1 A;  1Q7Y O;  4WQ5 C;  4MO4 A;  1CZB A;  1SAZ A;  1LWC A;  1VQ4 N;  4FVU A;  3VF4 A;  1K8K A;  3QDK A;  3SCX A;  3OW2 M;  2IIR A;  2OCE A;  1L5U A;  4B1X B;  3IMX A;  2O8D B;  1U48 A;  3MEG A;  4M63 C;  5AQP A;  1VSK A;  3KLE A;  3CJ9 A;  4BGB A;  2V7Y A;  4FWR A;  3DJC A;  3FLC O;  4H0T B;  4KHS A;  4YOU A;  5EY4 A;  3HVR A;  1BA1 A;  3ZX3 A;  3O08 A;  2BH1 A;  3FR0 A;  4FK0 A;  1C0M A;  1RTD A;  4J2E A;  1VQ8 N;  4JKC A;  3SYZ A;  3MN9 A;  4H4M A;  1ESV A;  1DLO A;  3VQ9 A;  3ZX2 A;  3VET A;  3H6E A;  2O4G A;  5F2R A;  1IG9 A;  2PBD A;  1EXQ A;  3ZSZ A;  4AHR A;  3L0Q A;  1S6P A;  4CFB A;  1W0H A;  3P31 A;  4CBX A;  4CEC A;  3DLB A;  1XMO K;  1GLF O;  4DUZ K;  5FDL A;  3ZSY A;  4FLY A;  1KC8 O;  1N32 K;  1OVY A;  4JI1 K;  2ITG A;  4A57 A;  1QZ6 A;  3TAQ A;  4C8N A;  1BCO A;  2IVO A;  4QAG A;  4CJQ A;  4I7F A;  5LL6 Z;  4E19 A;  1YTU A;  3VES A;  1ZC6 A;  2D0A A;  4K41 A;  5A2Q O;  2NRX A;  1W9H A;  4BR5 A;  3OYI A;  3E9P A;  2YNH A;  3RSE A;  2A42 A;  4LH4 A;  4JI3 K;  3PIP L;  3VOV A;  3T3F A;  3CME N;  4A61 A;  1WSF A;  4I2P A;  4PKI A;  2OAN A;  3CCE N;  2OPP A;  1RDA A;  2Q36 A;  2IDO A;  3CCQ N;  1DEJ A;  3CPW M;  4M7Y A;  3TSQ A;  3CCU N;  4GKK K;  1EWR A;  1BIU A;  4NB4 A;  1CZ9 A;  2D0P A;  4QOZ B;  1TKZ A;  3ALY A;  3DMJ A;  1IV0 A;  3OYG A;  2ETJ A;  2JWL A;  4A62 A;  2O8E A;  1VQO N;  2VWK A;  4W5N A;  5HBM A;  3VGM A;  3R1X A;  5K14 A;  4ELV A;  5AQL A;  4DTP A;  2KQ2 A;  5SZT A;  3HI0 A;  4H5W A;  3H46 O;  3M1F A;  3OYF A;  1NK6 A;  2HHU A;  4BE0 A;  5KPT A;  2G8I A;  1EKE A;  4FK2 A;  4B3S K;  1CXQ A;  1HKB A;  1VRU A;  4CF1 A;  4KB1 A;  1GLA G;  3WUH A;  3AO5 A;  3BGR A;  1N36 K;  2HVI A;  2GTD A;  1ILY A;  1YIT N;  2E20 A;  3DLE A;  3AO4 A;  3VQ7 A;  2GX9 A;  4RW6 A;  3U4L A;  3AVG A;  2NLX A;  4MFB A;  2EX3 A;  2Q97 A;  4CZG A;  1L3U A;  3CFO A;  5HL7 L;  3H45 C;  1VQ5 N;  3ZT0 A;  4YFU A;  3V9W A;  3AVA A;  4BWJ A;  3L2R A;  1A5W A;  4KKO A;  1RDC A;  3KJV A;  1SV5 A;  4E89 A;  5LY3 A;  3AAP A;  1QQN A;  1KLN A;  1FW6 A;  3N4P A;  3PSF A;  5AQY A;  1NK5 A;  1WSI A;  1Q81 O;  1NGI A;  2ZJP L;  3MAQ A;  4LF7 K;  1HQE A;  4HCB A;  3HK2 A;  2KLA A;  4HCC A;  4IWV A;  3PX0 A;  3VF2 A;  3QNN A;  2ZJR L;  4K8X A;  3O3G A;  5F1X A;  1L3S A;  2P9N A;  4V19 S;  3DOL A;  1CXU A;  1Z6R A;  1B9F A;  4OVL A;  4E7J A;  3SAF A;  4H5T A;  5MLC Q;  4DFP A;  3Q7B A;  5HOO A;  2FBY A;  2VYP A;  3ZEU B;  4EAH D;  1TAQ A;  1GLB G;  3K58 A;  3A5N C;  3RMD A;  3F9K A;  2KZM A;  1QSY A;  4C8L A;  4BDP A;  2O8F A;  4FO0 A;  2P9S A;  3WNF A;  2P5O A;  4IJN A;  1P90 A;  1JL1 A;  5GIO A;  5IWA K;  1QHT A;  3DLR A;  4RW4 A;  4Z4I A;  1BL3 A;  1RBV A;  5JS2 A;  3VPZ A;  4X66 K;  5ADX A;  1DKG D;  5JS1 A;  3I33 A;  1J54 A;  3IAY A;  2IS3 A;  1WSH A;  1IKW A;  3NF8 A;  4ICL A;  2UUB K;  4PL8 A;  3DLK A;  3E9L A;  3EO3 A;  1BG3 A;  5CYQ A;  1LWF A;  4CZF A;  2AJQ A;  2IOC A;  4O0J A;  5BR8 K;  3C7N A;  1NJZ A;  1TKX A;  2W41 A;  1BCM A;  1SKS A;  1JLQ A;  1K6Y A;  3GL1 A;  3TAE A;  1WSE A;  3ASM A;  4FJX A;  4ILG B;  1JLE A;  4AHV A;  4I2Q A;  3CJB A;  5FPE A;  4JLH A;  1YF5 L;  4N41 A;  3NDK A;  1ZBS A;  3AVK A;  4BVO A;  1K9M O;  4CJS A;  5KPZ A;  1K73 O;  1NGF A;  4EZ6 A;  1SZ2 A;  4BRI A;  5GIN A;  3LL3 A;  4M45 A;  2E2N A;  2JWK A;  1J5E K;  2UU9 K;  5I9E B;  1HMV A;  4MO5 A;  1MU2 A;  4FPA A;  3LM9 A;  3SQ1 A;  1G99 A;  1YJN N;  4JKD A;  3UKU A;  2QWR A;  4DQR A;  1V4S A;  3L8B A;  4IG0 A;  3A2F A;  1RT2 A;  4G9Z A;  2Z1G A;  4UY8 O;  4I9L A;  1RT1 A;  4CFC A;  2OA8 A;  1NJI O;  1T6C A;  2YJE A;  4WQ5 A;  4DV5 K;  3O6W A;  4F4K A;  1VRT A;  4Z4F A;  1OKJ A;  2E4L A;  4LFA K;  5KGW A;  3E01 A;  2PYJ A;  2O4I A;  1ASU A;  2UYT A;  4DTM A;  4B9V A;  1S1V A;  1KVA A;  3MXM A;  4K25 A;  3FFK B;  1RDW X;  4CZI A;  3GDQ A;  3AAQ A;  3MEE A;  4I6M A;  3SZ2 A;  4M3U A;  3M5R A;  4JKB A;  5AQS A;  2I7P A;  3EYZ A;  3D7E O;  3W0L A;  4HUE A;  2P9S B;  3LAK A;  4DLG A;  4HTL A;  4DLE A;  4FLX A;  4E7H A;  1TYQ A;  4CD1 A;  2KKZ A;  5C2F A;  3K59 A;  3EZ5 A;  4B9M A;  3G25 A;  1SKW A;  1NOZ A;  1RT7 A;  1HYZ A;  1UWB A;  3L3V A;  2UUA K;  3H3O B;  3HYF A;  5GAE P;  4CBU A;  3AY9 A;  3WQU A;  5J2Q A;  2YHX A;  2QTD A;  3FE1 A;  4FJL A;  3GG4 A;  3C7N B;  4QS9 A;  3ZYY X;  3LM2 A;  1ATN A;  3PO4 A;  1OVQ A;  3HSC A;  4J8F A;  3G4S N;  4CBW A;  4DR2 K;  1Q9X A;  3LDL A;  4GV6 A;  4CJ7 A;  2ASM A;  4JI4 K;  3OY9 A;  2OZS A;  3O9U A;  1YUW A;  3MXJ A;  2YI1 A;  5AQU A;  1KD1 O;  3VA0 A;  4FJM A;  2GWK A;  2ZWH A;  2NZT A;  4CJK A;  2QKB A;  1HYV A;  4H0V B;  4Z4G A;  1ZBH A;  4CEQ A;  4DTS A;  1VK0 A;  3QEW A;  3D6R A;  3VMF B;  2W6L A;  1LW2 A;  1FJG K;  1P8Z A;  5F0X A;  4X65 K;  3HBT A;  1QVG M;  1B9D A;  1T05 A;  5I3U A;  2P9P A;  3H08 A;  4BRM A;  3LP2 A;  4WF9 L;  2WTU A;  4C23 A;  2GBZ A;  1HR0 K;  1KXP A;  2ZF5 O;  3DYA A;  5AZJ A;  1DT9 A;  3LPU A;  1W7A A;  1YVU A;  3WXI A;  2GEL A;  3HP9 A;  2HHS A;  1RDB A;  4N5S A;  4R5P A;  1OH7 A;  3MWP A;  4BQL A;  4YNQ A;  1GOB A;  1NGC A;  3OJU A;  5C2D A;  3TR8 A;  3TWH A;  1NMN A;  2CGL A;  4BRL A;  4DR1 K;  4YOX A;  2QK9 A;  2DPN A;  4KB0 A;  2I5J A;  4KTQ A;  2HNZ A;  4DUY K;  5C42 A;  1NWK A;  1I3A A;  4NCG A;  1LW0 A;  4B1Y B;  3IS9 A;  1ZXO A;  5EXW A;  2QXF A;  4JHD A;  3TTD A;  3AVL A;  4KHW A;  4CJ3 A;  2FBX A;  4PL7 A;  4DTR A;  1WUA A;  1HNX K;  1TUU A;  1QQC A;  3NHG A;  4DR7 K;  4FVM A;  1XNR K;  1C1A A;  3VQE A;  5FLX O;  3KZB A;  3EE9 A;  5KQD A;  2D0O A;  1YAG A;  5M1N A;  4JI0 K;  3VQB A;  1VSM A;  3GBT A;  5C24 A;  4AM6 A;  1BDG A;  1VQK N;  3O1W A;  4CJF A;  4DV3 K;  2IVN A;  3MN6 A;  2O8C B;  3I8B A;  4DV1 K;  4DHY A;  3P38 A;  3QET A;  1Q82 O;  1UA0 A;  3CQ8 A;  2FSJ A;  3RTV A;  3SV3 A;  4CHO A;  2PY5 A;  3HT3 A;  4FXD A;  3VEO A;  4ELT A;  1RTJ A;  1NJX A;  3T1H K;  3S3M A;  2YHY A;  3G10 A;  4BAC A;  2Q2R A;  2GUI A;  3DRS A;  1Z05 A;  1K8A O;  3ZSX A;  3AA3 A;  4KHP K;  1H1V A;  4FW2 A;  3J7A P;  2RN2 A;  3V1Q A;  5GAD P;  4DFM A;  3OYH A;  1J9A A;  2I7N A;  2NRR A;  1VSE A;  4EIA A;  1YI2 N;  4BRO A;  3J7Z O;  4CZK A;  4NYN A;  4O0I A;  1JXE A;  3CET A;  3J7Y P;  3ZSO A;  1XHX A;  5CHI A;  4M42 A;  2OZM A;  3B6O A;  4CIG A;  3LP3 A;  2E2P A;  4Z0U A;  3CC7 N;  4FWM A;  1T8E A;  5KRS A;  2CH6 A;  3TAF A;  1UAX A;  1VQ9 N;  3I0R A;  3MN5 A;  4B1Z A;  3QES A;  3PX6 A;  1G15 A;  1YHQ N;  3PX4 A;  5TKY A;  3WEE A;  1BHL A;  3QBW A;  3L3U A;  2OPR A;  5AFU H;  5BRE A;  1RT4 A;  1WNS A;  1XC9 A;  4CGG A;  3L6Q A;  4B9U A;  1REV A;  3ZET A;  1GLJ O;  4FWN A;  3QEX A;  4K0K K;  4JHD B;  1E4F T;  1VQL N;  2KZZ A;  1RBS A;  4DFJ A;  5JMV A;  3ITH A;  5HRR A;  2P9I B;  1S9E A;  4DWI A;  4H0X B;  4K8Z A;  2Z1I A;  4IFE A;  3VA3 A;  1NGE A;  3BY5 A;  3RR8 A;  4LF9 K;  2DFF A;  4CI6 A;  2ZGY A;  4W5T A;  3WNG A;  1LAV A;  4A5B A;  4AM7 A;  1VQN N;  3JAM O;  3HZ6 A;  1U2V A;  3E1Y A;  4W5O A;  3L4Q A;  4E3S A;  3V9X A;  5KQ8 A;  1N34 K;  1VAZ A;  1HRH A;  4OKE A;  3QML A;  3BP8 A;  4CJ4 A;  2EWS A;  2A40 A;  3OTO K;  1HKG A;  3T7Z A;  3VQ6 A;  3VTH A;  2ZD1 A;  3NMU A;  2DFE A;  3KK1 A;  4AHC A;  4CEB A;  5FPD A;  3CJ7 A;  3FZF A;  1IO2 A;  4FLW A;  3SBT A;  1TUY A;  4RW9 A;  4NXM K;  4CHZ A;  4MLH A;  2E88 A;  4YDU C;  4CFD A;  1JJ2 M;  4FWO A;  4A2B A;  2X78 A;  3CJ1 A;  2HF4 A;  4KAZ A;  5AQI A;  1IBL K;  2A6A A;  3AA2 A;  4O4G A;  4O8K A;  3ZSR A;  4FJI A;  3VN5 A;  3ZT1 A;  4GV3 A;  4CEF A;  3LWL A;  4IEI A;  5FRM A;  2D0B A;  3WXM B;  3OYM A;  1KCF A;  1NGH A;  3R9P A;  5JVG L;  4C1N I;  3HXM A;  2IC3 A;  5AQO A;  3A5O C;  4NLC A;  3QER A;  4CJT A;  4YHH K;  2J4R A;  2KFZ A;  3WEE B;  4F9O A;  3QNO A;  3TAG A;  5AQG A;  2VGM A;  3VQ4 A;  3ZEU A;  3CI5 A;  5C12 A;  4JS4 A;  1WBB A;  2F8S A;  3ZET B;  1VQ6 N;  2XY7 A;  4H0Y B;  3HPH A;  3QEP A;  1RNH A;  4GY2 B;  3TSP A;  3J80 O;  4ZHR A;  3NH1 A;  4FJN A;  1BA0 A;  3ZT4 A;  4DS4 A;  4PHT X;  5BRH A;  5BRD A;  5HLF A;  2QI2 A;  3W3D A;  4CZL A;  4FWQ A;  3T19 A;  1QVF M;  3KLF A;  1S5J A;  1MA9 B;  1S3X A;  1JL2 A;  4C8M A;  2UXC K;  2G8F A;  3VEN A;  1EO1 A;  3CC4 N;  5KPR A;  3DAW A;  3K2P A;  5JLF A;  3CFR A;  4HVJ A;  4E0D A;  2XY5 A;  1XUP O;  1U2V B;  1YXQ A;  5GAG P;  3SJH A;  1S1U A;  2Q0R A;  3AVB A;  2ZQB A;  4IO9 L;  4IDH A;  4CJU A;  4BC3 A;  3V9S A;  3SPY A;  3JSM A;  1J5O A;  1C0F A;  2HF3 A;  4KHY A;  4E1J A;  4FSV A;  2XO7 A;  3EEQ A;  4IG3 A;  4BRN A;  4B9T A;  1JCE A;  1JLA A;  4DQP A;  2BDP A;  4BWM A;  3TAB A;  3OS2 A;  4M3Y A;  3V1O A;  3LAM A;  3OYJ A;  4BDZ A;  2Q3S A;  1NU0 A;  4EP5 A;  1EX4 A;  3UE5 A;  4DTN A;  1FKO A;  4DR5 K;  2E6M A;  3SMS A;  4FLZ A;  4EFH A;  5CR4 A;  3ID8 A;  1GLC G;  4DSL A;  4J2A A;  4HTU A;  4ELU A;  3KLG A;  3EE8 A;  4CHP A;  2QW9 A;  2DTU A;  3C94 A;  4BRP A;  1S9G A;  1HX1 A;  4MDB A;  1CLQ A;  4XIU A;  5C0Y A;  2AA4 A;  4DV2 K;  3SUN A;  3LDP A;  3AA5 X;  1HNI A;  4JYA K;  3HP6 A;  2XHB A;  1C1C A;  3HJF A;  3A0I X;  1HPM A;  2HW3 A;  1NK0 A;  3VQQ A;  3PSI A;  3NE6 A;  1BU6 O;  2X74 A;  2P1J A;  1TV6 A;  2AP1 A;  4FL9 A;  1N8R O;  2WON A;  5BPL A;  4BRQ A;  4CIE A;  1YTA A;  5HRO A;  3SQ4 A;  4B3T K;  3M3Z A;  2FF3 B;  5AFU A;  4JV5 K;  3NBP A;  3KD5 E;  3ULE A;  3L2Q A;  1HNV A;  1Y64 A;  3O80 A;  3C6A A;  5CY4 A;  4M41 A;  2F7T A;  5AQX A;  4CEE A;  5H1S Q;  3SNN A;  4ZTF A;  3CCR N;  1WLJ A;  1IKV A;  1R59 O;  4DKW A;  3RRG A;  4U67 L;  4A2A A;  3ATV A;  2DY4 A;  3T1A A;  4IOX A;  4BRE A;  2RHK A;  4QS8 A;  2B5J A;  3D45 A;  3O9T A;  1ZBL A;  4GVE A;  4DQ8 A;  3WXK A;  5HRN A;  1ITG A;  1U04 A;  2BTF A;  3LP0 A;  1QSS A;  3CMA N;  1LCU A;  3AO3 A;  4A59 A;  4DSK A;  4JKE A;  3SUP A;  3OS1 A;  2E1Y A;  4Z4E A;  4FWP A;  3K5L A;  1KSP A;  1S1W A;  5HRS A;  3AVJ A;  3Q7C A;  4OJR A;  4ILJ A;  4O44 A;  2HB5 A;  2NRH A;  2NRT A;  4FLV A;  1BWF O;  4FWL A;  1HJR A;  4RCH A;  5J1E A;  1GLL O;  1M1K O;  4H5V A;  4JRQ A;  2HNY A;  4CZJ A;  1QQM A;  5LMU K;  4TSX A;  5J2M A;  3U9Z A;  3CF5 L;  4FPB A;  4FM0 A;  4H8K A;  4DB3 A;  3DLG A;  3JYT A;  2XY8 A;  4HUG A;  1IKY A;  3OBW A;  4DR3 K;  1X3N A;  3ATU A;  3NAE A;  3CD6 N;  3NF6 A;  5M1O A;  3OYD A;  3AA4 A;  3VQ5 A;  3DRP A;  2PAV A;  2ZE2 A;  1WOQ A;  2FBT A;  1YVN A;  3TPQ A;  3ZX0 A;  2HHV A;  2IAJ A;  4BR9 A;  3VER A;  5KTQ A;  2A5X A;  3B8A X;  4C1N K;  1ZBU A;  2HBJ A;  4CHN A;  2OPS A;  3UKR B;  4LF8 K;  1N5Y A;  2YCH A;  1XMQ K;  4NCB A;  4LF5 K;  4BG8 A;  4AH9 A;  3OYB A;  3THX B;  4K43 A;  5AQJ A;  4CEO A;  4DU1 A;  4N47 A;  2QXL A;  4ISF A;  2BUP A;  1SL1 A;  1KVB A;  3BDP A;  3SV4 A;  5E84 A;  4PUO A;  4LH5 A;  2HBK A;  3ENB A;  1VSL A;  4KH5 A;  3VEZ A;  3M8Q A;  4NO7 A;  3JS6 A;  3ULE B;  3K5M A;  4LC9 B;  3NFA A;  1C6V A;  4BRD A;  3G71 N;  3SMP A;  1ZBF A;  2WBN A;  3H1Q A;  2OTL N;  1NGJ A;  1QHA A;  3MED A;  3OBY A;  4XEI A;  4H0P A;  5AZI B;  4YDU A;  4JK7 A;  4CK3 A;  3U9D A;  3QEV A;  5AQF A;  1N33 K;  4YOT A;  2VCP A;  5CE3 A;  3D0P A;  2WC9 A;  3HM8 A;  5JIC A;  2V51 B;  4JD2 A;  3R3L A;  2YNG A;  4GVM A;  3VQP A;  3CCS N;  4IOA L;  3SUO A;  3LWM A;  3P83 D;  5AQZ A;  2O8C A;  3C65 A;  1XI1 A;  1TL3 A;  3BZC A;  3TU5 A;  3S41 A;  1Z26 A;  3O8M A;  3EKS A;  1NJY A;  1NKC A;  2CH5 A;  1DTT A;  2ITM A;  4RWT A;  2XY6 A;  4NXN K;  1HQU A;  4DV6 K;  2E1Z A;  2NRW A;  1U49 A;  1BGX T;  2NRZ A;  3RRH A;  1NGA A;  1T6D A;  2CGJ A;  4CHY A;  1NM1 A;  3O1B A;  2EHG A;  3HRG A;  4CJR A;  4JKH A;  4U7B A;  1NK9 A;  5DM6 L;  3L2U A;  3A5L C;  1KFS A;  1HUX A;  4YOW A;  2G8U A;  3RMC A;  4B9L A;  4J2D A;  1HKC A;  1BIZ A;  3AVN A;  1NGG A;  3AO1 A;  4FOE A;  4XH1 A;  1NK4 A;  4GKJ K;  4ZTJ A;  3J8A A;  2YKN A;  1BOT O;  1NG9 A;  1HJO A;  1T3V A;  2HST A;  5JLH A;  1RCH A;  3CQX A;  3O4N A;  1U45 A;  4N76 A;  4CES A;  4CJP A;  3IDH A;  4CGD A;  1JCG A;  2YV0 X;  4PKH A;  3CM6 A;  3MDQ A;  3VEX A;  2OTJ N;  2VWB A;  1XNQ K;  4BRH A;  1JLF A;  3SUQ A;  2RF2 A;  5E26 A;  3T69 A;  2FBV A;  4Y1D A;  3O3H A;  3O3F A;  1T7P A;  4LF6 K;  3SI6 A;  2P51 A;  3P39 A;  4CZE A;  3MWT A;  3VEV A;  1HNW K;  3VQA A;  1RTH A;  4O8U A;  1TK0 A;  1B92 A;  2PZS A;  3OYL A;  4OGE A;  4RTF D;  1RGI A;  4BDY A;  1JXB A;  5T7B A;  4BE1 A;  3DLH A;  4DSE A;  5I42 A;  1U4B A;  4PY5 A;  2P9I A;  3QIO A;  2W6K A;  3VGL A;  1X9S A;  4E7L A;  1RTI A;  1HNZ K;  4JI8 K;  3A8Y A;  1RBT A;  4IZ9 A;  4XH4 A;  4FK4 A;  1JLG A;  1WSJ A;  4JD2 B;  4CF2 A;  4W5Q A;  3L4I A;  4EP4 A;  4DSF A;  4KHN A;  4J2B A;  1BO5 O;  2ASP A;  3QIN A;  2E2O A;  3AAR A;  4PA1 A;  4CGF A;  3V1R A;  1IG8 A;  4AIL C;  3IKM A;  4KHQ A;  2HMP A;  2KHO A;  3O5B A;  3SLC A;  3K5O A;  1EET A;  4PKG A;  1S72 N;  4KHU A;  4DF8 A;  3AVF A;  4RW8 A;  5TKW A;  1NJW A;  3KTQ A;  1YT3 A;  5FRN A;  3E66 A;  1I39 A;  1A5V A;  3FZH A;  4Z4C A;  2E2Q A;  3VQC A;  3OHR A;  5CYM A;  4C8K A;  4CF9 A;  1R0A A;  4FZX C;  4OX9 K;  3IFR A;  4DSI A;  4H5N A;  4NCA A;  4CGJ A;  4KTZ A;  4NLB A;  4JRP A;  5LJV A;  3TAN A;  4FCY A;  2B4J A;  1ATS A;  3PIO L;  3HO1 A;  4DCH A;  4ILH A;  1QZ5 A;  4GW6 A;  3ISN C;  4KRF A;  3RR7 A;  3QLH A;  3WT0 A;  3NF7 A;  3HPG A;  5DMR A;  4BG9 A;  3E9O A;  2HBL A;  1IH7 A;  3FGU A;  5IT9 O;  5FPM A;  2FSK A;  3PO5 A;  2UXD K;  4JNE A;  3TAR A;  4IEE A;  3CXC M;  4B3R K;  3P1G A;  5CZ2 A;  5LJW A;  3CM5 A;  4G1Q A;  4JKA A;  3FZM A;  2P9K A;  3V9U A;  2HHX A;  4FJ8 A;  4AHT A;  1NKE A;  4KI4 A;  3TAP A;  1ATR A;  4DR4 K;  2HND A;  3CG7 A;  1WB9 A;  4BRK A;  1U6Z A;  2P9U B;  5KGX A;  2QM1 A;  1EQY A;  4FWK A;  5J2P A;  4F3T A;  1Y97 A;  2G8H A;  3ZSV A;  4CER A;  4XH5 A;  4Q0B A;  5C25 A;  4B8C A;  4ID5 A;  2A1S A;  4OPA A;  1S22 A;  2QWM A;  2G8V A;  1LAW A;  1E4G T;  3NVM A;  4E7K A;  1TKD A;  4WQ4 C;  4CE9 A;  4EHU A;  2QWO A;  5EVZ A;  3AGR A;  4M3Z A;  2FLO A;  1D5A A;  4ID1 A;  1VQP N;  1D8Y A;  3K57 A;  4KV8 A;  3OYE A;  1ASW A;  3I0S A;  3CCV N;  3NGZ A;  2F8T A;  3QFP A;  1TGO A;  4CEZ A;  1X3M A;  2QWL A;  3LAN A;  3PLA A;  2E8A A;  3UIQ A;  4KI6 A;  4FZZ A;  2FXU A;  3WNH A;  4H5R A;  3V4I A;  4UQG A;  5ELZ A;  1KFD A;  1T44 A;  1LV5 A;  2Z1H A;  4DQQ A;  2E6L A;  3J81 O;  1MDU B;  3V81 A;  4CGH A;  3QFU A;  3MX2 A;  1RBR A;  1RDD A;  5J2N A;  2VG5 A;  3FZL A;  1QE1 A;  4H03 B;  1OH8 A;  4M3R A;  1O13 A;  2NRV A;  2VGN A;  5AJ3 K;  3K0S A;  3OJS A;  2OPQ A;  4KH4 A;  5DM7 L;  1TKT A;  2WFB A;  1VHX A;  3CIP A;  4FJH A;  2QEX N;  5HP1 A;  4CCH A;  4FJ9 A;  1MWK A;  3C6U A;  3CCJ N;  3D2F B;  4AQY K;  3F9M A;  4B9N A;  2ZJQ L;  5BR9 A;  1WAF A;  3HOT A;  4O5F A;  3H3N O;  5FRO A;  3CJC A;  1KAY A;  3AVM A;  3BZK A;  1NBW A;  3KLH A;  1EP4 A;  5CZ1 A;  2P9K B;  3VQD A;  5M1K A;  3PV8 A;  1N6Q A;  1NK7 A;  4JS5 A;  3LZJ A;  1ZBI A;  2GV9 A;  4M3T A;  3AVI A;  3SQ2 A;  2FF6 A;  3V6D A;  3ZLJ A;  4CED A;  4DSJ A;  2FSN A;  3NGI A;  1T03 A;  2P9L B;  2RKI A;  2WOM A;  3OVN A;  4E1M A;  2ZM6 K;  4DTJ A;  1QTM A;  5AQT A;  1WBD A;  3SBG A;  2P5G A;  1FK9 A;  4R79 A;  4DTX A;  5EOY A;  2GEM A;  3M8S A;  1JCF A;  1GOC A;  5AQH A;  3R6M A;  4MQ3 A;  2GUP A;  3ZSQ A;  4JK9 A;  4BVP A;  3M6G A;  4FJG A;  1C1B A;  3WNE A;  4LFB K;  3F73 A;  4FM2 A;  1BI4 A;  4WFN L;  1WAJ A;  4F2S A;  2G8K A;  3O9S A;  4KH6 A;  4LSL A;  3DLL L;  4NYF A;  3LDS A;  1YJ9 N;  3LDN A;  4JKG B;  4Z94 A;  3SJJ A;  3MN7 A;  4DR6 K;  4JI7 K;  4BRC A;  1YJW N;  3DOK A;  4LFC K;  3AV9 A;  1I94 K;  1WN7 A;  3OA9 A;  2QWP A;  3GOI A;  3DI6 A;  5BN9 A;  1NMD A;  3EY1 A;  1K8K B;  2YKM A;  2YNF A;  1XWL A;  2DFH A;  5AQQ A;  4CJE A;  2Q1N A;  4CZH A;  2LSN A;  2G8W A;  3KHY A;  3AVC A;  4OPK A;  5D3G A;  1RDU A;  2D5R A;  1KLM A;  2KW4 A;  3VGK A;  1RT3 A;  4JI5 K;  4CJW A;  2QA4 N;  3U6F A;  2D4W A;  4BY9 C;  2Q31 A;  4ISG A;  3TAM A;  3S9H A;  1RIL A;  4O5B A;  4DF4 A;  5JVH L;  2X6N A;  4FJ5 A;  4BR7 A;  2UUC K;  4X64 K;  3MCA B;  3K5N A;  1F21 A;  3UKR A;  4M3W A;  4KO0 A;  1C0T A;  1VSD A;  4DG1 A;  3DM2 A;  1L3V A;  1VSJ A;  5KI6 A;  1IKX A;  3THX A;  2OYQ A;  2O8B A;  4OLB A;  1GLD G;  2A3Z A;  3CER A;  1YIJ N;  2YNI A;  2D1K A;  3SK3 A;  3QIP A;  3KKR A;  4A5A A;  4EHT A;  1X9M A;  2HBM A;  3MK6 A;  4E7I A;  4FM1 A;  3EL2 A;  3SAH A;  2W42 A;  1Q8I A;  3ZCM A;  4JK8 A;  1KRP A; 
#chains in the Genus database with same CATH homology
 1K8A O;  4BR4 A;  3O8M A;  3P31 A;  4CBX A;  3EKS A;  1H1V A;  5AZI A;  2CH5 A;  2ITM A;  4RWT A;  4CD3 A;  5GAD P;  4ISE A;  1GLF O;  4MLE A;  2E1Z A;  3RSE B;  2GWJ A;  1DGK N;  2NRW A;  1KC8 O;  1OVY A;  2NRZ A;  2I7N A;  4A57 A;  1QZ6 A;  2NRR A;  2RE2 A;  1NGA A;  3D2E A;  4EIA A;  1YI2 N;  1T6D A;  4BRO A;  2CGJ A;  3KWG A;  3DXM A;  2IVO A;  1NM1 A;  4CZK A;  3J7Z O;  5BPN A;  3O1B A;  3CET A;  3HRG A;  4IOC L;  3VES A;  1ZC6 A;  2H3G X;  4K41 A;  4JKH A;  4U7B A;  2NRX A;  3K9J A;  4K42 A;  4BR5 A;  5DM6 L;  2V52 B;  5CHI A;  2ASO A;  3E9P A;  3A5L C;  3RSE A;  1HUX A;  2A42 A;  4YOW A;  1XC3 A;  1HKC A;  3PIP L;  2E2P A;  2PFU A;  1NGG A;  4FOE A;  4XH1 A;  3VOV A;  3CC7 N;  1VQ7 N;  4FWM A;  3QBX A;  3CME N;  4A61 A;  2CH6 A;  3J8A A;  1VQ9 N;  1BOT O;  3MN5 A;  1HJO A;  4PKI A;  2OAN A;  1T3V A;  3CCE N;  4B1Z A;  2HST A;  1W2B M;  2Q36 A;  1C0G A;  5JLH A;  1LOT B;  3A5M C;  3CCQ N;  3F5T A;  1DEJ A;  5AQV A;  3CPW M;  4M7Y A;  1YHQ N;  3CQX A;  3TSQ A;  5GAH P;  3CCU N;  3BF3 A;  5TKY A;  3WEE A;  3QBW A;  3VEW A;  4BC2 A;  1QQO A;  5AFU H;  4NB4 A;  5BRE A;  3IDH A;  1JCG A;  4GV9 A;  2D0P A;  3L6Q A;  4PKH A;  3ZET A;  1GLJ O;  3MDQ A;  3VEX A;  4CZM A;  2JWL A;  2VWB A;  2HOE A;  2OTJ N;  4FWN A;  4A62 A;  1VQO N;  4JHD B;  1E4F T;  4BRH A;  1VQL N;  3VGM A;  3O9Q A;  1J6Z A;  3R1X A;  4BC4 A;  5JMV A;  5E26 A;  5AQL A;  3T69 A;  2QWQ A;  2P9I B;  2YHW A;  3HI0 A;  4H0X B;  4BRF A;  4H5W A;  3H46 O;  3M1F A;  4BC5 A;  1V4T A;  3P39 A;  4FOI A;  4CZE A;  3MWT A;  3VEV A;  1X9J A;  5KPT A;  4IFE A;  3H1V X;  3CC2 N;  4WQ4 A;  1NGE A;  4O8U A;  1HKB A;  4CI6 A;  2ZGY A;  2YX6 A;  1HLU A;  4RTF D;  1GLA G;  3WUH A;  4A5B A;  4AM7 A;  1RGI A;  1VQN N;  3HZ6 A;  1U2V A;  3E1Y A;  2GTD A;  2P9I A;  3L4Q A;  1ILY A;  1YIT N;  2W40 A;  2E20 A;  3VGL A;  5KQ8 A;  1VAZ A;  2GX9 A;  3U4L A;  2NLX A;  3QML A;  3BP8 A;  3A8Y A;  3CQY A;  2EWS A;  5AQR A;  4IZ9 A;  2Q97 A;  4XH4 A;  4CZG A;  2A40 A;  5HL7 L;  3H45 C;  1VQ5 N;  4BRA A;  4JD2 B;  1HKG A;  3MX5 A;  3T7Z A;  3L4I A;  3KVG A;  3VTH A;  4JEP A;  1BO5 O;  3CHW A;  2ASP A;  2NNW A;  2P9N B;  3NMU A;  2E2O A;  3AAR A;  3UB5 A;  5LY3 A;  2WUS A;  1IG8 A;  3AAP A;  1QQN A;  5FPD A;  3CJ7 A;  3FZF A;  3N4P A;  3IKM A;  5AQY A;  2HMP A;  1BUP A;  1TUY A;  2KHO A;  3SBT A;  3O5B A;  4OPH A;  3SLC A;  4MLH A;  2E88 A;  4YDU C;  1JJ2 M;  4PKG A;  1Q81 O;  1NGI A;  4FWO A;  3SAG A;  2ZJP L;  1S72 N;  4A2B A;  2KLA A;  3P4I A;  4IWV A;  1SS6 A;  2V7Z A;  3VF2 A;  1IJJ A;  3D2E B;  4B1V A;  2ZJR L;  5F1X A;  5TKW A;  3CJ1 A;  2HF4 A;  3DXM B;  2P9N A;  3E66 A;  3EKU A;  5AQI A;  3FZH A;  1Z6R A;  2A6A A;  4O8K A;  4Y0W A;  3QIC A;  2E2Q A;  3EN9 A;  1D4X A;  3SAF A;  3OHR A;  4H5T A;  5MLC Q;  4GV3 A;  3Q7B A;  5HOO A;  4WFA L;  2ZGZ A;  3KWI A;  4IEI A;  2VYP A;  3ZEU B;  4EAH D;  3WXM B;  3IFR A;  1GLB G;  1NGH A;  3QB0 A;  4H5N A;  3R9P A;  3A5N C;  4NLB A;  5LJV A;  5JVG L;  4C1N I;  4L3Q A;  1ATS A;  3PIO L;  4FO0 A;  5AQK A;  5AQO A;  2P9S A;  4YOR A;  4DCH A;  4ILH A;  1QZ5 A;  1P90 A;  3A5O C;  4IJN A;  4NLC A;  5BPM A;  5GIO A;  4M7X A;  3WT0 A;  4BG9 A;  2J4R A;  5M1Q A;  3E9O A;  2HBL A;  3WEE B;  4F9O A;  3AGK A;  3FGU A;  5AQG A;  2VGM A;  3ZEU A;  5AQN A;  5FPM A;  2FSK A;  3CI5 A;  5C12 A;  4JNE A;  3CCL N;  5M1F A;  4WFB L;  3VPZ A;  3BEX A;  5ADX A;  4IEE A;  4YOY A;  3CXC M;  4BR2 A;  1DKG D;  3I33 A;  3ZET B;  3CCM N;  1VQ6 N;  5LJW A;  3HOS A;  4H0Y B;  4PL8 A;  4JKA A;  3GE1 A;  3E9L A;  3EO3 A;  2P9K A;  3FZM A;  4GY2 B;  1BG3 A;  3TSP A;  4JN4 A;  1ATR A;  4CZF A;  1BA0 A;  4PHT X;  5BRH A;  5BRD A;  4BQZ A;  2QI2 A;  3W3D A;  4CZL A;  4FWQ A;  1QVF M;  3C7N A;  4BRK A;  1U6Z A;  1MA9 B;  2P9U B;  1S3X A;  2W41 A;  1VQ8 N;  3GL1 A;  2QM1 A;  1EQY A;  3IUC A;  4FWK A;  3VEN A;  2CGK A;  1EO1 A;  3CC4 N;  5KPR A;  4ILG B;  5B8H A;  3WQT A;  1MWM A;  3DAW A;  4XH5 A;  5JLF A;  4MDA A;  3CJB A;  5FPE A;  1YF5 L;  1XUP O;  1ZBS A;  1U2V B;  1YXQ A;  3UKU B;  3SJH A;  4BVO A;  5GAG P;  5BRF A;  1K9M O;  2Q0R A;  4OPA A;  4IO9 L;  4IDH A;  1S22 A;  1NGB A;  3VTI A;  5KPZ A;  2QWM A;  1K73 O;  1NGF A;  4BC3 A;  3MCP A;  1SZ2 A;  2P9U A;  4GNI A;  4BRI A;  3LL3 A;  5GIN A;  4KBO A;  1C0F A;  1E4G T;  2F9T A;  3NVM A;  3CPE A;  2E2N A;  2JWK A;  3MMV A;  4WQ4 C;  2HF3 A;  1NGD A;  5I9E B;  3O4W A;  4MO5 A;  4EHU A;  2QWO A;  4E1J A;  4FSV A;  4FPA A;  5EVZ A;  4BRN A;  4BR0 A;  3LM9 A;  1JCE A;  3TTC A;  1G99 A;  3AGR A;  4JAX A;  4JKD A;  1YJN N;  2FLO A;  3UKU A;  1VQP N;  2QWR A;  1V4S A;  1XQS C;  4IXC A;  3LDQ A;  4JKF A;  4B1U B;  3TSU A;  4G9Z A;  5M1P A;  2QWN A;  3CCV N;  3K9K A;  4OO1 J;  4UY8 O;  3QFP A;  3UE5 A;  1X3M A;  2QWL A;  3G6E N;  3PLA A;  1NJI O;  2E8A A;  3SMS A;  1T6C A;  2YJE A;  4WQ5 A;  3O6W A;  4I6M B;  5CR4 A;  4EFH A;  3ID8 A;  1GLC G;  2FXU A;  3EE8 A;  4H5R A;  2QW9 A;  5ELZ A;  1OKJ A;  1T44 A;  4BRP A;  1HX1 A;  4MDB A;  1MDU B;  5C0Y A;  2AA4 A;  3I55 N;  3QFU A;  2UYT A;  3MX2 A;  3DXK A;  5AR0 A;  1RFQ A;  3C6H A;  3FZK A;  4K25 A;  3FFK B;  1RDW X;  3FZL A;  4CZI A;  4H03 B;  1TYQ B;  3LDP A;  3GDQ A;  3AAQ A;  1O13 A;  4I6M A;  2NRV A;  3M5R A;  4JKB A;  3A0I X;  5AQS A;  2VGN A;  2I7P A;  1KQS M;  1HPM A;  3D7E O;  3JXU A;  3W0L A;  1BU6 O;  2P9S B;  4KH4 A;  5DM7 L;  2AP1 A;  4FL9 A;  2WFB A;  4HTL A;  3DWL A;  1N8R O;  4WYB A;  2Q0U A;  3CIP A;  5BPL A;  2QEX N;  4IJA A;  5BN8 A;  3VF6 A;  4BRQ A;  1TYQ A;  1MWK A;  3ENH A;  3WXL A;  3CCJ N;  3D2F B;  4CD1 A;  3F9M A;  2KKZ A;  3M3Z A;  2ZJQ L;  2FF3 B;  5AFU A;  5BR9 A;  5C2F A;  3ID6 A;  3HOT A;  4O5F A;  3G25 A;  3ULE A;  3RVC A;  3H3N O;  3CJC A;  1KAY A;  1Y64 A;  1NBW A;  3H3O B;  4BRG A;  5GAE P;  2P9K B;  4CBU A;  1Q86 O;  4YOV A;  3AY9 A;  3O80 A;  3C6A A;  3ENO A;  5M1K A;  1VQM N;  2F7T A;  5AQX A;  5H1S Q;  3WQU A;  1CZA N;  3NVK A;  3CCR N;  1NLV A;  2YHX A;  2QTD A;  3FE1 A;  5C15 A;  2A41 A;  1R59 O;  3D2F A;  3GG4 A;  4DKW A;  3C7N B;  4QS9 A;  3ZYY X;  3LM2 A;  4U67 L;  1ATN A;  2FF6 A;  4A2A A;  3ATV A;  3HSC A;  4J8F A;  3G4S N;  4CBW A;  4IOX A;  4QS7 A;  2FSN A;  4BRE A;  3LDL A;  1KAX A;  1KAZ A;  2RHK A;  3HTV A;  2ASM A;  4QS8 A;  4CJ7 A;  4GV6 A;  2P9L B;  3O9T A;  3O9U A;  4GVE A;  4DQ8 A;  3WXK A;  1YUW A;  5AQT A;  2YI1 A;  2BTF A;  5AQU A;  3SBG A;  1KD1 O;  4R79 A;  2GWK A;  2ZWH A;  3CMA N;  1LCU A;  2NZT A;  4IO8 A;  2P9P B;  4JKE A;  3CJA A;  4A59 A;  5EOY A;  2GEM A;  4H0V B;  2E1Y A;  4HWI A;  1JCF A;  4FWS A;  5AQH A;  3R6M A;  4FWP A;  1SQK A;  3EZW A;  2GUP A;  4BVP A;  4JK9 A;  3D6R A;  3M6G A;  3C0B A;  3Q7C A;  3VMF B;  4ILJ A;  2NRH A;  2NRT A;  2P9L A;  1W97 L;  1BWF O;  5AZJ B;  4FWL A;  1Q18 A;  4RCH A;  1P8Z A;  5F0X A;  1GLL O;  3HBT A;  4WFN L;  5GIP A;  1QVG M;  5EX5 A;  1M1K O;  4H0O A;  3LDO A;  4H5V A;  3O9S A;  4KH6 A;  2P9P A;  4BRM A;  3DLL L;  4CZJ A;  1GLE G;  1QQM A;  1YJ9 N;  3LDN A;  4JKG B;  3U9Z A;  4B9Q A;  4Z94 A;  3MN7 A;  4FPB A;  4WF9 L;  3CF5 L;  3BUZ B;  4C23 A;  4BRC A;  1KXP A;  2ZF5 O;  1YJW N;  5C10 A;  4DB3 A;  2YJF A;  3OBW A;  3KK7 A;  5AZJ A;  1DT9 A;  3VEY A;  3WXI A;  2GEL A;  1X3N A;  3ATU A;  3OA9 A;  3WXJ A;  3MWP A;  3CD6 N;  4BQL A;  3I56 N;  2QWP A;  1NGC A;  3GOI A;  5M1O A;  5C2D A;  5BN9 A;  1NMD A;  3U8X A;  1K8K B;  2CGL A;  4B1W B;  3N4Q A;  4BRL A;  3O9R A;  5FPN A;  2F9W A;  5AQQ A;  4WCE L;  2PAV A;  5AQM A;  4YOX A;  4JKG A;  1WOQ A;  5ADX H;  2DPN A;  1YVN A;  2Q1N A;  5AQW A;  3F2K A;  3TPQ A;  3ZX0 A;  4CZH A;  1M90 O;  3DXK B;  4BR9 A;  3R8E A;  3VER A;  3TTF A;  4AF1 A;  1NWK A;  3KHY A;  4BGA A;  2A5X A;  4B1Y B;  3B8A X;  1ZXO A;  2IVP A;  4C1N K;  5EXW A;  4JHD A;  3BF1 A;  1RDU A;  3TTD A;  1Q7Y O;  4WQ5 C;  2HBJ A;  4MO4 A;  4PL7 A;  3UKR B;  1SAZ A;  1WUA A;  1TUU A;  1VQ4 N;  4FVU A;  3VGK A;  3VF4 A;  1K8K A;  2YCH A;  3QDK A;  4BG8 A;  3KZB A;  3EE9 A;  4K43 A;  5AQJ A;  3OW2 M;  2IIR A;  5KQD A;  2QXL A;  4ISF A;  2BUP A;  2D0O A;  2QA4 N;  2D4W A;  1YAG A;  4B1X B;  2Q31 A;  5M1N A;  3IMX A;  4ISG A;  4BY9 C;  5E84 A;  3GBT A;  4M63 C;  5AQP A;  5JVH L;  2HBK A;  3ENB A;  4AM6 A;  3CJ9 A;  4KH5 A;  3VEZ A;  4BGB A;  4NO7 A;  1BDG A;  4BR7 A;  1VQK N;  2V7Y A;  3JS6 A;  4FWR A;  3DJC A;  3FLC O;  3MCA B;  3O1W A;  4H0T B;  3UKR A;  4YOU A;  3ULE B;  5EY4 A;  2IVN A;  3MN6 A;  4LC9 B;  3I8B A;  1BA1 A;  3ZX3 A;  3G71 N;  4BRD A;  4DHY A;  3O08 A;  2BH1 A;  3FR0 A;  2WBN A;  3H1Q A;  3P38 A;  3SMP A;  2OTL N;  1Q82 O;  1NGJ A;  1QHA A;  3OBY A;  4XEI A;  4JKC A;  4H0P A;  1GLD G;  5AZI B;  2FSJ A;  4JK7 A;  2A3Z A;  4YDU A;  3MN9 A;  3CER A;  3U9D A;  1YIJ N;  5AQF A;  1ESV A;  2D1K A;  4YOT A;  2VCP A;  3SK3 A;  5CE3 A;  2WC9 A;  3HM8 A;  3ZX2 A;  5JIC A;  2V51 B;  3VET A;  3H6E A;  4A5A A;  4EHT A;  3VEO A;  2HBM A;  3R3L A;  4JD2 A;  3CCS N;  3MK6 A;  5F2R A;  4IOA L;  2PBD A;  3EL2 A;  2YHY A;  2Q2R A;  5AQZ A;  3SAH A;  3C65 A;  4JK8 A;  3TU5 A;  3L0Q A;  3S41 A;  1Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...