4GA1A

Structure of the n-terminal domain of nup358
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
143
structure length
143
Chain Sequence
RSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYMEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPMQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAVYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Pan troglodytes
molecule tags Transport protein
molecule keywords E3 SUMO-PROTEIN LIGASE RANBP2
total genus 56
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga1A00
2UWJG 1TJCA 2KATA 2XCCA 3EDTB 3LY7A 2KCVA 3Q5MA 2KC7A 4GZ3A 3PE4A 4JHRA 5EX3A 3GZ2A 5BW8C 3ZHEB 5HQ8A 3TGOA 3AS5A 2Y4UA 3MV3B 2NC9A 5CHEE 3OXLA 5AYWD 4CDRA 3K9IA 4GYYA 3ESKA 4N39A 4YVOA 4GYOA 5FT9A 3R9AB 5KJMA 4CGWA 3NF1A 1PC2A 2VSNA 4G2VA 2E2EA 5HI7A 1NA0A 2AVPA 3GW4A 3Q15A 4GZ5A 5JJTA 2V5FA 4EQFA 3ZGQA 2PZIA 1ZBPA 3PDNA 4JA9A 1HH8A 5FZQA 5DBKA 4J0UA 4YVQC 2VGXB 4N3AA 3TAXA 3FWVA 4J8DA 2KCKA 4HOTA 4WNEA 2XCBA 3RKVA 3CEQA 4U0SA 4APOA 2WPVA 1NA3A 5JJ6A 2XGSA 1HZ4A 4GZ6A 3SZ7A 4H7XA 5CCLA 1W3BA 3LYAA 5KJLA 2JLBA 4BT9A 3TG5A 4G24A 2LSVA 4LEUA 2XPIA 4XIFA 3QDNA 4WUYA 3IEGA 4UQXA 1B89A 3Q49B 2YQ8A 2P58C 4BWRA 2FI7A 3O48A 4G23A 4GA2A 3S7DA 3JYSA 2PL2A 4I9EA 1XNFA 5CCMA 4U0ZA 3CKCA 2IF4A 3LCAA 2HYZA 3QWWA 4IN3B 2PQRA 4BT8A 5D0QD 4GA1A 4I2ZA 3MA5A 1WM5A 3AS4A 3OXGA 4WNGA 3UUXA 1WAO1 4Y6WA 4YNDA 5ARGA 4UI9J 5G05J 2UY1A 2C0LA 5A7DB 2L6JA 3SF4A 5A6CA 1A17A 3LKUA 2Y4TA 3RO3A 3VTYA 4AY5A 3RIBA 2YHCA 5KJNA 4HOSA 3ZPJA 3CK9A 4Y6CA 5M72A 4GPKA 2GW1A 3OXFA 4XI9A 3ZFWA 4GYWA 3CK7A 2HO1A 3FFLA 3LY8A 4RG9A 2UY1B 3QOUA 1IHGA 3CVLA 3GZ1A 2KCLA 3QKYA 4KYOB 3FP3A 2XGMA 3CV0A 3UPVA 5G04J 3WXXA 2IFUA 3BEEA 4GCNA 3RO2A 1HXIA 2J9QA 2ONDA 3LPZA 5KJKA 5JJ7A 2FO7A 2XEVA 3CVNA 4H7YA 4RG6A 1ELRA 4N3CA 4AM9A 5LCWJ 3ASFA 2FBNA 5DIZA 5FZRA 3ULQA 1E96B 3MEKA 4AY6A 3AS8A 4A1SA 3KD7A 4U0UA 5BNWA 2VSYA 3PE3A 4HOQA 3U4TA 3S7FA 3RJVA 3ZHEA 1KT0A 3RU0A 1FCHA 2VYIA 3QWPA 1IYGA 3Q4AB 4KXKB 4BTBA 4I9CA 3S7JA 2DBAA 3LY9A 4U04A 4O6FA 4UI9C 4W9RA 2VGYA 3VTXA 3ASHA 2PQNA 2Q7FA 5LCWC 2BUGA 2VQ2A 5EX0A 5D0OD 4N2QA 3CKBA 4J8EA 4U07A 4G26A 2VGXA 1ELWA 4UQYA 2C2LA 5G04C 4N5CA 4I17A 1NZNA 2FEZA 5FTPA 4AIFA 3QWVA 4NQ0A 3MKRA 4JA7A 3CVQA 5FJYA 4BTAA 4HORA 4N2SA 2R5SA 4UQZA 3Q47B 3GYZA 5EKQD 4J8FA 4N3BA 3HYMB 4WNFA 2XGOA 1QZ2A 4ME2A 3CK8A 4F3VA 5FZSA 2OOEA 2MHKA 3MV2B 3S7BA 4G1TA 1KLXA 4I2WA 4UI9K 2QFCA 4XI0A 3TG4A 2FF4A 2LNIA 4KBQA 4NRHB 3URZA 4CGVA 1P5QA 4GCOA 2LSUA 3N71A 1Y8MA 3U3WA 5G05C 1OUVA 2HR2A 3KS2A 3UQ3A 2I6HA 4I1AA 1KT1A 3ASGA 3KAEA 4G25A 4HOUA 4WNDA 5ARFA 4ABNA 4B94A 4GA0A 3ASDA 5BT1A 3E4BA 1QQEA 2C0MA 3CVPA 1YA0A 1ZU2A 2WQHA 5C1DA 4JL0A 3ZN3A
chains in the Genus database with same CATH superfamily
2UWJG 3APCA 3LY7A 3SFZA 1TNOA 3Q5MA 3UIOC 2NC9A 3K9IA 1Z6TA 3W9GA 3PNTB 2GRNB 2F37A 1OWOA 3UM2A 1H0AA 2XPIA 2YQ8A 5B1AE 2L0IA 3O48A 4G23A 3FH7A 4RQIA 1K1BA 3FUEA 1A17A 3VTYA 4Y6CA 3KSLA 3V2OA 3LS8A 3TWVA 3DSXA 3CV0A 2J09A 3APDA 1K3ZD 5AJDA 5JJ7A 4RG6A 1IXVA 3VLFA 3KSQA 1HX8A 4DX1A 3VLEA 2I1KA 3UT7A 5CRVA 3IKOB 1NP7A 3TL5A 2WQ6A 3E32A 4YDWA 1XGWA 4U07A 3MKQB 2XZDG 4HORA 3PZ1A 2XHEA 4B89A 3EIQC 3SFYA 3ABME 1O5MA 4EECA 2VSOE 2XPZA 3UQ3A 2GRRB 4WNDA 4HI9A 2KM4A 1H2UA 5HQ8A 4JHRA 5T3RA 1SZAA 4U7EB 2QZAA 3OXLA 5B1BE 5HI7A 4XKCA 2WM9A 3G2TA 4LUNU 4EQFA 3J5PA 2P9LG 4YVQC 2XCBA 1LF8A 4APOA 1SZ9A 4ATGA 4BT9A 4JVSA 1UOHA 5JHAA 2J4BA 3TWRA 4EZKA 1TN8A 2ETCA 4WWPA 2Y3AA 3PUJA 4GA1A 4WNGA 2EILE 2C0LA 2L6JA 4TXQA 3UKRG 2Y4TA 3ZYQA 5M72A 3FTSA 3UX4A 1SQMA 5FINA 4DX5D 2J07A 2QYJA 2WXIA 3SGHA 2J9QA 3FULA 5H7PA 5CERB 1E96B 1LD8A 2L6BA 3U4TA 2LXLA 3CVVA 3TWQA 2DBAA 3FDHA 3UM0A 2P9KG 2V8SE 3FUKA 1N4RA 4IRUA 3T8MA 4LRZA 1RW2A 1NI1A 2A4ZA 1X5BA 4HVBA 2KZTB 4N3BA 2DIWA 1QZ2A 5LX8A 3E4BA 4U95D 2KC7A 1N52A 3TGOA 3FH5A 5AQAA 3ULEG 4GZ5A 2WXFA 3PEVB 1QNFA 3UM3A 2A5UA 4MRUA 2KCKA 2WPVA 4A3TA 3I3NA 3S2AA 4J7WA 1OT8A 1W3BA 5KJLA 3RRNB 4JXTA 3T9KA 2VSXE 4FADA 2GRLA 3JYSA 3IV0A 3DPYA 5ANLA 2XPYA 2RFAA 3HRAA 4U96D 5JA4D 3DSUA 2WXLA 3EU5A 3UMVA 2M63A 1JCQA 2GW1A 1MX4A 1N9AA 2ZIRA 2P9UG 5KJKA 2X6JA 2XEVA 4L7TA 4AM9A 1RZ4A 1FT2A 3Q78A 3S7FA 2Y69E 4I9CA 2A5EA 1FPPA 3L22A 3PH0C 4J6IA 3EUVA 4UQYA 3ONLA 2WXMA 3JXJA 4ACKA 3L17A 2XGOA 4ME2A 4F6RD 4G1TA 3PRZA 5AARA 3JUIA 2I2OA 1KT1A 4HLEA 2J4DA 2C0MA 4ANUA 3ZVVA 1HF8A 3C3OA 1OWNA 3O4ZA 1QBQA 4FHJA 4HNAD 4BSXA 4G2VA 3L08A 3UM1A 5CMWA 4XE0A 1DVPA 3PS6A 1ZBPA 5FZQA 5EDSA 2MRIA 2LAHA 4PUCA 1NA3A 5FWQA 3ESLA 3QB2A 1U2VG 1S70B 4UWKA 4GTOA 4I9EA 2ZXWE 3LCAA 1HU3A 1N4SA 3CHPA 4GTVA 3LXUX 4M3OA 3DWLG 2LXMA 1E8ZA 4V3IA 5KJNA 4OYSA 3ZPJA 1TNBA 3QOUA 2LUHA 3HXBA 3L13A 4GCNA 3Q79A 2WMOA 4FJZA 4TUMA 3UT8A 3PZ2A 4G11A 2OVFA 4AY6A 4Q94A 2GROB 4CYMD 1H6OA 1N94A 1BLXB 1FCHA 5AQ9A 3S7JA 1V55E 1N4PA 2BUGA 5EX0A 4N2QA 4FJYA 5FTPA 4I6GA 4BTAA 4DJAA 1S64A 2OOEA 4GPKA 2XS1A 3PNLB 1E90A 4I1AA 3KAEA 4JPSA 4GTSA 2E0IA 2KCVA 5CECB 3TWTA 2RKKA 3NZSA 4F1SA 4GYYA 4YVOA 3U9WA 1DC2A 5KJMA 3T5VA 3FU6A 2MOWA 5EYPF 3CR3A 2PZIA 4HI8A 3RKVA 3LJ3A 3CEQA 1V54E 4RVBA 5AENA 1TEZA 1MYOA 4KZCA 4L2YA 2HYZA 3I4GA 1UN9A 5A6CA 2NSZA 3RO3A 3DPDA 4HOSA 3CK7A 3C98A 1UJKA 2KCLA 3FP3A 4ACLA 3E37A 2CFZA 3WXXA 3RO2A 2OV8A 4H7YA 1ELRA 2X6FA 2FBNA 3AJIA 3ULQA 5ENTD 2VSYA 4HQDA 3NOCD 3ZYMA 4HXIA 1IYGA 2VYIA 1H2VC 2VGYA 3ASHA 3RRUA 1Z3YA 5D0OD 2V0PA 5CEDB 3HXEA 4HFGA 4I6EA 4AJWA 4JHJA 2KBXA 3TG4A 4UI9K 3D9KA 4GTRA 2HR2A 3KS2A 5CMYA 4GA0A 1EYHA 4FHKA 4QFVA 3NAWA 4HS2A 1SA5A 2P9PG 2WQHA 5C1DA 3ZN3A 3LEWA 2XRZA 3DRAA 3J5QB 4HRMB 3CHOA 1WDYA 3Q15A 1VDYA 3SFXA 3D3MA 2F0YA 4APFA 4J0UA 4MLPA 1JPLA 2JEKA 4CCAA 5JJ6A 4BETA 4LEUA 5AJLA 4I43A 3G2WA 4BWRA 4CT0A 3DXMG 3MCXA 4PS7A 2VGEA 1S0PA 3UUXA 4UI9J 2WB2A 2EINE 3CK9A 4U8VD 2DCPA 2DZOA 1IHGA 1O1RA 4Q69A 4BX9A 5EIDA 1MX2A 1HXIA 3AS8A 4L23A 3RU0A 5FQ7A 5LFAA 1TJFA 4U04A 5JMND 4HLLA 3SQVA 1EDUA 5KNGA 2VQ2A 4R7LA 4IYPA 3MKRA 3BG0B 4Q96A 3QK0A 4XI0A 3CVWA 3U3WA 2LSUA 4DLQA 1KPSB 3CQCB 3ZNGA 1SVXA 3ZXPA 3LVQE 2OCCE 4FU3A 5T4YA 3FTWA 3AG1E 5EX3A 3HDXA 4EZLA 3AS5A 2Y4UA 3AAAC 4ILHB 4CDRA 4N39A 4U8YD 3ZU7B 1U3DA 2GRPB 1PC2A 3ONKA 2H6GA 4Z68A 2V5QC 4N3AA 4BERA 1NFIE 4RSYA 2PM6A 3TWWA 4G24A 1IQRA 3D9PA 1B89A 3UT4A 2VTBA 4GB9A 3HXDA 1WAO1 4Y6WA 5ARGA 3AU5A 3SF4A 3IHVA 4F1PA 2Y1LE 2IQCA 2KZTA 3SO8A 3ZFWA 4DRXE 4I1OB 4GAAA 3EHRA 3UPVA 1N0RA 3I4RB 2X3MA 1X81A 2J49A 3E33A 2CFUA 5BXUA 3CVXA 2H6HA 4WWNA 4GZCA 4NACA 5AAOA 2XENA 2WVIA 4QQIA 4O6FA 4MBGA 3EU9A 1U3CA 3G2SA 2R03A 4N2SA 3MZLB 3GYZA 1UN8A 1YYHA 5CBNA 2PM7A 3SY2A 2HM8A 3B7RL 3QC1A 3CVPA 3DBSA 2ZGGA 5BW8C 4XZ4A 1E8XA 4K03A 4O1PA 1TYQG 1IKND 1SW6A 3KEAA 3RSEG 3UTMA 3TAXA 3NB2A 4JHKA 4K5BA 2IOSA 3FUIA 3EHMA 4EPZA 4U0ZA 4ANXA 1E7VA 4MKTA 4BT8A 2FO1E 5D0QD 1WM5A 4YNDA 1H2TC 3UXGA 3QAQA 3B7UX 3FUFA 4AEZC 3OXFA 2AW6A 3QKYA 4LNGA 3MKQA 4I1MA 4YDYA 4GTPA 3BEEA 2ZU6B 2CG2A 5AN8A 1HFAA 2L9BA 3KD7A 5IY5E 3TXNA 3CHSA 1AP7A 3SNXA 3UINC 3Q9NC 4GTQA 4JZYA 1HE8A 3EIJA 4J8EA 2C2LA 4N5CA 2CHXA 3HIZA 4JA7A 4ZFHA 3DEPA 4A63B 3PUKA 2H6FA 4WNFA 4XKBA 1KLXA 3FUJA 2QFCA 4CRWA 3ZYLA 3NZUA 2CHWA 5BT1A 3FTZA 1ZU2A 4ILIA 3QARA 3NBNB 2R17C 5A23A 5E76A 4NURA 2OVBA 1OWPA 3NF1A 3Q75A 3W9FA 4KMOA 3F6QA 3PDNA 4DX7D 4JA9A 5EN5D 3D9NA 3FWVA 2XZTG 4CT4A 3AG4E 4C0MA 2YNQA 2OEWA 5HS0A 5CCLA 3LVRE 4ANVA 5D2MC 3FHEA 5EIBE 4GA2A 4KZ0A 1Y6IA 1IHBA 3WG7E 4U8HA 4M7CA 5A7DB 3ZUVB 5BXOA 3RIBA 2YHCA 3ENEA 4N5QA 2UY1B 4KYOB 1PY1A 3DXKG 4D10C 3AG3E 4N3CA 4ILGA 4B8AA 3IBEA 3ABKE 2GGFA 4UI9C 1TNYA 5LCWC 4UWHA 4G26A 5G04C 2YHEA 2FEZA 2XRYA 4J8YA 2R5SA 3EJNA 1N11A 2MHKA 2FF4A 4KBQA 1P5QA 3N71A 5G05C 4OVVA 3FEXA 1UG3A 2RD0A 5ARFA 3ASDA 1TNUA 3FTVA 3Q9UC 2BF0X 2KATA 3R9AB 5LP0A 4K5CA 4CGWA 5BUZA 2AVPA 3HXCA 1N95A 3ASOE 3ZW3A 2WXGA 4LNUD 4KVMA 3CSFA 1HZ4A 4YDEA 3MYVA 3TG5A 3GZSA 4WUYA 3IEGA 4AOFA 1K1AA 3Q7FA 2FI7A 3E30A 2YINA 2IF4A 3QWWA 5FQ8A 2F8YA 2P9SG 4I2ZA 1BD8A 2UY1A 3CSTA 5E75A 5AQBA 3LKUA 4AY5A 3CVUA 3SD5A 3HVEA 4PS3A 3PZDA 2ZISA 3FFLA 1KZPA 1BI7B 3DEOA 4U63A 2FULA 3TWXA 3G2UA 4BFRA 1S63A 5G2NA 2WQ7A 4OAVB 2BKKB 4EHMA 3TXMA 3ISMC 4G8KA 5KBAA 2MYOA 2X6HA 4I17A 4OVUA 3CQGB 3QWVA 3D9MA 5BPPA 4JC8A 5EKQD 5FZSA 3R9MA 4CGVA 3URZA 4HBDA 3RK6A 4A55A 1OUVA 4G25A 4DI3A 1INZA 2ZGDA 1QQEA 4J8SA 2I1JA 3EDTB 5ENQD 3FTXA 3L82A 4PH4B 3GZ2A 4JB8P 1UJJA 3CLJA 2HE0A 4ZHBA 3PEUB 2IU1A 5ENNA 3X2QE 1NA0A 2BTDA 2V5FA 1EF1C 3ZGQA 2P9IG 2VGXB 4HOTA 3LJNA 2XQ0A 3B7TA 4WNEA 2QC9A 3ZEFA 4PDXA 3LYAA 3FH8A 2LSVA 3FU5A 3C72A 3Q49B 3ML8A 5J90A 3D9JA 1DNPA 2PL2A 3FUDA 1ELKA 4CEMA 3QJZA 1TR4A 2IJGX 4DPRA 1OWLA 3FUHA 1JWFA 3HG0D 3FU0A 5AIJA 1WY6A 1MJ0A 3JUEA 1MQSA 2FO7A 3P1UA 5DIZA 4HOQA 3KEZA 3Q7AA 1L5JA 3VTXA 1D8DA 3SHFA 2ETAA 1Q2ZA 1MZCA 2EQXA 1GW6A 3V30A 4NRHB 4KVOA 1WG0A 4WAFA 4L9PA 1NL4A 5KCMA 3FUNA 5FJYA 3U64A 4BX8A 5CHEE 4NIKA 3ESKA 1N4QA 4GYOA 5FT9A 1FVHA 4FC8A 1MX6A 1OCOE 1A5EA 3V31A 3CVYA 4EBAA 4DK5A 4U0SA 4FLHA 3TWSA 3DSWA 2V4HC 2P2CP 3CIAA 3QDNA 1FVFA 2EIJE 1YCSB 2P58C 4RLYA 1OXJA 3JQ0A 1XNFA 2DYSE 1Z3XA 4AVXA 3HXFA 3ZYKA 4X8QA 3NQPA 3ASNE 5ENPD 2BKGA 5T8IA 4MS6A 1HG5A 2R05A 3LY8A 3B7BA 4A1GA 3CVLA 2WXRA 5B3SE 3GZ1A 4DLOA 3CHRA 3OAWA 2XGMA 4E85A 1G3NB 1OCZE 5FZRA 3MEKA 5AQ7A 1K8KG 3PE3A 4AP2A 4UWFA 4P29A 3D9OA 5HRYA 3QWPA 3EHQA 4KXKB 3LY9A 2L0TB 3EHNA 2DYRE 2LO6A 3T5XA 1ELWA 4GTMA 1LD7A 4NQ0A 5EYLA 2JABA 3Q47B 3HYMB 3MGBA 4F3VA 2RG8A 4WWOA 4GTTA 4XEIG 4EZJA 3PVLA 1D8EA 3PZ4A 4EBAG 4JL0A 3B13A 4DX2A 2IY0C 2WXNA 3PE4A 4GZ3A 4HB5A 3ZHEB 4C48B 1BU9A 3MV3B 4XX5A 3P2BA 3GW4A 2P9NG 2R02A 2X6IA 5CRUA 4DX6D 3JCKC 3L54A 5ANRA 4AV7A 4GMJA 1HG2A 3L9TA 3SI5A 1BI8B 1H6PA 2DVWA 1FT1A 4F7AA 1HS6A 4A3VA 3T8KA 2WXKA 2VJ8A 2GRQB 3APFA 4JD2G 3QNKA 2H6IA 4RG9A 4TV3A 4JW1A 3VLDA 3D9HA 2IFUA 4O60A 1ZB1A 5ENRD 3FTYA 4FA6A 3MX3A 4TXRA 4PS8A 3ML9A 3Q4AB 1BPOA 4OAUC 2WXQA 3CKBA 3V2XA 2AXZA 1OCCE 4AIFA 2XEHA 4DI4A 4UQZA 4GMLA 4J8FA 3ZXSA 4BY6A 1OCRE 2EIME 3DSSA 1KZOA 2I6HA 2LAIA 3ZIMA 4B94A 4BESA 1HO8A 1YA0A 4GZDA 3SBTB 1TJCA 4FULA 1OY3D 3UKUG 5AYWD 5C2YA 5JJTA 3JQ1A 1H6KA 1N54A 4LSZE 2KXPC 5CEAA 1E8WA 1HH8A 3ABLE 4CZ2D 1OWMA 4GU5A 3B95A 2JLBA 4XIFA 1JWGA 1D9SA 2F8XK 1TN7A 3ZKJA 3U66A 2BEDA 4AXHA 3CKCA 4HRNA 3NOGD 2RFMA 3OXGA 1O1SA 1E7UA 2CG3A 5JHBA 4L2LA 1O1TA 2ETBA 2R59A 5J08A 3LPZA 4UUCA 4CDMA 2XEEA 3DSTA 1PAQA 5FQ6A 1KT0A 4TRQA 3BUAA 5CBOA 2NYJA 3PREA 4DUIA 4W9RA 3BU8A 3AG2E 2PQNA 3UIPC 2X6KA 2XS8A 4ANWA 2WXOA 5LOZA 1N0QA 2QY7A 3L16A 3MV2B 2WXJA 4K5AB 3ASGA 4HOUA 4ABNA 5BV1A 1IQUA 3BG1B 3I5PA 4B8CB 4KT6B 2VSNA 3CGHA 2E2EA 2VTBB 1QYMA 3L6AA 3SZ7A 4H7XA 3TJPA 1JCSA 5ENSD 3R7RA 3S7DA 4F53A 4LCTA 2IEJA 1JCRA 5D66A 3MA5A 3AS4A 2PNNA 3D9IA 5G05J 1DCEA 4TXPA 4XI9A 4GYWA 4G8LA 2WXHA 5ENOD 3TWUA 1SA4A 5G04J 3R7QA 5FIOA 4GPMA 1JUQA 1EPUA 3CVNA 5LCWJ 5EILA 1E8YA 3IXEA 4B93B 4HRLA 2AJAA 4JEUA 5ITZF 3JXIA 3FUMA 3FEYA 4CDNA 3G2VA 2J8SD 4ATZD 3DSVA 2I9CA 2VGXA 2IONA 1NZNA 5G55A 4YDOA 2QYUA 3CVQA 3CHQA 3HVEB 5KNHD 4B0ZA 3ULYA 2B6CA 2LNIA 4GCOA 1Y8MA 4GMRA 1UW4B 1LTXA 4URKA 3PZ3A 3B7SA 2EIKE 2XCCA 3C3RA 4LNBA 2NXPA 4C0EA 3C5RA 4BEPA 3OTNA 4IULA 3IHYA 2B0OE 4L1BA 3MJWA 3C3QA 5DBKA 4JEHA 4J8DA 3FTUA 2IO2C 2WXPA 3BQOA 2XGSA 2WMNA 4GZ6A 4UWGA 5KWDA 3E34A 1TNZA 4UWLA 2DWZA 3RRMB 1DCQA 4UQXA 3SBSA 5CCMA 1TN6A 4IN3B 2PQRA 3FY4A 1H19A 5FQ4A 3D9LA 4O1OA 2R2LA 2AXVA 3AU4A 2GRMA 1Z5SC 4E6HA 2OEVA 5HKPA 3V79K 2HO1A 3ZRHA 1MHQA 1YMPA 4C9BB 5BV0A 2Y0BG 2IOLA 2ONDA 3UI2A 2V4LA 3ASFA 5BNWA 4A1SA 4U0UA 4BSZB 1AWCB 3RJVA 3ZHEA 4BTBA 3LDZA 4TUUA 2Q7FA 2ILRA 2J08A 2CHZA 2X38A 4LERA 4LG6A 3RAUA 3HHMA 2IO3C 4I6JA 3CK8A 2AWIA 3S7BA 4I2WA 2DZNA 4FLBA 2AXUA 4K0RA 3FU3A 3CHMA 4FP7A 3Q73A
chains in the Genus database with same CATH topology
3QARA 2UWJG 2E0IA 3APCA 3LY7A 3SFZA 2KCVA 2R17C 3Q5MA 2WXNA 3PE4A 4GZ3A 5E76A 5A23A 3ZHEB 4NURA 3MV3B 2NC9A 2OVBA 3NZSA 3K9IA 4GYYA 4F1SA 1OWPA 4YVOA 3U9WA 4XX5A 5KJMA 3NF1A 1Z6TA 3P2BA 3GW4A 3T5VA 4KMOA 3FU6A 2MOWA 2X6IA 3CR3A 2PZIA 3PDNA 4JA9A 3JCKC 3PNTB 3D9NA 3FWVA 3L54A 3RKVA 4CT4A 3LJ3A 3CEQA 4C0MA 2YNQA 1OWOA 5ANRA 4RVBA 4AV7A 1H0AA 5AENA 5CCLA 1TEZA 3LVRE 4GMJA 1HG2A 4ANVA 3FHEA 2XPIA 4KZCA 4L2YA 2YQ8A 2L0IA 3O48A 4G23A 4GA2A 4KZ0A 3SI5A 1Y6IA 3FH7A 2HYZA 3I4GA 1UN9A 4U8HA 4F7AA 3FUEA 5A7DB 1HS6A 4A3VA 5A6CA 1A17A 2NSZA 3RO3A 2WXKA 3DPDA 3VTYA 3RIBA 2YHCA 4HOSA 2VJ8A 3ENEA 4Y6CA 3APFA 3LS8A 3CK7A 3QNKA 3C98A 1UJKA 2UY1B 4RG9A 4KYOB 2KCLA 4TV3A 3FP3A 4ACLA 4JW1A 1PY1A 4D10C 3VLDA 2CFZA 3CV0A 2J09A 3WXXA 2IFUA 3RO2A 3APDA 5AJDA 2OV8A 5JJ7A 3FTYA 4H7YA 4RG6A 1ELRA 2X6FA 4N3CA 4FA6A 3VLFA 2FBNA 1HX8A 3ULQA 3VLEA 4ILGA 3MX3A 4B8AA 2VSYA 3IBEA 2I1KA 3UT7A 4PS8A 4HXIA 2GGFA 3ZYMA 1IYGA 2VYIA 3ML9A 3Q4AB 3IKOB 1H2VC 1NP7A 4UI9C 1BPOA 3TL5A 2VGYA 3ASHA 2WQ6A 5LCWC 3RRUA 1Z3YA 1XGWA 4UWHA 5D0OD 2WXQA 3CKBA 4U07A 4G26A 5G04C 2AXZA 2V0PA 2YHEA 3MKQB 2FEZA 4HFGA 4AIFA 2XRYA 4I6EA 4DI4A 4HORA 2R5SA 4UQZA 4GMLA 4J8FA 2XHEA 3ZXSA 4AJWA 4BY6A 3EJNA 4JHJA 4B89A 3EIQC 2MHKA 3TG4A 4UI9K 2FF4A 3D9KA 4KBQA 1P5QA 3N71A 4EECA 2VSOE 2XPZA 5G05C 4OVVA 2HR2A 3FEXA 3KS2A 3UQ3A 5CMYA 1UG3A 2I6HA 2RD0A 2LAIA 4WNDA 5ARFA 3ZIMA 4B94A 4GA0A 3ASDA 1EYHA 1HO8A 4FHKA 4QFVA 3FTVA 4HS2A 1YA0A 4GZDA 2KM4A 2WQHA 1H2UA 3SBTB 5C1DA 2BF0X 3ZN3A 3LEWA 1TJCA 2KATA 4FULA 2XRZA 5HQ8A 4JHRA 5T3RA 1SZAA 3OXLA 5AYWD 3R9AB 5LP0A 3CHOA 4CGWA 5HI7A 5BUZA 2AVPA 5C2YA 3Q15A 1VDYA 2WM9A 3G2TA 4XKCA 5JJTA 3JQ1A 4LUNU 4EQFA 1H6KA 1N54A 3D3MA 1E8WA 1HH8A 3ZW3A 2WXGA 4APFA 4J0UA 4YVQC 4MLPA 1JPLA 1OWMA 4GU5A 2XCBA 1LF8A 4KVMA 3CSFA 2JEKA 4APOA 4CCAA 1SZ9A 5JJ6A 1HZ4A 3MYVA 4ATGA 2JLBA 4BT9A 3TG5A 4LEUA 3GZSA 5AJLA 4JVSA 4XIFA 1JWGA 4WUYA 5JHAA 4I43A 3IEGA 4AOFA 3U66A 3G2WA 2J4BA 4EZKA 4BWRA 2FI7A 4AXHA 2YINA 4CT0A 3CKCA 2IF4A 3QWWA 3MCXA 4WWPA 5FQ8A 4PS7A 2Y3AA 3PUJA 4GA1A 4I2ZA 4WNGA 1S0PA 3OXGA 3UUXA 4UI9J 2UY1A 2C0LA 2WB2A 1E7UA 3CSTA 5E75A 2L6JA 2CG3A 2Y4TA 3LKUA 4AY5A 3CVUA 3CK9A 3SD5A 3ZYQA 5M72A 5JHBA 3FTSA 3HVEA 1SQMA 3PZDA 4PS3A 2DCPA 3UX4A 3FFLA 4L2LA 1IHGA 4Q69A 2R59A 4BX9A 5J08A 2J07A 2WXIA 3SGHA 1HXIA 2J9QA 3FULA 3LPZA 4CDMA 4U63A 2FULA 1E96B 3G2UA 3AS8A 4BFRA 5G2NA 1PAQA 2WQ7A 3U4TA 3CVVA 4L23A 5FQ6A 1KT0A 4TRQA 3RU0A 5FQ7A 3TXMA 3PREA 5LFAA 1TJFA 2DBAA 4U04A 3FDHA 4W9RA 2PQNA 1EDUA 2V8SE 2VQ2A 4R7LA 3FUKA 4IRUA 3T8MA 2X6HA 4IYPA 4LRZA 2X6KA 4ANWA 4I17A 4OVUA 3CQGB 2WXOA 2A4ZA 3QWVA 3D9MA 1X5BA 3MKRA 5LOZA 4HVBA 5BPPA 4JC8A 5EKQD 2KZTB 4N3BA 2DIWA 2QY7A 1QZ2A 3BG0B 3QK0A 4Q96A 3L16A 5FZSA 3MV2B 5LX8A 4XI0A 2WXJA 3CVWA 4CGVA 3URZA 3U3WA 2LSUA 3RK6A 4DLQA 4A55A 1OUVA 3CQCB 3ASGA 4G25A 4HOUA 4ABNA 4DI3A 5BV1A 1IQUA 1INZA 3BG1B 1QQEA 3E4BA 3LVQE 4FU3A 3I5PA 5T4YA 4B8CB 4J8SA 2I1JA 3EDTB 3FTXA 3FTWA 2KC7A 1N52A 4PH4B 5EX3A 3GZ2A 1UJJA 3TGOA 3CLJA 3HDXA 4EZLA 3AS5A 2Y4UA 4ILHB 4KT6B 3FH5A 4CDRA 3PEUB 4N39A 1U3DA 2IU1A 5ENNA 1PC2A 2VSNA 3CGHA 2E2EA 1NA0A 2VTBB 4GZ5A 2WXFA 3ONKA 3PEVB 2BTDA 2V5FA 1EF1C 1QNFA 3ZGQA 2A5UA 2VGXB 4N3AA 4MRUA 4HOTA 2KCKA 2XQ0A 3B7TA 4WNEA 3L6AA 3ZEFA 2WPVA 4A3TA 3I3NA 4RSYA 3S2AA 4PDXA 4H7XA 3SZ7A 1W3BA 2PM6A 3FH8A 3LYAA 3TJPA 5KJLA 4G24A 2LSVA 1IQRA 3R7RA 4JXTA 3RRNB 3D9PA 2VSXE 1B89A 3FU5A 3Q49B 3ML8A 2GRLA 4FADA 3S7DA 5J90A 3D9JA 1DNPA 2PL2A 3FUDA 3IV0A 3JYSA 4LCTA 3UT4A 1ELKA 4F53A 2VTBA 4GB9A 5ANLA 2XPYA 4CEMA 3MA5A 3AS4A 3QJZA 1WAO1 4Y6WA 5ARGA 2IJGX 3AU5A 3D9IA 5G05J 4DPRA 3SF4A 2WXLA 1OWLA 3IHVA 3UMVA 2M63A 2IQCA 2GW1A 2KZTA 3FUHA 1JWFA 4XI9A 4GYWA 3ZFWA 4I1OB 4GAAA 3FU0A 5AIJA 1WY6A 2WXHA 3UPVA 5G04J 3R7QA 3I4RB 2X3MA 2J49A 1JUQA 1MQSA 2CFUA 5KJKA 2X6JA 1EPUA 2FO7A 2XEVA 3CVNA 4L7TA 5LCWJ 4AM9A 3CVXA 3P1UA 5DIZA 4WWNA 1E8YA 4GZCA 4NACA 4HOQA 3S7FA 3KEZA 4I9CA 1L5JA 2WVIA 4O6FA 4JEUA 3VTXA 3L22A 3FUMA 3FEYA 3PH0C 4CDNA 3G2VA 4J6IA 2I9CA 2VGXA 4UQYA 1U3CA 2IONA 3G2SA 3SHFA 1NZNA 5G55A 4N2SA 3CVQA 3ONLA 2WXMA 3CHQA 3MZLB 4ACKA 3GYZA 2EQXA 1UN8A 3HVEB 2PM7A 4B0ZA 3L17A 2XGOA 1GW6A 4ME2A 4G1TA 2LNIA 4NRHB 3PRZA 4GCOA 1Y8MA 3JUIA 2I2OA 2HM8A 4KVOA 3B7RL 1KT1A 4HLEA 4WAFA 1UW4B 3QC1A 2J4DA 3CVPA 2C0MA 4ANUA 3ZVVA 1HF8A 3DBSA 1OWNA 5KCMA 3FUNA 5FJYA 3O4ZA 3B7SA 4URKA 4FHJA 3U64A 2XCCA 2NXPA 4C0EA 5BW8C 4XZ4A 1E8XA 4BSXA 4K03A 4BX8A 5CHEE 3ESKA 4GYOA 5FT9A 1FVHA 4G2VA 3L08A 4FC8A 3OTNA 5CMWA 4IULA 3IHYA 4XE0A 4L1BA 1DVPA 3MJWA 3PS6A 1ZBPA 5FZQA 5EDSA 5DBKA 4JEHA 3TAXA 3CVYA 2MRIA 2LAHA 4J8DA 3FTUA 4EBAA 4DK5A 2WXPA 4U0SA 4FLHA 4JHKA 4PUCA 1NA3A 5FWQA 3ESLA 2XGSA 2WMNA 4GZ6A 3QB2A 4UWGA 3CIAA 3QDNA 4UWLA 2IOSA 4UWKA 3FUIA 3RRMB 1FVFA 3EHMA 4UQXA 2P58C 3SBSA 4EPZA 3JQ0A 4I9EA 1XNFA 5CCMA 4U0ZA 4ANXA 3LCAA 1E7VA 1Z3XA 4IN3B 2PQRA 1HU3A 4MKTA 3FY4A 1H19A 5D0QD 5FQ4A 4AVXA 4BT8A 3CHPA 3ZYKA 1WM5A 3D9LA 4YNDA 3LXUX 2AXVA 3AU4A 4M3OA 2GRMA 3NQPA 1E8ZA 1H2TC 4E6HA 5T8IA 4V3IA 4MS6A 5KJNA 4OYSA 3ZPJA 3QAQA 3B7UX 3FUFA 4AEZC 1HG5A 3OXFA 2HO1A 3ZRHA 1MHQA 3LY8A 2AW6A 3QOUA 4A1GA 3CVLA 2WXRA 3GZ1A 3QKYA 4DLOA 3CHRA 3MKQA 3OAWA 4C9BB 4I1MA 2XGMA 3L13A 5BV0A 4E85A 3BEEA 4GCNA 2WMOA 4FJZA 2IOLA 3UT8A 2ONDA 2ZU6B 2CG2A 1HFAA 4G11A 2V4LA 3ASFA 5FZRA 2OVFA 4AY6A 2L9BA 3MEKA 4Q94A 4A1SA 3KD7A 4U0UA 5BNWA 4AP2A 3PE3A 4UWFA 4P29A 3D9OA 3RJVA 3TXNA 3ZHEA 1FCHA 3QWPA 3CHSA 4KXKB 4BTBA 3S7JA 3LDZA 2L0TB 3LY9A 4TUUA 3SNXA 2Q7FA 2ILRA 2BUGA 5EX0A 3EHNA 2J08A 2LO6A 3T5XA 4JZYA 1HE8A 4N2QA 3EIJA 4J8EA 1ELWA 2CHZA 2C2LA 2X38A 4N5CA 4FJYA 4LERA 5FTPA 2CHXA 4I6GA 4NQ0A 4BTAA 3HIZA 4JA7A 4DJAA 3HHMA 3Q47B 4I6JA 3PUKA 3HYMB 4WNFA 3MGBA 4F3VA 4XKBA 3CK8A 2OOEA 2AWIA 4GPKA 3S7BA 1KLXA 2RG8A 3FUJA 2QFCA 4I2WA 4WWOA 3PNLB 4FLBA 4CRWA 2AXUA 4K0RA 4EZJA 3PVLA 1E90A 4I1AA 3KAEA 3ZYLA 3NZUA 4JPSA 3FU3A 2CHWA 3CHMA 4FP7A 3FTZA 5BT1A 1ZU2A 4ILIA 4EBAG 4JL0A 3B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ G;  1TJC A;  2KAT A;  2XCC A;  3EDT B;  3LY7 A;  2KCV A;  3Q5M A;  2KC7 A;  4GZ3 A;  3PE4 A;  4JHR A;  5EX3 A;  3GZ2 A;  5BW8 C;  3ZHE B;  5HQ8 A;  3TGO A;  3AS5 A;  2Y4U A;  3MV3 B;  2NC9 A;  5CHE E;  3OXL A;  5AYW D;  4CDR A;  3K9I A;  4GYY A;  3ESK A;  4N39 A;  4YVO A;  4GYO A;  5FT9 A;  3R9A B;  5KJM A;  4CGW A;  3NF1 A;  1PC2 A;  2VSN A;  4G2V A;  2E2E A;  5HI7 A;  1NA0 A;  2AVP A;  3GW4 A;  3Q15 A;  4GZ5 A;  5JJT A;  2V5F A;  4EQF A;  3ZGQ A;  2PZI A;  1ZBP A;  3PDN A;  4JA9 A;  1HH8 A;  5FZQ A;  5DBK A;  4J0U A;  4YVQ C;  2VGX B;  4N3A A;  3TAX A;  3FWV A;  4J8D A;  2KCK A;  4HOT A;  4WNE A;  2XCB A;  3RKV A;  3CEQ A;  4U0S A;  4APO A;  2WPV A;  1NA3 A;  5JJ6 A;  2XGS A;  1HZ4 A;  4GZ6 A;  3SZ7 A;  4H7X A;  5CCL A;  1W3B A;  3LYA A;  5KJL A;  2JLB A;  4BT9 A;  3TG5 A;  4G24 A;  2LSV A;  4LEU A;  2XPI A;  4XIF A;  3QDN A;  4WUY A;  3IEG A;  4UQX A;  1B89 A;  3Q49 B;  2YQ8 A;  2P58 C;  4BWR A;  2FI7 A;  3O48 A;  4G23 A;  4GA2 A;  3S7D A;  3JYS A;  2PL2 A;  4I9E A;  1XNF A;  5CCM A;  4U0Z A;  3CKC A;  2IF4 A;  3LCA A;  2HYZ A;  3QWW A;  4IN3 B;  2PQR A;  4BT8 A;  5D0Q D;  4GA1 A;  4I2Z A;  3MA5 A;  1WM5 A;  3AS4 A;  3OXG A;  4WNG A;  3UUX A;  1WAO 1;  4Y6W A;  4YND A;  5ARG A;  4UI9 J;  5G05 J;  2UY1 A;  2C0L A;  5A7D B;  2L6J A;  3SF4 A;  5A6C A;  1A17 A;  3LKU A;  2Y4T A;  3RO3 A;  3VTY A;  4AY5 A;  3RIB A;  2YHC A;  5KJN A;  4HOS A;  3ZPJ A;  3CK9 A;  4Y6C A;  5M72 A;  4GPK A;  2GW1 A;  3OXF A;  4XI9 A;  3ZFW A;  4GYW A;  3CK7 A;  2HO1 A;  3FFL A;  3LY8 A;  4RG9 A;  2UY1 B;  3QOU A;  1IHG A;  3CVL A;  3GZ1 A;  2KCL A;  3QKY A;  4KYO B;  3FP3 A;  2XGM A;  3CV0 A;  3UPV A;  5G04 J;  3WXX A;  2IFU A;  3BEE A;  4GCN A;  3RO2 A;  1HXI A;  2J9Q A;  2OND A;  3LPZ A;  5KJK A;  5JJ7 A;  2FO7 A;  2XEV A;  3CVN A;  4H7Y A;  4RG6 A;  1ELR A;  4N3C A;  4AM9 A;  5LCW J;  3ASF A;  2FBN A;  5DIZ A;  5FZR A;  3ULQ A;  1E96 B;  3MEK A;  4AY6 A;  3AS8 A;  4A1S A;  3KD7 A;  4U0U A;  5BNW A;  2VSY A;  3PE3 A;  4HOQ A;  3U4T A;  3S7F A;  3RJV A;  3ZHE A;  1KT0 A;  3RU0 A;  1FCH A;  2VYI A;  3QWP A;  1IYG A;  3Q4A B;  4KXK B;  4BTB A;  4I9C A;  3S7J A;  2DBA A;  3LY9 A;  4U04 A;  4O6F A;  4UI9 C;  4W9R A;  2VGY A;  3VTX A;  3ASH A;  2PQN A;  2Q7F A;  5LCW C;  2BUG A;  2VQ2 A;  5EX0 A;  5D0O D;  4N2Q A;  3CKB A;  4J8E A;  4U07 A;  4G26 A;  2VGX A;  1ELW A;  4UQY A;  2C2L A;  5G04 C;  4N5C A;  4I17 A;  1NZN A;  2FEZ A;  5FTP A;  4AIF A;  3QWV A;  4NQ0 A;  3MKR A;  4JA7 A;  3CVQ A;  5FJY A;  4BTA A;  4HOR A;  4N2S A;  2R5S A;  4UQZ A;  3Q47 B;  3GYZ A;  5EKQ D;  4J8F A;  4N3B A;  3HYM B;  4WNF A;  2XGO A;  1QZ2 A;  4ME2 A;  3CK8 A;  4F3V A;  5FZS A;  2OOE A;  2MHK A;  3MV2 B;  3S7B A;  4G1T A;  1KLX A;  4I2W A;  4UI9 K;  2QFC A;  4XI0 A;  3TG4 A;  2FF4 A;  2LNI A;  4KBQ A;  4NRH B;  3URZ A;  4CGV A;  1P5Q A;  4GCO A;  2LSU A;  3N71 A;  1Y8M A;  3U3W A;  5G05 C;  1OUV A;  2HR2 A;  3KS2 A;  3UQ3 A;  2I6H A;  4I1A A;  1KT1 A;  3ASG A;  3KAE A;  4G25 A;  4HOU A;  4WND A;  5ARF A;  4ABN A;  4B94 A;  4GA0 A;  3ASD A;  5BT1 A;  3E4B A;  1QQE A;  2C0M A;  3CVP A;  1YA0 A;  1ZU2 A;  2WQH A;  5C1D A;  4JL0 A;  3ZN3 A; 
#chains in the Genus database with same CATH topology
 2UWJ G;  3APC A;  3LY7 A;  3SFZ A;  1TNO A;  3Q5M A;  3UIO C;  2NC9 A;  3K9I A;  1Z6T A;  3W9G A;  3PNT B;  2GRN B;  2F37 A;  1OWO A;  3UM2 A;  1H0A A;  2XPI A;  2YQ8 A;  5B1A E;  2L0I A;  3O48 A;  4G23 A;  3FH7 A;  4RQI A;  1K1B A;  3FUE A;  1A17 A;  3VTY A;  4Y6C A;  3KSL A;  3V2O A;  3LS8 A;  3TWV A;  3DSX A;  3CV0 A;  2J09 A;  3APD A;  1K3Z D;  5AJD A;  5JJ7 A;  4RG6 A;  1IXV A;  3VLF A;  3KSQ A;  1HX8 A;  4DX1 A;  3VLE A;  2I1K A;  3UT7 A;  5CRV A;  3IKO B;  1NP7 A;  3TL5 A;  2WQ6 A;  3E32 A;  4YDW A;  1XGW A;  4U07 A;  3MKQ B;  2XZD G;  4HOR A;  3PZ1 A;  2XHE A;  4B89 A;  3EIQ C;  3SFY A;  3ABM E;  1O5M A;  4EEC A;  2VSO E;  2XPZ A;  3UQ3 A;  2GRR B;  4WND A;  4HI9 A;  2KM4 A;  1H2U A;  5HQ8 A;  4JHR A;  5T3R A;  1SZA A;  4U7E B;  2QZA A;  3OXL A;  5B1B E;  5HI7 A;  4XKC A;  2WM9 A;  3G2T A;  4LUN U;  4EQF A;  3J5P A;  2P9L G;  4YVQ C;  2XCB A;  1LF8 A;  4APO A;  1SZ9 A;  4ATG A;  4BT9 A;  4JVS A;  1UOH A;  5JHA A;  2J4B A;  3TWR A;  4EZK A;  1TN8 A;  2ETC A;  4WWP A;  2Y3A A;  3PUJ A;  4GA1 A;  4WNG A;  2EIL E;  2C0L A;  2L6J A;  4TXQ A;  3UKR G;  2Y4T A;  3ZYQ A;  5M72 A;  3FTS A;  3UX4 A;  1SQM A;  5FIN A;  4DX5 D;  2J07 A;  2QYJ A;  2WXI A;  3SGH A;  2J9Q A;  3FUL A;  5H7P A;  5CER B;  1E96 B;  1LD8 A;  2L6B A;  3U4T A;  2LXL A;  3CVV A;  3TWQ A;  2DBA A;  3FDH A;  3UM0 A;  2P9K G;  2V8S E;  3FUK A;  1N4R A;  4IRU A;  3T8M A;  4LRZ A;  1RW2 A;  1NI1 A;  2A4Z A;  1X5B A;  4HVB A;  2KZT B;  4N3B A;  2DIW A;  1QZ2 A;  5LX8 A;  3E4B A;  4U95 D;  2KC7 A;  1N52 A;  3TGO A;  3FH5 A;  5AQA A;  3ULE G;  4GZ5 A;  2WXF A;  3PEV B;  1QNF A;  3UM3 A;  2A5U A;  4MRU A;  2KCK A;  2WPV A;  4A3T A;  3I3N A;  3S2A A;  4J7W A;  1OT8 A;  1W3B A;  5KJL A;  3RRN B;  4JXT A;  3T9K A;  2VSX E;  4FAD A;  2GRL A;  3JYS A;  3IV0 A;  3DPY A;  5ANL A;  2XPY A;  2RFA A;  3HRA A;  4U96 D;  5JA4 D;  3DSU A;  2WXL A;  3EU5 A;  3UMV A;  2M63 A;  1JCQ A;  2GW1 A;  1MX4 A;  1N9A A;  2ZIR A;  2P9U G;  5KJK A;  2X6J A;  2XEV A;  4L7T A;  4AM9 A;  1RZ4 A;  1FT2 A;  3Q78 A;  3S7F A;  2Y69 E;  4I9C A;  2A5E A;  1FPP A;  3L22 A;  3PH0 C;  4J6I A;  3EUV A;  4UQY A;  3ONL A;  2WXM A;  3JXJ A;  4ACK A;  3L17 A;  2XGO A;  4ME2 A;  4F6R D;  4G1T A;  3PRZ A;  5AAR A;  3JUI A;  2I2O A;  1KT1 A;  4HLE A;  2J4D A;  2C0M A;  4ANU A;  3ZVV A;  1HF8 A;  3C3O A;  1OWN A;  3O4Z A;  1QBQ A;  4FHJ A;  4HNA D;  4BSX A;  4G2V A;  3L08 A;  3UM1 A;  5CMW A;  4XE0 A;  1DVP A;  3PS6 A;  1ZBP A;  5FZQ A;  5EDS A;  2MRI A;  2LAH A;  4PUC A;  1NA3 A;  5FWQ A;  3ESL A;  3QB2 A;  1U2V G;  1S70 B;  4UWK A;  4GTO A;  4I9E A;  2ZXW E;  3LCA A;  1HU3 A;  1N4S A;  3CHP A;  4GTV A;  3LXU X;  4M3O A;  3DWL G;  2LXM A;  1E8Z A;  4V3I A;  5KJN A;  4OYS A;  3ZPJ A;  1TNB A;  3QOU A;  2LUH A;  3HXB A;  3L13 A;  4GCN A;  3Q79 A;  2WMO A;  4FJZ A;  4TUM A;  3UT8 A;  3PZ2 A;  4G11 A;  2OVF A;  4AY6 A;  4Q94 A;  2GRO B;  4CYM D;  1H6O A;  1N94 A;  1BLX B;  1FCH A;  5AQ9 A;  3S7J A;  1V55 E;  1N4P A;  2BUG A;  5EX0 A;  4N2Q A;  4FJY A;  5FTP A;  4I6G A;  4BTA A;  4DJA A;  1S64 A;  2OOE A;  4GPK A;  2XS1 A;  3PNL B;  1E90 A;  4I1A A;  3KAE A;  4JPS A;  4GTS A;  2E0I A;  2KCV A;  5CEC B;  3TWT A;  2RKK A;  3NZS A;  4F1S A;  4GYY A;  4YVO A;  3U9W A;  1DC2 A;  5KJM A;  3T5V A;  3FU6 A;  2MOW A;  5EYP F;  3CR3 A;  2PZI A;  4HI8 A;  3RKV A;  3LJ3 A;  3CEQ A;  1V54 E;  4RVB A;  5AEN A;  1TEZ A;  1MYO A;  4KZC A;  4L2Y A;  2HYZ A;  3I4G A;  1UN9 A;  5A6C A;  2NSZ A;  3RO3 A;  3DPD A;  4HOS A;  3CK7 A;  3C98 A;  1UJK A;  2KCL A;  3FP3 A;  4ACL A;  3E37 A;  2CFZ A;  3WXX A;  3RO2 A;  2OV8 A;  4H7Y A;  1ELR A;  2X6F A;  2FBN A;  3AJI A;  3ULQ A;  5ENT D;  2VSY A;  4HQD A;  3NOC D;  3ZYM A;  4HXI A;  1IYG A;  2VYI A;  1H2V C;  2VGY A;  3ASH A;  3RRU A;  1Z3Y A;  5D0O D;  2V0P A;  5CED B;  3HXE A;  4HFG A;  4I6E A;  4AJW A;  4JHJ A;  2KBX A;  3TG4 A;  4UI9 K;  3D9K A;  4GTR A;  2HR2 A;  3KS2 A;  5CMY A;  4GA0 A;  1EYH A;  4FHK A;  4QFV A;  3NAW A;  4HS2 A;  1SA5 A;  2P9P G;  2WQH A;  5C1D A;  3ZN3 A;  3LEW A;  2XRZ A;  3DRA A;  3J5Q B;  4HRM B;  3CHO A;  1WDY A;  3Q15 A;  1VDY A;  3SFX A;  3D3M A;  2F0Y A;  4APF A;  4J0U A;  4MLP A;  1JPL A;  2JEK A;  4CCA A;  5JJ6 A;  4BET A;  4LEU A;  5AJL A;  4I43 A;  3G2W A;  4BWR A;  4CT0 A;  3DXM G;  3MCX A;  4PS7 A;  2VGE A;  1S0P A;  3UUX A;  4UI9 J;  2WB2 A;  2EIN E;  3CK9 A;  4U8V D;  2DCP A;  2DZO A;  1IHG A;  1O1R A;  4Q69 A;  4BX9 A;  5EID A;  1MX2 A;  1HXI A;  3AS8 A;  4L23 A;  3RU0 A;  5FQ7 A;  5LFA A;  1TJF A;  4U04 A;  5JMN D;  4HLL A;  3SQV A;  1EDU A;  5KNG A;  2VQ2 A;  4R7L A;  4IYP A;  3MKR A;  3BG0 B;  4Q96 A;  3QK0 A;  4XI0 A;  3CVW A;  3U3W A;  2LSU A;  4DLQ A;  1KPS B;  3CQC B;  3ZNG A;  1SVX A;  3ZXP A;  3LVQ E;  2OCC E;  4FU3 A;  5T4Y A;  3FTW A;  3AG1 E;  5EX3 A;  3HDX A;  4EZL A;  3AS5 A;  2Y4U A;  3AAA C;  4ILH B;  4CDR A;  4N39 A;  4U8Y D;  3ZU7 B;  1U3D A;  2GRP B;  1PC2 A;  3ONK A;  2H6G A;  4Z68 A;  2V5Q C;  4N3A A;  4BER A;  1NFI E;  4RSY A;  2PM6 A;  3TWW A;  4G24 A;  1IQR A;  3D9P A;  1B89 A;  3UT4 A;  2VTB A;  4GB9 A;  3HXD A;  1WAO 1;  4Y6W A;  5ARG A;  3AU5 A;  3SF4 A;  3IHV A;  4F1P A;  2Y1L E;  2IQC A;  2KZT A;  3SO8 A;  3ZFW A;  4DRX E;  4I1O B;  4GAA A;  3EHR A;  3UPV A;  1N0R A;  3I4R B;  2X3M A;  1X81 A;  2J49 A;  3E33 A;  2CFU A;  5BXU A;  3CVX A;  2H6H A;  4WWN A;  4GZC A;  4NAC A;  5AAO A;  2XEN A;  2WVI A;  4QQI A;  4O6F A;  4MBG A;  3EU9 A;  1U3C A;  3G2S A;  2R03 A;  4N2S A;  3MZL B;  3GYZ A;  1UN8 A;  1YYH A;  5CBN A;  2PM7 A;  3SY2 A;  2HM8 A;  3B7R L;  3QC1 A;  3CVP A;  3DBS A;  2ZGG A;  5BW8 C;  4XZ4 A;  1E8X A;  4K03 A;  4O1P A;  1TYQ G;  1IKN D;  1SW6 A;  3KEA A;  3RSE G;  3UTM A;  3TAX A;  3NB2 A;  4JHK A;  4K5B A;  2IOS A;  3FUI A;  3EHM A;  4EPZ A;  4U0Z A;  4ANX A;  1E7V A;  4MKT A;  4BT8 A;  2FO1 E;  5D0Q D;  1WM5 A;  4YND A;  1H2T C;  3UXG A;  3QAQ A;  3B7U X;  3FUF A;  4AEZ C;  3OXF A;  2AW6 A;  3QKY A;  4LNG A;  3MKQ A;  4I1M A;  4YDY A;  4GTP A;  3BEE A;  2ZU6 B;  2CG2 A;  5AN8 A;  1HFA A;  2L9B A;  3KD7 A;  5IY5 E;  3TXN A;  3CHS A;  1AP7 A;  3SNX A;  3UIN C;  3Q9N C;  4GTQ A;  4JZY A;  1HE8 A;  3EIJ A;  4J8E A;  2C2L A;  4N5C A;  2CHX A;  3HIZ A;  4JA7 A;  4ZFH A;  3DEP A;  4A63 B;  3PUK A;  2H6F A;  4WNF A;  4XKB A;  1KLX A;  3FUJ A;  2QFC A;  4CRW A;  3ZYL A;  3NZU A;  2CHW A;  5BT1 A;  3FTZ A;  1ZU2 A;  4ILI A;  3QAR A;  3NBN B;  2R17 C;  5A23 A;  5E76 A;  4NUR A;  2OVB A;  1OWP A;  3NF1 A;  3Q75 A;  3W9F A;  4KMO A;  3F6Q A;  3PDN A;  4DX7 D;  4JA9 A;  5EN5 D;  3D9N A;  3FWV A;  2XZT G;  4CT4 A;  3AG4 E;  4C0M A;  2YNQ A;  2OEW A;  5HS0 A;  5CCL A;  3LVR E;  4ANV A;  5D2M C;  3FHE A;  5EIB E;  4GA2 A;  4KZ0 A;  1Y6I A;  1IHB A;  3WG7 E;  4U8H A;  4M7C A;  5A7D B;  3ZUV B;  5BXO A;  3RIB A;  2YHC A;  3ENE A;  4N5Q A;  2UY1 B;  4KYO B;  1PY1 A;  3DXK G;  4D10 C;  3AG3 E;  4N3C A;  4ILG A;  4B8A A;  3IBE A;  3ABK E;  2GGF A;  4UI9 C;  1TNY A;  5LCW C;  4UWH A;  4G26 A;  5G04 C;  2YHE A;  2FEZ A;  2XRY A;  4J8Y A;  2R5S A;  3EJN A;  1N11 A;  2MHK A;  2FF4 A;  4KBQ A;  1P5Q A;  3N71 A;  5G05 C;  4OVV A;  3FEX A;  1UG3 A;  2RD0 A;  5ARF A;  3ASD A;  1TNU A;  3FTV A;  3Q9U C;  2BF0 X;  2KAT A;  3R9A B;  5LP0 A;  4K5C A;  4CGW A;  5BUZ A;  2AVP A;  3HXC A;  1N95 A;  3ASO E;  3ZW3 A;  2WXG A;  4LNU D;  4KVM A;  3CSF A;  1HZ4 A;  4YDE A;  3MYV A;  3TG5 A;  3GZS A;  4WUY A;  3IEG A;  4AOF A;  1K1A A;  3Q7F A;  2FI7 A;  3E30 A;  2YIN A;  2IF4 A;  3QWW A;  5FQ8 A;  2F8Y A;  2P9S G;  4I2Z A;  1BD8 A;  2UY1 A;  3CST A;  5E75 A;  5AQB A;  3LKU A;  4AY5 A;  3CVU A;  3SD5 A;  3HVE A;  4PS3 A;  3PZD A;  2ZIS A;  3FFL A;  1KZP A;  1BI7 B;  3DEO A;  4U63 A;  2FUL A;  3TWX A;  3G2U A;  4BFR A;  1S63 A;  5G2N A;  2WQ7 A;  4OAV B;  2BKK B;  4EHM A;  3TXM A;  3ISM C;  4G8K A;  5KBA A;  2MYO A;  2X6H A;  4I17 A;  4OVU A;  3CQG B;  3QWV A;  3D9M A;  5BPP A;  4JC8 A;  5EKQ D;  5FZS A;  3R9M A;  4CGV A;  3URZ A;  4HBD A;  3RK6 A;  4A55 A;  1OUV A;  4G25 A;  4DI3 A;  1INZ A;  2ZGD A;  1QQE A;  4J8S A;  2I1J A;  3EDT B;  5ENQ D;  3FTX A;  3L82 A;  4PH4 B;  3GZ2 A;  4JB8 P;  1UJJ A;  3CLJ A;  2HE0 A;  4ZHB A;  3PEU B;  2IU1 A;  5ENN A;  3X2Q E;  1NA0 A;  2BTD A;  2V5F A;  1EF1 C;  3ZGQ A;  2P9I G;  2VGX B;  4HOT A;  3LJN A;  2XQ0 A;  3B7T A;  4WNE A;  2QC9 A;  3ZEF A;  4PDX A;  3LYA A;  3FH8 A;  2LSV A;  3FU5 A;  3C72 A;  3Q49 B;  3ML8 A;  5J90 A;  3D9J A;  1DNP A;  2PL2 A;  3FUD A;  1ELK A;  4CEM A;  3QJZ A;  1TR4 A;  2IJG X;  4DPR A;  1OWL A;  3FUH A;  1JWF A;  3HG0 D;  3FU0 A;  5AIJ A;  1WY6 A;  1MJ0 A;  3JUE A;  1MQS A;  2FO7 A;  3P1U A;  5DIZ A;  4HOQ A;  3KEZ A;  3Q7A A;  1L5J A;  3VTX A;  1D8D A;  3SHF A;  2ETA A;  1Q2Z A;  1MZC A;  2EQX A;  1GW6 A;  3V30 A;  4NRH B;  4KVO A;  1WG0 A;  4WAF A;  4L9P A;  1NL4 A;  5KCM A;  3FUN A;  5FJY A;  3U64 A;  4BX8 A;  5CHE E;  4NIK A;  3ESK A;  1N4Q A;  4GYO A;  5FT9 A;  1FVH A;  4FC8 A;  1MX6 A;  1OCO E;  1A5E A;  3V31 A;  3CVY A;  4EBA A;  4DK5 A;  4U0S A;  4FLH A;  3TWS A;  3DSW A;  2V4H C;  2P2C P;  3CIA A;  3QDN A;  1FVF A;  2EIJ E;  1YCS B;  2P58 C;  4RLY A;  1OXJ A;  3JQ0 A;  1XNF A;  2DYS E;  1Z3X A;  4AVX A;  3HXF A;  3ZYK A;  4X8Q A;  3NQP A;  3ASN E;  5ENP D;  2BKG A;  5T8I A;  4MS6 A;  1HG5 A;  2R05 A;  3LY8 A;  3B7B A;  4A1G A;  3CVL A;  2WXR A;  5B3S E;  3GZ1 A;  4DLO A;  3CHR A;  3OAW A;  2XGM A;  4E85 A;  1G3N B;  1OCZ E;  5FZR A;  3MEK A;  5AQ7 A;  1K8K G;  3PE3 A;  4AP2 A;  4UWF A;  4P29 A;  3D9O A;  5HRY A;  3QWP A;  3EHQ A;  4KXK B;  3LY9 A;  2L0T B;  3EHN A;  2DYR E;  2LO6 A;  3T5X A;  1ELW A;  4GTM A;  1LD7 A;  4NQ0 A;  5EYL A;  2JAB A;  3Q47 B;  3HYM B;  3MGB A;  4F3V A;  2RG8 A;  4WWO A;  4GTT A;  4XEI G;  4EZJ A;  3PVL A;  1D8E A;  3PZ4 A;  4EBA G;  4JL0 A;  3B13 A;  4DX2 A;  2IY0 C;  2WXN A;  3PE4 A;  4GZ3 A;  4HB5 A;  3ZHE B;  4C48 B;  1BU9 A;  3MV3 B;  4XX5 A;  3P2B A;  3GW4 A;  2P9N G;  2R02 A;  2X6I A;  5CRU A;  4DX6 D;  3JCK C;  3L54 A;  5ANR A;  4AV7 A;  4GMJ A;  1HG2 A;  3L9T A;  3SI5 A;  1BI8 B;  1H6P A;  2DVW A;  1FT1 A;  4F7A A;  1HS6 A;  4A3V A;  3T8K A;  2WXK A;  2VJ8 A;  2GRQ B;  3APF A;  4JD2 G;  3QNK A;  2H6I A;  4RG9 A;  4TV3 A;  4JW1 A;  3VLD A;  3D9H A;  2IFU A;  4O60 A;  1ZB1 A;  5ENR D;  3FTY A;  4FA6 A;  3MX3 A;  4TXR A;  4PS8 A;  3ML9 A;  3Q4A B;  1BPO A;  4OAU C;  2WXQ A;  3CKB A;  3V2X A;  2AXZ A;  1OCC E;  4AIF A;  2XEH A;  4DI4 A;  4UQZ A;  4GML A;  4J8F A;  3ZXS A;  4BY6 A;  1OCR E;  2EIM E;  3DSS A;  1KZO A;  2I6H A;  2LAI A;  3ZIM A;  4B94 A;  4BES A;  1HO8 A;  1YA0 A;  4GZD A;  3SBT B;  1TJC A;  4FUL A;  1OY3 D;  3UKU G;  5AYW D;  5C2Y A;  5JJT A;  3JQ1 A;  1H6K A;  1N54 A;  4LSZ E;  2KXP C;  5CEA A;  1E8W A;  1HH8 A;  3ABL E;  4CZ2 D;  1OWM A;  4GU5 A;  3B95 A;  2JLB A;  4XIF A;  1JWG A;  1D9S A;  2F8X K;  1TN7 A;  3ZKJ A;  3U66 A;  2BED A;  4AXH A;  3CKC A;  4HRN A;  3NOG D;  2RFM A;  3OXG A;  1O1S A;  1E7U A;  2CG3 A;  5JHB A;  4L2L A;  1O1T A;  2ETB A;  2R59 A;  5J08 A;  3LPZ A;  4UUC A;  4CDM A;  2XEE A;  3DST A;  1PAQ A;  5FQ6 A;  1KT0 A;  4TRQ A;  3BUA A;  5CBO A;  2NYJ A;  3PRE A;  4DUI A;  4W9R A;  3BU8 A;  3AG2 E;  2PQN A;  3UIP C;  2X6K A;  2XS8 A;  4ANW A;  2WXO A;  5LOZ A;  1N0Q A;  2QY7 A;  3L16 A;  3MV2 B;  2WXJ A;  4K5A B;  3ASG A;  4HOU A;  4ABN A;  5BV1 A;  1IQU A;  3BG1 B;  3I5P A;  4B8C B;  4KT6 B;  2VSN A;  3CGH A;  2E2E A;  2VTB B;  1QYM A;  3L6A A;  3SZ7 A;  4H7X A;  3TJP A;  1JCS A;  5ENS D;  3R7R A;  3S7D A;  4F53 A;  4LCT A;  2IEJ A;  1JCR A;  5D66 A;  3MA5 A;  3AS4 A;  2PNN A;  3D9I A;  5G05 J;  1DCE A;  4TXP A;  4XI9 A;  4GYW A;  4G8L A;  2WXH A;  5ENO D;  3TWU A;  1SA4 A;  5G04 J;  3R7Q A;  5FIO A;  4GPM A;  1JUQ A;  1EPU A;  3CVN A;  5LCW J;  5EIL A;  1E8Y A;  3IXE A;  4B93 B;  4HRL A;  2AJA A;  4JEU A;  5ITZ F;  3JXI A;  3FUM A;  3FEY A;  4CDN A;  3G2V A;  2J8S D;  4ATZ D;  3DSV A;  2I9C A;  2VGX A;  2ION A;  1NZN A;  5G55 A;  4YDO A;  2QYU A;  3CVQ A;  3CHQ A;  3HVE B;  5KNH D;  4B0Z A;  3ULY A;  2B6C A;  2LNI A;  4GCO A;  1Y8M A;  4GMR A;  1UW4 B;  1LTX A;  4URK A;  3PZ3 A;  3B7S A;  2EIK E;  2XCC A;  3C3R A;  4LNB A;  2NXP A;  4C0E A;  3C5R A;  4BEP A;  3OTN A;  4IUL A;  3IHY A;  2B0O E;  4L1B A;  3MJW A;  3C3Q A;  5DBK A;  4JEH A;  4J8D A;  3FTU A;  2IO2 C;  2WXP A;  3BQO A;  2XGS A;  2WMN A;  4GZ6 A;  4UWG A;  5KWD A;  3E34 A;  1TNZ A;  4UWL A;  2DWZ A;  3RRM B;  1DCQ A;  4UQX A;  3SBS A;  5CCM A;  1TN6 A;  4IN3 B;  2PQR A;  3FY4 A;  1H19 A;  5FQ4 A;  3D9L A;  4O1O A;  2R2L A;  2AXV A;  3AU4 A;  2GRM A;  1Z5S C;  4E6H A;  2OEV A;  5HKP A;  3V79 K;  2HO1 A;  3ZRH A;  1MHQ A;  1YMP A;  4C9B B;  5BV0 A;  2Y0B G;  2IOL A;  2OND A;  3UI2 A;  2V4L A;  3ASF A;  5BNW A;  4A1S A;  4U0U A;  4BSZ B;  1AWC B;  3RJV A;  3ZHE A;  4BTB A;  3LDZ A;  4TUU A;  2Q7F A;  2ILR A;  2J08 A;  2CHZ A;  2X38 A;  4LER A;  4LG6 A;  3RAU A;  3HHM A;  2IO3 C;  4I6J A;  3CK8 A;  2AWI A;  3S7B A;  4I2W A;  2DZN A;  4FLB A;  2AXU A;  4K0R A;  3FU3 A;  3CHM A;  4FP7 A;  3Q73 A; 
#chains in the Genus database with same CATH homology
 3QAR A;  2UWJ G;  2E0I A;  3APC A;  3LY7 A;  3SFZ A;  2KCV A;  2R17 C;  3Q5M A;  2WXN A;  3PE4 A;  4GZ3 A;  5E76 A;  5A23 A;  3ZHE B;  4NUR A;  3MV3 B;  2NC9 A;  2OVB A;  3NZS A;  3K9I A;  4GYY A;  4F1S A;  1OWP A;  4YVO A;  3U9W A;  4XX5 A;  5KJM A;  3NF1 A;  1Z6T A;  3P2B A;  3GW4 A;  3T5V A;  4KMO A;  3FU6 A;  2MOW A;  2X6I A;  3CR3 A;  2PZI A;  3PDN A;  4JA9 A;  3JCK C;  3PNT B;  3D9N A;  3FWV A;  3L54 A;  3RKV A;  4CT4 A;  3LJ3 A;  3CEQ A;  4C0M A;  2YNQ A;  1OWO A;  5ANR A;  4RVB A;  4AV7 A;  1H0A A;  5AEN A;  5CCL A;  1TEZ A;  3LVR E;  4GMJ A;  1HG2 A;  4ANV A;  3FHE A;  2XPI A;  4KZC A;  4L2Y A;  2YQ8 A;  2L0I A;  3O48 A;  4G23 A;  4GA2 A;  4KZ0 A;  3SI5 A;  1Y6I A;  3FH7 A;  2HYZ A;  3I4G A;  1UN9 A;  4U8H A;  4F7A A;  3FUE A;  5A7D B;  1HS6 A;  4A3V A;  5A6C A;  1A17 A;  2NSZ A;  3RO3 A;  2WXK A;  3DPD A;  3VTY A;  3RIB A;  2YHC A;  4HOS A;  2VJ8 A;  3ENE A;  4Y6C A;  3APF A;  3LS8 A;  3CK7 A;  3QNK A;  3C98 A;  1UJK A;  2UY1 B;  4RG9 A;  4KYO B;  2KCL A;  4TV3 A;  3FP3 A;  4ACL A;  4JW1 A;  1PY1 A;  4D10 C;  3VLD A;  2CFZ A;  3CV0 A;  2J09 A;  3WXX A;  2IFU A;  3RO2 A;  3APD A;  5AJD A;  2OV8 A;  5JJ7 A;  3FTY A;  4H7Y A;  4RG6 A;  1ELR A;  2X6F A;  4N3C A;  4FA6 A;  3VLF A;  2FBN A;  1HX8 A;  3ULQ A;  3VLE A;  4ILG A;  3MX3 A;  4B8A A;  2VSY A;  3IBE A;  2I1K A;  3UT7 A;  4PS8 A;  4HXI A;  2GGF A;  3ZYM A;  1IYG A;  2VYI A;  3ML9 A;  3Q4A B;  3IKO B;  1H2V C;  1NP7 A;  4UI9 C;  1BPO A;  3TL5 A;  2VGY A;  3ASH A;  2WQ6 A;  5LCW C;  3RRU A;  1Z3Y A;  1XGW A;  4UWH A;  5D0O D;  2WXQ A;  3CKB A;  4U07 A;  4G26 A;  5G04 C;  2AXZ A;  2V0P A;  2YHE A;  3MKQ B;  2FEZ A;  4HFG A;  4AIF A;  2XRY A;  4I6E A;  4DI4 A;  4HOR A;  2R5S A;  4UQZ A;  4GML A;  4J8F A;  2XHE A;  3ZXS A;  4AJW A;  4BY6 A;  3EJN A;  4JHJ A;  4B89 A;  3EIQ C;  2MHK A;  3TG4 A;  4UI9 K;  2FF4 A;  3D9K A;  4KBQ A;  1P5Q A;  3N71 A;  4EEC A;  2VSO E;  2XPZ A;  5G05 C;  4OVV A;  2HR2 A;  3FEX A;  3KS2 A;  3UQ3 A;  5CMY A;  1UG3 A;  2I6H A;  2RD0 A;  2LAI A;  4WND A;  5ARF A;  3ZIM A;  4B94 A;  4GA0 A;  3ASD A;  1EYH A;  1HO8 A;  4FHK A;  4QFV A;  3FTV A;  4HS2 A;  1YA0 A;  4GZD A;  2KM4 A;  2WQH A;  1H2U A;  3SBT B;  5C1D A;  2BF0 X;  3ZN3 A;  3LEW A;  1TJC A;  2KAT A;  4FUL A;  2XRZ A;  5HQ8 A;  4JHR A;  5T3R A;  1SZA A;  3OXL A;  5AYW D;  3R9A B;  5LP0 A;  3CHO A;  4CGW A;  5HI7 A;  5BUZ A;  2AVP A;  5C2Y A;  3Q15 A;  1VDY A;  2WM9 A;  3G2T A;  4XKC A;  5JJT A;  3JQ1 A;  4LUN U;  4EQF A;  1H6K A;  1N54 A;  3D3M A;  1E8W A;  1HH8 A;  3ZW3 A;  2WXG A;  4APF A;  4J0U A;  4YVQ C;  4MLP A;  1JPL A;  1OWM A;  4GU5 A;  2XCB A;  1LF8 A;  4KVM A;  3CSF A;  2JEK A;  4APO A;  4CCA A;  1SZ9 A;  5JJ6 A;  1HZ4 A;  3MYV A;  4ATG A;  2JLB A;  4BT9 A;  3TG5 A;  4LEU A;  3GZS A;  5AJL A;  4JVS A;  4XIF A;  1JWG A;  4WUY A;  5JHA A;  4I43 A;  3IEG A;  4AOF A;  3U66 A;  3G2W A;  2J4B A;  4EZK A;  4BWR A;  2FI7 A;  4AXH A;  2YIN A;  4CT0 A;  3CKC A;  2IF4 A;  3QWW A;  3MCX A;  4WWP A;  5FQ8 A;  4PS7 A;  2Y3A A;  3PUJ A;  4GA1 A;  4I2Z A;  4WNG A;  1S0P A;  3OXG A;  3UUX A;  4UI9 J;  2UY1 A;  2C0L A;  2WB2 A;  1E7U A;  3CST A;  5E75 A;  2L6J A;  2CG3 A;  2Y4T A;  3LKU A;  4AY5 A;  3CVU A;  3CK9 A;  3SD5 A;  3ZYQ A;  5M72 A;  5JHB A;  3FTS A;  3HVE A;  1SQM A;  3PZD A;  4PS3 A;  2DCP A;  3UX4 A;  3FFL A;  4L2L A;  1IHG A;  4Q69 A;  2R59 A;  4BX9 A;  5J08 A;  2J07 A;  2WXI A;  3SGH A;  1HXI A;  2J9Q A;  3FUL A;  3LPZ A;  4CDM A;  4U63 A;  2FUL A;  1E96 B;  3G2U A;  3AS8 A;  4BFR A;  5G2N A;  1PAQ A;  2WQ7 A;  3U4T A;  3CVV A;  4L23 A;  5FQ6 A;  1KT0 A;  4TRQ A;  3RU0 A;  5FQ7 A;  3TXM A;  3PRE A;  5LFA A;  1TJF A;  2DBA A;  4U04 A;  3FDH A;  4W9R A;  2PQN A;  1EDU A;  2V8S E;  2VQ2 A;  4R7L A;  3FUK A;  4IRU A;  3T8M A;  2X6H A;  4IYP A;  4LRZ A;  2X6K A;  4ANW A;  4I17 A;  4OVU A;  3CQG B;  2WXO A;  2A4Z A;  3QWV A;  3D9M A;  1X5B A;  3MKR A;  5LOZ A;  4HVB A;  5BPP A;  4JC8 A;  5EKQ D;  2KZT B;  4N3B A;  2DIW A;  2QY7 A;  1QZ2 A;  3BG0 B;  3QK0 A;  4Q96 A;  3L16 A;  5FZS A;  3MV2 B;  5LX8 A;  4XI0 A;  2WXJ A;  3CVW A;  4CGV A;  3URZ A;  3U3W A;  2LSU A;  3RK6 A;  4DLQ A;  4A55 A;  1OUV A;  3CQC B;  3ASG A;  4G25 A;  4HOU A;  4ABN A;  4DI3 A;  5BV1 A;  1IQU A;  1INZ A;  3BG1 B;  1QQE A;  3E4B A;  3LVQ E;  4FU3 A;  3I5P A;  5T4Y A;  4B8C B;  4J8S A;  2I1J A;  3EDT B;  3FTX A;  3FTW A;  2KC7 A;  1N52 A;  4PH4 B;  5EX3 A;  3GZ2 A;  1UJJ A;  3TGO A;  3CLJ A;  3HDX A;  4EZL A;  3AS5 A;  2Y4U A;  4ILH B;  4KT6 B;  3FH5 A;  4CDR A;  3PEU B;  4N39 A;  1U3D A;  2IU1 A;  5ENN A;  1PC2 A;  2VSN A;  3CGH A;  2E2E A;  1NA0 A;  2VTB B;  4GZ5 A;  2WXF A;  3ONK A;  3PEV B;  2BTD A;  2V5F A;  1EF1 C;  1QNF A;  3ZGQ A;  2A5U A;  2VGX B;  4N3A A;  4MRU A;  4HOT A;  2KCK A;  2XQ0 A;  3B7T A;  4WNE A;  3L6A A;  3ZEF A;  2WPV A;  4A3T A;  3I3N A;  4RSY A;  3S2A A;  4PDX A;  4H7X A;  3SZ7 A;  1W3B A;  2PM6 A;  3FH8 A;  3LYA A;  3TJP A;  5KJL A;  4G24 A;  2LSV A;  1IQR A;  3R7R A;  4JXT A;  3RRN B;  3D9P A;  2VSX E;  1B89 A;  3FU5 A;  3Q49 B;  3ML8 A;  2GRL A;  4FAD A;  3S7D A;  5J90 A;  3D9J A;  1DNP A;  2PL2 A;  3FUD A;  3IV0 A;  3JYS A;  4LCT A;  3UT4 A;  1ELK A;  4F53 A;  2VTB A;  4GB9 A;  5ANL A;  2XPY A;  4CEM A;  3MA5 A;  3AS4 A;  3QJZ A;  1WAO 1;  4Y6W A;  5ARG A;  2IJG X;  3AU5 A;  3D9I A;  5G05 J;  4DPR A;  3SF4 A;  2WXL A;  1OWL A;  3IHV A;  3UMV A;  2M63 A;  2IQC A;  2GW1 A;  2KZT A;  3FUH A;  1JWF A;  4XI9 A;  4GYW A;  3ZFW A;  4I1O B;  4GAA A;  3FU0 A;  5AIJ A;  1WY6 A;  2WXH A;  3UPV A;  5G04 J;  3R7Q A;  3I4R B;  2X3M A;  2J49 A;  1JUQ A;  1MQS A;  2CFU A;  5KJK A;  2X6J A;  1EPU A;  2FO7 A;  2XEV A;  3CVN A;  4L7T A;  5LCW J;  4AM9 A;  3CVX A;  3P1U A;  5DIZ A;  4WWN A;  1E8Y A;  4GZC A;  4NAC A;  4HOQ A;  3S7F A;  3KEZ A;  4I9C A;  1L5J A;  2WVI A;  4O6F A;  4JEU A;  3VTX A;  3L22 A;  3FUM A;  3FEY A;  3PH0 C;  4CDN A;  3G2V A;  4J6I A;  2I9C A;  2VGX A;  4UQY A;  1U3C A;  2ION A;  3G2S A;  3SHF A;  1NZN A;  5G55 A;  4N2S A;  3CVQ A;  3ONL A;  2WXM A;  3CHQ A;  3MZL B;  4ACK A;  3GYZ A;  2EQX A;  1UN8 A;  3HVE B;  2PM7 A;  4B0Z A;  3L17 A;  2XGO A;  1GW6 A;  4ME2 A;  4G1T A;  2LNI A;  4NRH B;  3PRZ A;  4GCO A;  1Y8M A;  3JUI A;  2I2O A;  2HM8 A;  4KVO A;  3B7R L;  1KT1 A;  4HLE A;  4WAF A;  1UW4 B;  3QC1 A;  2J4D A;  3CVP A;  2C0M A;  4ANU A;  3ZVV A;  1HF8 A;  3DBS A;  1OWN A;  5KCM A;  3FUN A;  5FJY A;  3O4Z A;  3B7S A;  4URK A;  4FHJ A;  3U64 A;  2XCC A;  2NXP A;  4C0E A;  5BW8 C;  4XZ4 A;  1E8X A;  4BSX A;  4K03 A;  4BX8 A;  5CHE E;  3ESK A;  4GYO A;  5FT9 A;  1FVH A;  4G2V A;  3L08 A;  4FC8 A;  3OTN A;  5CMW A;  4IUL A;  3IHY A;  4XE0 A;  4L1B A;  1DVP A;  3MJW A;  3PS6 A;  1ZBP A;  5FZQ A;  5EDS A;  5DBK A;  4JEH A;  3TAX A;  3CVY A;  2MRI A;  2LAH A;  4J8D A;  3FTU A;  4EBA A;  4DK5 A;  2WXP A;  4U0S A;  4FLH A;  4JHK A;  4PUC A;  1NA3 A;  5FWQ A;  3ESL A;  2XGS A;  2WMN A;  4GZ6 A;  3QB2 A;  4UWG A;  3CIA A;  3QDN A;  4UWL A;  2IOS A;  4UWK A;  3FUI A;  3RRM B;  1FVF A;  3EHM A;  4UQX A;  2P58 C;  3SBS A;  4EPZ A;  3JQ0 A;  4I9E A;  1XNF A;  5CCM A;  4U0Z A;  4ANX A;  3LCA A;  1E7V A;  1Z3X A;  4IN3 B;  2PQR A;  1HU3 A;  4MKT A;  3FY4 A;  1H19 A;  5D0Q D;  5FQ4 A;  4AVX A;  4BT8 A;  3CHP A;  3ZYK A;  1WM5 A;  3D9L A;  4YND A;  3LXU X;  2AXV A;  3AU4 A;  4M3O A;  2GRM A;  3NQP A;  1E8Z A;  1H2T C;  4E6H A;  5T8I A;  4V3I A;  4MS6 A;  5KJN A;  4OYS A;  3ZPJ A;  3QAQ A;  3B7U X;  3FUF A;  4AEZ C;  1HG5 A;  3OXF A;  2HO1 A;  3ZRH A;  1MHQ A;  3LY8 A;  2AW6 A;  3QOU A;  4A1G A;  3CVL A;  2WXR A;  3GZ1 A;  3QKY A;  4DLO A;  3CHR A;  3MKQ A;  3OAW A;  4C9B B;  4I1M A;  2XGM A;  3L13 A;  5BV0 A;  4E85 A;  3BEE A;  4GCN A;  2WMO A;  4FJZ A;  2IOL A;  3UT8 A;  2OND A;  2ZU6 B;  2CG2 A;  1HFA A;  4G11 A;  2V4L A;  3ASF A;  5FZR A;  2OVF A;  4AY6 A;  2L9B A;  3MEK A;  4Q94 A;  4A1S A;  3KD7 A;  4U0U A;  5BNW A;  4AP2 A;  3PE3 A;  4UWF A;  4P29 A;  3D9O A;  3RJV A;  3TXN A;  3ZHE A;  1FCH A;  3QWP A;  3CHS A;  4KXK B;  4BTB A;  3S7J A;  3LDZ A;  2L0T B;  3LY9 A;  4TUU A;  3SNX A;  2Q7F A;  2ILR A;  2BUG A;  5EX0 A;  3EHN A;  2J08 A;  2LO6 A;  3T5X A;  4JZY A;  1HE8 A;  4N2Q A;  3EIJ A;  4J8E A;  1ELW A;  2CHZ A;  2C2L A;  2X38 A;  4N5C A;  4FJY A;  4LER A;  5FTP A;  2CHX A;  4I6G A;  4NQ0 A;  4BTA A;  3HIZ A;  4JA7 A;  4DJA A;  3HHM A;  3Q47 B;  4I6J A;  3PUK A;  3HYM B;  4WNF A;  3MGB A;  4F3V A;  4XKB A;  3CK8 A;  2OOE A;  2AWI A;  4GPK A;  3S7B A;  1KLX A;  2RG8 A;  3FUJ A;  2QFC A;  4I2W A;  4WWO A;  3PNL B;  4FLB A;  4CRW A;  2AXU A;  4K0R A;  4EZJ A;  3PVL A;  1E90 A;  4I1A A;  3KAE A;  3ZYL A;  3NZU A;  4JPS A;  3FU3 A;  2CHW A;  3CHM A;  4FP7 A;  3FTZ A;  5BT1 A;  1ZU2 A;  4ILI A;  4EBA G;  4JL0 A;  3B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...