4GA1A

Structure of the n-terminal domain of nup358
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
143
structure length
143
Chain Sequence
RSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYMEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPMQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAVYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Pan troglodytes
molecule tags Transport protein
molecule keywords E3 SUMO-PROTEIN LIGASE RANBP2
total genus 56
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga1A00
2MHKA 4UI9C 5JJTA 4XI9A 2XGOA 2VSNA 4CGVA 3Q49B 4HOUA 4ABNA 5FTPA 3SF4A 3VTYA 4N2QA 5BT1A 2KCKA 2AVPA 3ASGA 4JA9A 4LEUA 3QKYA 3UUXA 2XPIA 1HZ4A 4I2ZA 2FEZA 2LSVA 3NF1A 2HYZA 3KS2A 3IEGA 3KAEA 4W9RA 4GZ6A 5D0QD 3LY7A 2FO7A 4G26A 4GA1A 4J8DA 3UPVA 4APOA 4B94A 4F3VA 3BEEA 4XI0A 4HOTA 4YVQC 2KCVA 2LSUA 4BWRA 3QWPA 5D0OD 3AS8A 4N3BA 3CVQA 4JA7A 4BT8A 4HOSA 2IFUA 3RU0A 1OUVA 4RG6A 5FJYA 3RKVA 5FZQA 1QQEA 5CCLA 3LY9A 3ESKA 3Q47B 3PDNA 4BTAA 3FWVA 3FP3A 4J0UA 3RO2A 4H7YA 3JYSA 2QFCA 3U4TA 2UWJG 5DBKA 2UY1A 3O48A 4YNDA 3SZ7A 3TGOA 5C1DA 3MV3B 3N71A 4Y6CA 1NA0A 4I2WA 4I17A 4HOQA 1PC2A 2R5SA 2XGMA 1ELRA 2DBAA 3CKBA 3GZ1A 3QOUA 3E4BA 4U04A 4AM9A 5LCWJ 5EX0A 3K9IA 3KD7A 5JJ6A 4AY6A 2KCLA 2Y4TA 3LPZA 2XGSA 3LYAA 2PL2A 4GCNA 1KT1A 5FZRA 4GYOA 4WNDA 3OXLA 3URZA 4G2VA 3VTXA 2XEVA 5HQ8A 2WQHA 2GW1A 4KBQA 3TG4A 2P58C 4UQZA 3CKCA 5A6CA 4WNGA 2XCCA 3LY8A 2LNIA 4N3AA 3PE4A 2E2EA 4GCOA 3CK8A 4O6FA 4U0SA 5AYWD 5HI7A 4UQXA 5FZSA 3GZ2A 4CGWA 1A17A 4UQYA 4JHRA 5DIZA 4N39A 3EDTB 3S7JA 2C0LA 1B89A 4NQ0A 4GYWA 4YVOA 2FBNA 4EQFA 3HYMB 1NZNA 3MKRA 1HH8A 3QDNA 4WNEA 2VGYA 3QWWA 5KJNA 3ULQA 1ELWA 3CK7A 1TJCA 4WNFA 3QWVA 2VYIA 5ARGA 5FT9A 3RIBA 3LCAA 4UI9J 3Q4AB 5G05C 1ZU2A 5BNWA 2YQ8A 3MA5A 3OXFA 5BW8C 3S7BA 3ZFWA 5CHEE 4KXKB 3ASDA 3MEKA 1HXIA 5JJ7A 2V5FA 3S7FA 4I9CA 2ONDA 5LCWC 3RO3A 4A1SA 2KC7A 3ZPJA 5M72A 3CVPA 3AS5A 3UQ3A 4WUYA 2PZIA 2C0MA 5KJLA 4N2SA 2VSYA 1E96B 4GYYA 5G04C 3TAXA 2BUGA 4J8FA 4H7XA 5G05J 4XIFA 5CCMA 4KYOB 1XNFA 3ZHEB 2Y4UA 3CEQA 2JLBA 3CK9A 3CVNA 4IN3B 4G1TA 3LKUA 3ZN3A 4GZ5A 3GW4A 1NA3A 4GZ3A 2I6HA 2HR2A 4RG9A 1YA0A 2HO1A 4N3CA 5KJKA 2PQNA 3PE3A 2OOEA 1P5QA 2NC9A 2VGXB 2VQ2A 3MV2B 4ME2A 4G23A 3WXXA 2YHCA 4Y6WA 4AY5A 4HORA 5EX3A 4G24A 4CDRA 4U0ZA 5ARFA 1KT0A 1Y8MA 3CV0A 1IYGA 4N5CA 2WPVA 3ASHA 5A7DB 1W3BA 4UI9K 1IHGA 4U0UA 2FI7A 3Q5MA 3AS4A 1WAO1 5KJMA 3CVLA 5G04J 2PQRA 3GYZA 3OXGA 3ZHEA 3U3WA 2XCBA 2KATA 3Q15A 4I1AA 4U07A 2FF4A 2J9QA 2Q7FA 1QZ2A 2C2LA 4JL0A 4G25A 3ASFA 2IF4A 3S7DA 4GPKA 4J8EA 4I9EA 4GA2A 3R9AB 4BT9A 1KLXA 3FFLA 4AIFA 1FCHA 3RJVA 3ZGQA 4BTBA 4GA0A 3TG5A 1ZBPA 5EKQD 1WM5A 2UY1B 2L6JA 2VGXA 4NRHB
chains in the Genus database with same CATH superfamily
5A23A 3KEAA 3CHRA 3TWUA 3TGOA 2P9SG 2HYZA 3MKQB 3IEGA 4JD2G 3DPDA 2J8SD 5ITZF 5D0OD 4N3BA 5CECB 4JHKA 4UWLA 4OVVA 2EIJE 4HOQA 1AP7A 4XKBA 1N52A 1QNFA 4EBAG 2VTBB 2IONA 2J49A 5LOZA 3SNXA 2P58C 1H2UA 4I1OB 3L16A 2IOSA 4I6EA 4GTVA 3ULYA 1FVFA 4EQFA 4E85A 3QDNA 4ANVA 3PEUB 3DRAA 2YQ8A 2X6FA 3ASDA 3ZNGA 3ZPJA 4U63A 2P9IG 1HFAA 1IKND 1E8WA 3CEQA 3DSXA 4JB8P 2I6HA 4L1BA 4HORA 3DBSA 5EX3A 1QBQA 3APCA 1SA5A 1U3DA 2XZDG 3E34A 1KT0A 4WWNA 3D9LA 4CDNA 4UI9K 5CMYA 2C2LA 3CQCB 4D10C 1JCSA 3R9AB 3VLFA 3TG5A 3RAUA 1KZOA 1TN7A 5KWDA 3DEOA 3PVLA 3VTYA 3FH8A 3E33A 4XEIG 4F3VA 4GTTA 3APDA 1GW6A 1H2VC 5T4YA 3ONKA 2WXJA 3RKVA 3FDHA 3SQVA 3UM2A 4PS8A 4WAFA 4MLPA 5B1AE 3SZ7A 4XZ4A 2I9CA 1LF8A 1PC2A 2XGMA 4FADA 5JJ6A 4AY6A 3KD7A 4DI4A 2WXQA 4YDOA 4KBQA 2GROB 2XZTG 4JEHA 3EJNA 5FZSA 4K03A 5AAOA 1HS6A 2C0LA 4NQ0A 3EHQA 3DXKG 4GMLA 3EHMA 3D9KA 2R02A 4NIKA 5T3RA 4BSXA 2CG3A 4GTSA 1OWMA 3ABKE 3LDZA 3BQOA 4GYYA 2VJ8A 3D9IA 4XIFA 2J09A 3FTVA 3UT7A 3GW4A 2L6BA 2WB2A 4FHJA 2ETBA 5CMWA 4YDYA 2XPYA 2XEHA 2WXGA 4U0ZA 1O5MA 5EYLA 4EHMA 4N5CA 2WPVA 3EUVA 5A7DB 1AWCB 2F8XK 4U0UA 3B7TA 4DX2A 2KATA 4GZDA 3AG4E 4HI8A 3FU3A 4L9PA 5FQ8A 4GA0A 3DEPA 2XEEA 4F1PA 2B0OE 1H2TC 2KCKA 5FQ7A 4YDWA 2OEWA 4FJZA 2FO7A 2MRIA 1KPSB 3KSQA 2XRZA 3V2OA 1H6OA 3ESKA 2RFMA 3PDNA 3DXMG 3NAWA 3JYSA 4GTQA 5B3SE 1D8EA 5ANRA 2B6CA 5AQ9A 2V0PA 4QQIA 5LCWJ 3TWVA 5CEDB 1FVHA 4UQXA 3BG1B 3RK6A 4GMJA 2ZGGA 2RG8A 1INZA 3P2BA 3BU8A 3V30A 4F1SA 5EIBE 3HIZA 3ZFWA 3RSEG 2V5FA 3DSSA 4U96D 4L23A 2VSYA 2XRYA 2Y69E 2KZTA 5AQAA 1OWOA 4N3CA 1OT8A 3PS6A 5J90A 4G24A 1DC2A 5AENA 4FLBA 3CV0A 3NB2A 2P9KG 4RSYA 4K0RA 3LS8A 4GTMA 4NRHB 3V2XA 2XENA 4UI9C 2CHZA 5BXUA 1TN6A 4AOFA 3SFXA 4N2QA 5BT1A 4JA9A 4E6HA 1OWPA 2BKKB 5D0QD 3LY7A 3FEXA 5AIJA 4XI0A 3FH5A 4G11A 4A55A 5E76A 3JQ0A 3UM0A 5FQ4A 5CRVA 2DIWA 2FULA 4JHJA 4XE0A 5HKPA 4CRWA 4GMRA 2LNIA 4U0SA 3LVQE 2FO1E 5JHAA 5DIZA 4N39A 2GRNB 2P2CP 4DUIA 3UT8A 3FY4A 3RRMB 3ULQA 1ELWA 3OTNA 2VYIA 3L08A 3Q4AB 3ABLE 4JXTA 3EHNA 4I9CA 4HNAD 4N2SA 5CCMA 4TV3A 3T5XA 1RW2A 4DPRA 1E8XA 2DZOA 3LKUA 4EZJA 4DK5A 5LFAA 4JZYA 4AY5A 4U8YD 3B7SA 5ENNA 4FJYA 3ZYQA 1FT1A 3AS4A 2NYJA 1DCQA 2J9QA 4DX6D 3DWLG 4TRQA 1IHBA 2IQCA 3RJVA 2BKGA 1LD7A 2UY1B 2L6JA 4U7EB 1EDUA 2WXFA 1DNPA 4FULA 3ASOE 2A5EA 4I2ZA 4IYPA 3NOGD 1H6KA 4WWOA 4KMOA 3CSTA 5E75A 3CVUA 3FP3A 1TNUA 2IEJA 4YNDA 2XPZA 5AN8A 2HE0A 4HRNA 3ZYLA 4HLLA 1TNYA 1JWFA 3LJNA 4GYOA 4Q69A 3AU5A 4L2YA 3MX3A 4B93B 3EDTB 5B1BE 3ML8A 2KXPC 3FTSA 3MKRA 1HH8A 1Z5SC 3CHSA 3UT4A 3QWWA 1TJCA 3QNKA 3RIBA 4DX1A 5BNWA 1O1TA 5T8IA 3CVPA 1WDYA 3T8KA 3TAXA 4UWGA 1XNFA 3LVRE 4IULA 3PRZA 3I4GA 1Z3XA 3PE3A 3TWWA 4AV7A 1UJKA 4BERA 2GRQB 1JCRA 1IHGA 3ASNE 3PZDA 3U3WA 3VLDA 2X6KA 4BX9A 2VGEA 1U2VG 4BSZB 4BY6A 4ACLA 3R9MA 2AVPA 2LAHA 2LSVA 3G2VA 1MX2A 4APOA 1E8YA 4F6RD 3IHVA 4TUUA 3HXCA 4JPSA 4EECA 4J0UA 1BI8B 4Y6CA 2J4BA 4O1OA 3CKBA 5BV0A 2DVWA 2R05A 3VTXA 3DPYA 2XEVA 2QZAA 3R7QA 3ONLA 3CQGB 3HXBA 2RFAA 3TJPA 1ELKA 4JHRA 4ANUA 4BX8A 4DX7D 4YVOA 4B89A 3P1UA 4OVUA 4YDEA 2LXMA 4UI9J 5BV1A 2OVFA 1N4PA 2PZIA 2BUGA 4K5AB 3NOCD 3UXGA 5LP0A 1UJJA 4BESA 3FUNA 4GZ5A 3B7BA 2PQNA 4EZKA 3WXXA 4ME2A 3L9TA 2P9UG 3D3MA 3HG0D 5BXOA 3Q15A 4U8VD 3QARA 4I1AA 3UIPC 2FF4A 3FUDA 4G25A 2BF0X 4WWPA 4I6JA 4CCAA 4L2LA 3UTMA 2VGXA 4A3TA 2XGOA 5AARA 4V3IA 1OCOE 2NXPA 3PUJA 3EHRA 4M3OA 2J07A 2H6GA 1BPOA 5HS0A 1HG5A 3QWPA 3AG3E 1IQRA 2F0YA 5FJYA 4J8YA 1TNZA 3PZ3A 4GTOA 4H7YA 3U4TA 4C9BB 3D9HA 1MQSA 4O1PA 1OY3D 2AWIA 1H19A 5ENOD 3AJIA 2IO3C 4B8AA 5AYWD 3G2WA 2E2EA 5HI7A 2ETAA 4LNBA 1N4RA 1A5EA 1O1SA 1UN8A 1PY1A 2X38A 1K8KG 3FU0A 4HBDA 3ESLA 3MA5A 3Q9UC 2BTDA 4A1SA 3Q7FA 3ZRHA 2P9NG 4IN3B 1LD8A 3ZN3A 1JUQA 2J4DA 4GZ3A 3E37A 2HO1A 3IKOB 1P5QA 3SBTB 3E30A 1MHQA 5ARFA 4G8LA 1UW4B 4ACKA 3ABME 1HU3A 5G04J 2PQRA 1L5JA 4B8CB 2Q7FA 2IF4A 3PREA 1FCHA 3QJZA 1SZ9A 3BUAA 3Q49B 4HOUA 3SF4A 4RLYA 4W9RA 1O1RA 2PM6A 4J8DA 3UPVA 4A1GA 3B13A 1EF1C 4C0EA 4ILIA 4BEPA 2DYRE 3Q75A 3LJ3A 2IJGX 1DVPA 1YCSB 3CHMA 3I4RB 2CFZA 3FUKA 3O48A 3ML9A 3SFYA 2R5SA 3K9IA 3FUIA 3UKRG 5IY5E 3URZA 3CVWA 1MX6A 1N54A 3TG4A 3CKCA 3NZUA 2AXUA 4K5BA 2F37A 2LAIA 4DX5D 5ENRD 1D9SA 3FTXA 4GYWA 4BETA 2L0IA 3UX4A 2EIME 2VGYA 4PS3A 4OAUC 4WNFA 1BU9A 2H6HA 4LNUD 2CFUA 4KXKB 2DWZA 1SW6A 3O4ZA 2ZISA 3UMVA 4GZCA 4H7XA 5G05J 3Q78A 3Q73A 4ZHBA 4ILGA 2CHWA 4FA6A 3FEYA 4FU3A 2GRLA 5ENTD 2FI7A 3CVYA 3GYZA 3OXGA 2XCBA 3C3QA 5CEAA 4U07A 1N0RA 4QFVA 5FWQA 3FTUA 2X6IA 1HG2A 4ABNA 4ATGA 2YINA 4RQIA 3NBNB 2FEZA 2EINE 1YYHA 4GA1A 3JUEA 4HOSA 4OYSA 2J08A 3I3NA 4MS6A 1QQEA 4LG6A 4F53A 1U3CA 3FU5A 5EYPF 3KEZA 1NL4A 2BEDA 4HQDA 4AP2A 4TXRA 4XX5A 4FLHA 3U64A 1OCRE 3C3RA 3HDXA 2GW1A 3J5QB 2WXMA 4KT6B 5D2MC 4GCOA 3CK8A 5ANLA 1FPPA 4CGWA 1B89A 2DCPA 3AG2E 1NP7A 3CK7A 1UN9A 3G2UA 3UINC 3JUIA 2PM7A 5AQBA 4J7WA 1NI1A 1HO8A 1EPUA 4Q94A 2I2OA 2HR2A 3FU6A 3MV2B 2VGXB 1Z3YA 3ISMC 2AW6A 2XS8A 1TEZA 1V54E 4GAAA 4BFRA 2DZNA 4IRUA 4HXIA 3WG7E 2P9PG 3SFZA 1E90A 3S7DA 3LXUX 3S2AA 4PDXA 3FWVA 3RRUA 3L82A 3MJWA 3ASGA 2WQ6A 3HXFA 2QYUA 2I1KA 5CCLA 3FUFA 2HM8A 2F8YA 4MBGA 2GRRB 5C1DA 1NA0A 3B7RL 2KZTB 2DBAA 4U04A 1HF8A 2PNNA 2V5QC 3ZVVA 1KT1A 3SHFA 1BD8A 3C5RA 4LSZE 3ZUVB 3D9OA 4DI3A 2IO2C 1JPLA 3LY8A 4ZFHA 4Q96A 2DYSE 2WMNA 2I1JA 2WXOA 3HYMB 3ZYKA 3PEVB 4FP7A 4WNEA 1ZU2A 5FIOA 4I6GA 2MOWA 1K1BA 5M72A 1OCCE 3QC1A 1S63A 4N5QA 4KVOA 3IBEA 3ZHEB 3CVNA 4O60A 4JC8A 1NA3A 2OOEA 2LO6A 3MKQA 3Q7AA 4A63B 5HRYA 4M7CA 2V4LA 3FHEA 3CVVA 3JXJA 4I9EA 4BT9A 3FFLA 4CDMA 2ZGDA 1WM5A 5CBNA 2MHKA 4L7TA 5ENQD 5JJTA 2EILE 1SA4A 5AJDA 4LEUA 3BG0B 3CGHA 3NF1A 3KS2A 3KAEA 4GZ6A 3HRAA 2LSUA 4J8SA 2H6FA 3ZXSA 4FHKA 2UWJG 4RVBA 4HI9A 4AM9A 3E4BA 5H7PA 3HVEA 5EX0A 2KCLA 2Y4TA 2XGSA 2WXKA 1TN8A 5FZRA 4WNDA 1VDYA 1N11A 4WNGA 4I1MA 3T5VA 3UM1A 3TXMA 4AXHA 1MZCA 4APFA 2P9LG 3LCAA 4JEUA 3DSVA 5FINA 3ZYMA 4PH4B 3T8MA 2C0MA 5KJLA 4G8KA 3EU5A 5G04C 1UG3A 2Y4UA 5BPPA 1WG0A 2WXLA 5C2YA 2ZXWE 3MGBA 4BTAA 5ENPD 4CDRA 1X81A 4C0MA 2WMOA 1MX4A 2M63A 3W9GA 3SO8A 4R7LA 3HVEB 1KLXA 4GPMA 3UIOC 3ZGQA 1EYHA 5CERB 3F6QA 3EIQC 3D9NA 1N94A 4UWKA 1RZ4A 3L54A 2OCCE 3UUXA 3QKYA 2LUHA 1DCEA 1Q2ZA 4B94A 2A5UA 4JA7A 4BT8A 2IFUA 3IV0A 5KBAA 4LUNU 3LY9A 4LCTA 4ANXA 1S0PA 2OEVA 3FTZA 2E0IA 4I17A 4U95D 4A3VA 3QOUA 3FUMA 3Q9NC 5AJLA 3TWSA 2GRMA 2R17C 1MJ0A 4O6FA 5EDSA 4HLEA 1S64A 2AJAA 2RKKA 3EU9A 3TWTA 1A17A 4HFGA 4K5CA 3RRNB 3FUEA 4Z68A 1JWGA 2YHEA 1NZNA 3FTYA 4EPZA 3PNLB 3D9PA 2ILRA 3MEKA 2WXNA 3SI5A 1IXVA 3AAAC 2V8SE 4PS7A 3PUKA 1OXJA 3ZXPA 2JLBA 4G1TA 5LX8A 3EIJA 1H6PA 1TNBA 3ZU7B 2QYJA 2Y1LE 4ANWA 4C48B 2JABA 2NSZA 4HB5A 3I5PA 4UWFA 3ASFA 4NACA 4MRUA 3L13A 2JEKA 1XGWA 3G2TA 3GZSA 2L0TB 3DSTA 3Q5MA 1SZAA 2WM9A 4I43A 1TR4A 1OCZE 4DLQA 1N95A 2R59A 3AS8A 1BLXB 3CVQA 3C98A 2Y0BG 4RG6A 3OAWA 3Q47B 5AQ7A 3V31A 4X8QA 4ATZD 2R03A 3FH7A 3GZ1A 1S70B 3Q79A 5EIDA 4MKTA 2GGFA 3OXLA 4G2VA 4N3AA 3NZSA 4TUMA 4UQYA 4GTRA 3V79K 4HS2A 2VSXE 3S7JA 4CT4A 1TYQG 2X6JA 1JCQA 1HX8A 4F7AA 1G3NB 3QAQA 2QC9A 3OXFA 3S7FA 5LCWC 2KC7A 4LERA 2XQ0A 2ZU6B 1E96B 4RG9A 4EZLA 3PZ2A 4G23A 2YHCA 1V55E 2QY7A 3ASHA 2R2LA 3CVLA 3ZHEA 4TXPA 3IHYA 1OWNA 2ETCA 3D9JA 3JXIA 4GA2A 1PAQA 3G2SA 1N4SA 4P29A 2IU1A 4BTBA 3CIAA 5BUZA 4XI9A 3ZEFA 4CGVA 3L17A 5D66A 2AXVA 3DSUA 5KNHD 2A4ZA 5CRUA 3SBSA 2OVBA 3ZW3A 2KM4A 1ZB1A 3CHPA 4G26A 3BEEA 4YVQC 3CLJA 4BWRA 5KCMA 3W9FA 3QK0A 2QFCA 1QYMA 2L9BA 4OAVB 1WY6A 3MZLB 2X3MA 3MYVA 4DJAA 4GCNA 4KZ0A 5G2NA 5HQ8A 2RD0A 2WQHA 2AXZA 3TXNA 1MYOA 5JJ7A 3TWRA 3SD5A 3GZ2A 4UUCA 2WVIA 1N0QA 2WXPA 4GB9A 5G55A 4LRZA 4B0ZA 1N4QA 3D9MA 2EQXA 3QWVA 5ARGA 2YNQA 1YMPA 2X6HA 1IQUA 3TWQA 2WQ7A 3QB2A 2ONDA 1OWLA 3KSLA 5CBOA 4KYOB 4PUCA 2WXHA 3U66A 3ULEG 1K1AA 5JMND 3T9KA 1N9AA 5KJKA 4ILHB 3PH0C 4JVSA 2VTBA 3APFA 3X2QE 2XHEA 3UKUG 4DLOA 4AVXA 1Y8MA 3CHQA 1W3BA 1WAO1 2V4HC 4KZCA 4AIFA 1ZBPA 3SGHA 2CG2A 2IY0C 3B7UX 4J6IA 2XPIA 4U8HA 1TNOA 2IOLA 4HOTA 2MYOA 3C3OA 3RU0A 4GTPA 2WXRA 4NURA 5FZQA 2ZIRA 3RO2A 5EN5D 5DBKA 2UY1A 3VLEA 3FUJA 1E8ZA 3N71A 3ENEA 2VSOE 3LYAA 4CYMD 1D8DA 3PZ1A 5A6CA 4JW1A 1SVXA 3RO3A 3FUHA 3PE4A 3AG1E 4CT0A 3MCXA 3E32A 1TJFA 1E7VA 5KJNA 4HRMB 3UI2A 5G05C 4LNGA 3S7BA 5CHEE 1BI7B 1HXIA 5ENSD 3L22A 5EILA 1Z6TA 2NC9A 3ZIMA 2VQ2A 4Y6WA 1K3ZD 2WXIA 3PNTB 5KJMA 3CR3A 3ZKJA 3L6AA 4J8EA 3FTWA 3HHMA 5EKQD 3CVXA 2EIKE 4AJWA 1FT2A 2VSNA 4GU5A 1H0AA 2LXLA 5FTPA 1HZ4A 3LEWA 4AEZC 1NFIE 5JA4D 2Y3AA 2KCVA 3UM3A 3J5PA 1OUVA 3IXEA 4DRXE 3MV3B 4I2WA 3CSFA 3DSWA 1ELRA 1X5BA 1KZPA 3LPZA 2PL2A 3SY2A 3NQPA 3HXEA 3B95A 4TXQA 4UQZA 3U9WA 4HVBA 2XCCA 2XS1A 4URKA 2FBNA 1HE8A 5FT9A 4EBAA 3TL5A 4FC8A 4HRLA 3C72A 5BW8C 5J08A 1UOHA 3JCKC 1LTXA 3CHOA 5JHBA 2GRPB 3AS5A 3UQ3A 4WUYA 4XKCA 4J8FA 2OV8A 3PZ4A 2H6IA 3AU4A 3CK9A 3R7RA 5FQ6A 1SQMA 1YA0A 1E7UA 3JQ1A 2KBXA 2CHXA 4UWHA 1IYGA 4CZ2D 3FULA 4CEMA 4KVMA 5KNGA 1QZ2A 4GPKA 4JL0A 3TWXA 1Y6IA 3HXDA
chains in the Genus database with same CATH topology
2X6IA 5A23A 1HG2A 1EDUA 1SZAA 4ABNA 2WXFA 1DNPA 3CHRA 4FULA 4ATGA 2YINA 3TGOA 4I2ZA 2FEZA 2WM9A 4IYPA 2HYZA 3MKQB 4I43A 3IEGA 3DPDA 1H6KA 4WWOA 4GA1A 4DLQA 2R59A 4KMOA 5D0OD 3AS8A 4N3BA 3CVQA 3C98A 4HOSA 4OYSA 3CSTA 2J08A 4RG6A 3I3NA 4MS6A 4JHKA 3OAWA 5E75A 1QQEA 3Q47B 4F53A 4UWLA 3CVUA 1U3CA 3FP3A 3FU5A 3KEZA 4OVVA 4YNDA 2XPZA 4AP2A 4HOQA 3FH7A 3GZ1A 4XX5A 4XKBA 1N52A 4FLHA 1QNFA 3U64A 4EBAG 3ZYLA 1JWFA 2GGFA 4MKTA 4GYOA 3OXLA 4G2VA 2VTBB 3HDXA 2IONA 3AU5A 4Q69A 2J49A 5LOZA 2GW1A 3SNXA 2P58C 2WXMA 4L2YA 1H2UA 3MX3A 4KT6B 4N3AA 4GCOA 4I1OB 3CK8A 3NZSA 5ANLA 3L16A 4CGWA 2IOSA 4I6EA 4UQYA 3EDTB 4HS2A 2VSXE 1FVFA 1B89A 3ML8A 3S7JA 4CT4A 4EQFA 2X6JA 2DCPA 3FTSA 3MKRA 1HH8A 3CHSA 3QDNA 4E85A 1HX8A 3QWWA 3UT4A 1NP7A 3CK7A 1TJCA 4ANVA 3PEUB 3QNKA 1UN9A 3QAQA 3RIBA 4F7AA 3G2UA 5BNWA 2YQ8A 3OXFA 2X6FA 3JUIA 2PM7A 5T8IA 3ASDA 3S7FA 5LCWC 2KC7A 3ZPJA 3CVPA 4LERA 4U63A 1HFAA 2XQ0A 2ZU6B 3TAXA 1E96B 1HO8A 1EPUA 4UWGA 1XNFA 1E8WA 3CEQA 4Q94A 2I2OA 3LVRE 4IULA 2I6HA 2HR2A 4RG9A 3PRZA 3I4GA 3FU6A 1Z3XA 3PE3A 4EZLA 3MV2B 2VGXB 4L1BA 1UJKA 4AV7A 1Z3YA 4G23A 2YHCA 4HORA 3DBSA 5EX3A 2AW6A 2QY7A 3APCA 1TEZA 1U3DA 1KT0A 4GAAA 4WWNA 3D9LA 4BFRA 3ASHA 4CDNA 4UI9K 1IHGA 3PZDA 4IRUA 3CVLA 3ZHEA 3U3WA 3VLDA 4HXIA 5CMYA 3IHYA 3SFZA 1OWNA 1E90A 2C2LA 3CQCB 3D9JA 3S7DA 4D10C 3LXUX 3S2AA 4GA2A 3R9AB 1PAQA 3G2SA 4PDXA 2X6KA 4P29A 2IU1A 4BTBA 3VLFA 3TG5A 3CIAA 3FWVA 4BX9A 5BUZA 4XI9A 3RRUA 3MJWA 3ZEFA 3PVLA 4CGVA 4BY6A 4ACLA 3L17A 3VTYA 2AXVA 3ASGA 2A4ZA 2AVPA 3FH8A 2LAHA 2LSVA 2OVBA 3G2VA 3SBSA 3ZW3A 2WQ6A 2KM4A 3CHPA 4G26A 4APOA 4F3VA 1E8YA 3BEEA 4YVQC 3CLJA 3APDA 1GW6A 2I1KA 4BWRA 1H2VC 5T4YA 3ONKA 3IHVA 2WXJA 4TUUA 4JPSA 3RKVA 3FDHA 5CCLA 5KCMA 4EECA 3QK0A 4J0UA 3FUFA 2HM8A 4PS8A 2QFCA 4WAFA 4MLPA 3SZ7A 2L9BA 4XZ4A 1WY6A 5C1DA 4Y6CA 1NA0A 2I9CA 3B7RL 2J4BA 1LF8A 2XGMA 1PC2A 2KZTB 2DBAA 2X3MA 1HF8A 3CKBA 3MZLB 3MYVA 4U04A 4DJAA 5JJ6A 4AY6A 3KD7A 4DI4A 5BV0A 4GCNA 2WXQA 4KZ0A 5G2NA 1KT1A 3ZVVA 4B8AA 5HQ8A 3SHFA 3VTXA 2XEVA 2RD0A 2WQHA 4KBQA 2AXZA 3D9OA 3TXNA 3R7QA 3ONLA 4DI3A 3LY8A 1JPLA 5JJ7A 3CQGB 4Q96A 4JEHA 3EJNA 2WMNA 3SD5A 5FZSA 3GZ2A 4K03A 1ELKA 2I1JA 3TJPA 2WXOA 1HS6A 4JHRA 4ANUA 4BX8A 2WVIA 2C0LA 2WXPA 4GB9A 4NQ0A 4LRZA 5G55A 4YVOA 4B0ZA 3HYMB 4B89A 4GMLA 3EHMA 3D9KA 3ZYKA 3P1UA 3D9MA 3PEVB 4FP7A 4OVUA 4WNEA 2EQXA 3QWVA 5ARGA 2YNQA 5T3RA 4UI9J 5BV1A 1ZU2A 1IQUA 2X6HA 4BSXA 2OVFA 4I6GA 2CG3A 2MOWA 2WQ7A 3QB2A 2ONDA 1OWMA 5M72A 3LDZA 1OWLA 2PZIA 3QC1A 4GYYA 4KVOA 2BUGA 2VJ8A 3D9IA 4XIFA 3IBEA 4KYOB 4PUCA 3ZHEB 2WXHA 5LP0A 3U66A 2J09A 1UJJA 3CVNA 3FTVA 3FUNA 4GZ5A 4JC8A 3GW4A 1NA3A 3UT7A 5KJKA 2WB2A 4FHJA 2PQNA 5CMWA 2OOEA 3PH0C 4ILHB 3WXXA 2XPYA 4EZKA 4ME2A 2LO6A 4JVSA 3MKQA 2VTBA 3APFA 2WXGA 2XHEA 4U0ZA 4DLOA 4AVXA 1Y8MA 3D3MA 4N5CA 2WPVA 3CHQA 5A7DB 1W3BA 4U0UA 2V4LA 1WAO1 3B7TA 2KATA 3Q15A 4GZDA 3FHEA 3QARA 4I1AA 3CVVA 2FF4A 3FUDA 4G25A 3FU3A 2BF0X 4I9EA 4BT9A 3FFLA 4KZCA 4WWPA 4AIFA 4CDMA 5FQ8A 4GA0A 4I6JA 4L2LA 4CCAA 1ZBPA 1WM5A 2VGXA 3SGHA 2CG2A 2MHKA 4L7TA 5JJTA 4A3TA 1H2TC 2XGOA 3B7UX 4J6IA 4V3IA 5AJDA 2KCKA 2NXPA 4LEUA 3PUJA 5FQ7A 2XPIA 3BG0B 3CGHA 3NF1A 4M3OA 3KS2A 2J07A 3KAEA 4GZ6A 4FJZA 4U8HA 2FO7A 2MRIA 2IOLA 1BPOA 4HOTA 1HG5A 2LSUA 3QWPA 2XRZA 3RU0A 1IQRA 4J8SA 5FJYA 2WXRA 4NURA 5FZQA 3ESKA 3ZXSA 3PDNA 4FHKA 3RO2A 4H7YA 3JYSA 3U4TA 2UWJG 5DBKA 2UY1A 3VLEA 3FUJA 1E8ZA 5ANRA 4C9BB 3N71A 1MQSA 4RVBA 2V0PA 4AM9A 3E4BA 5LCWJ 3HVEA 3ENEA 5EX0A 2KCLA 2VSOE 2AWIA 2Y4TA 2XGSA 3LYAA 2WXKA 1H19A 5FZRA 4WNDA 1VDYA 5A6CA 4JW1A 1FVHA 4I1MA 4WNGA 3FUHA 5AYWD 3G2WA 3PE4A 2E2EA 3RO3A 3T5VA 5HI7A 4UQXA 3TXMA 3BG1B 3RK6A 4GMJA 2RG8A 4AXHA 3P2BA 4APFA 1INZA 1UN8A 4CT0A 3MCXA 1PY1A 2X38A 1TJFA 4F1SA 1E7VA 5KJNA 3FU0A 3HIZA 3LCAA 4JEUA 5G05C 3ESLA 3MA5A 3S7BA 3ZFWA 5CHEE 2BTDA 1HXIA 3ZYMA 2V5FA 4A1SA 4PH4B 3T8MA 3ZRHA 2C0MA 5KJLA 4L23A 2VSYA 5G04C 2XRYA 1UG3A 2Y4UA 2KZTA 4IN3B 3ZN3A 1JUQA 2J4DA 3L22A 5BPPA 4GZ3A 1OWOA 2HO1A 2WXLA 4N3CA 5C2YA 3MGBA 1Z6TA 3IKOB 1P5QA 2NC9A 3ZIMA 2VQ2A 4BTAA 3SBTB 4Y6WA 3PS6A 5J90A 1MHQA 4G24A 4CDRA 5ARFA 5AENA 1UW4B 4FLBA 3CV0A 2WXIA 3PNTB 4ACKA 4C0MA 5KJMA 1HU3A 5G04J 2WMOA 2PQRA 3CR3A 2M63A 3L6AA 1L5JA 4B8CB 2Q7FA 4R7LA 2IF4A 3HVEB 4J8EA 4RSYA 1KLXA 3PREA 1FCHA 3ZGQA 4K0RA 1EYHA 3LS8A 3FTWA 3HHMA 3QJZA 5EKQD 3CVXA 1SZ9A 4NRHB 4UI9C 3EIQC 2CHZA 3D9NA 4AJWA 4AOFA 2VSNA 4GU5A 3Q49B 1H0AA 4HOUA 4UWKA 5FTPA 3L54A 3SF4A 4N2QA 5BT1A 4JA9A 3UUXA 4E6HA 1OWPA 3QKYA 1HZ4A 3LEWA 4W9RA 5D0QD 3LY7A 4AEZC 4FADA 2PM6A 4J8DA 3UPVA 4A1GA 3FEXA 4B94A 5AIJA 4XI0A 2Y3AA 2KCVA 3FH5A 3B13A 1EF1C 4G11A 2A5UA 4C0EA 4JA7A 4ILIA 4BT8A 4A55A 2IFUA 3IV0A 1OUVA 4LUNU 3LJ3A 5E76A 3JQ0A 2IJGX 3LY9A 1DVPA 3CHMA 5FQ4A 3I4RB 2CFZA 4LCTA 4ANXA 1S0PA 3FUKA 3O48A 3ML9A 2DIWA 3MV3B 4I2WA 3CSFA 2E0IA 3FTZA 4I17A 4A3VA 2R5SA 1ELRA 2FULA 1X5BA 3QOUA 3K9IA 3LPZA 2PL2A 3FUMA 3FUIA 5AJLA 3NQPA 3URZA 4JHJA 4XE0A 3CVWA 1N54A 3TG4A 2GRMA 4UQZA 3CKCA 3U9WA 3NZUA 4CRWA 2R17C 4HVBA 2XCCA 2LNIA 2AXUA 4O6FA 5EDSA 4HLEA 4U0SA 3LVQE 1A17A 4HFGA 2LAIA 5JHAA 5DIZA 4N39A 3RRNB 3FUEA 3FTXA 4GYWA 4URKA 1JWGA 2FBNA 2YHEA 1NZNA 3FTYA 2L0IA 3UT8A 3FY4A 3UX4A 4EPZA 2VGYA 1HE8A 4PS3A 1ELWA 5FT9A 4WNFA 3RRMB 3OTNA 2VYIA 3PNLB 3ULQA 4EBAA 3D9PA 3L08A 4FC8A 3TL5A 3Q4AB 5BW8C 2ILRA 5J08A 2CFUA 4KXKB 3JCKC 2WXNA 3MEKA 3CHOA 4JXTA 3EHNA 4I9CA 3O4ZA 3SI5A 5JHBA 2V8SE 3AS5A 3UQ3A 4PS7A 3PUKA 4WUYA 3UMVA 4N2SA 4XKCA 5CCMA 4J8FA 4GZCA 4H7XA 4TV3A 5G05J 3T5XA 2OV8A 4DPRA 1E8XA 2JLBA 3AU4A 3CK9A 4G1TA 3LKUA 3EIJA 3R7RA 5FQ6A 4DK5A 1SQMA 4EZJA 5LX8A 5LFAA 4ILGA 1YA0A 1E7UA 2CHWA 3JQ1A 4JZYA 4AY5A 4ANWA 4FA6A 3B7SA 3FEYA 4FU3A 2CHXA 5ENNA 4UWHA 1IYGA 2GRLA 4FJYA 3ZYQA 2FI7A 3AS4A 3CVYA 2NSZA 3FULA 4CEMA 3GYZA 3OXGA 4KVMA 2XCBA 3I5PA 4UWFA 4U07A 2J9QA 1QZ2A 4GPKA 4JL0A 3ASFA 4TRQA 4NACA 4MRUA 3L13A 2IQCA 1XGWA 2JEKA 3G2TA 3GZSA 1Y6IA 4QFVA 5FWQA 3RJVA 3FTUA 2L0TB 2UY1B 2L6JA 3Q5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHK A;  4UI9 C;  5JJT A;  4XI9 A;  2XGO A;  2VSN A;  4CGV A;  3Q49 B;  4HOU A;  4ABN A;  5FTP A;  3SF4 A;  3VTY A;  4N2Q A;  5BT1 A;  2KCK A;  2AVP A;  3ASG A;  4JA9 A;  4LEU A;  3QKY A;  3UUX A;  2XPI A;  1HZ4 A;  4I2Z A;  2FEZ A;  2LSV A;  3NF1 A;  2HYZ A;  3KS2 A;  3IEG A;  3KAE A;  4W9R A;  4GZ6 A;  5D0Q D;  3LY7 A;  2FO7 A;  4G26 A;  4GA1 A;  4J8D A;  3UPV A;  4APO A;  4B94 A;  4F3V A;  3BEE A;  4XI0 A;  4HOT A;  4YVQ C;  2KCV A;  2LSU A;  4BWR A;  3QWP A;  5D0O D;  3AS8 A;  4N3B A;  3CVQ A;  4JA7 A;  4BT8 A;  4HOS A;  2IFU A;  3RU0 A;  1OUV A;  4RG6 A;  5FJY A;  3RKV A;  5FZQ A;  1QQE A;  5CCL A;  3LY9 A;  3ESK A;  3Q47 B;  3PDN A;  4BTA A;  3FWV A;  3FP3 A;  4J0U A;  3RO2 A;  4H7Y A;  3JYS A;  2QFC A;  3U4T A;  2UWJ G;  5DBK A;  2UY1 A;  3O48 A;  4YND A;  3SZ7 A;  3TGO A;  5C1D A;  3MV3 B;  3N71 A;  4Y6C A;  1NA0 A;  4I2W A;  4I17 A;  4HOQ A;  1PC2 A;  2R5S A;  2XGM A;  1ELR A;  2DBA A;  3CKB A;  3GZ1 A;  3QOU A;  3E4B A;  4U04 A;  4AM9 A;  5LCW J;  5EX0 A;  3K9I A;  3KD7 A;  5JJ6 A;  4AY6 A;  2KCL A;  2Y4T A;  3LPZ A;  2XGS A;  3LYA A;  2PL2 A;  4GCN A;  1KT1 A;  5FZR A;  4GYO A;  4WND A;  3OXL A;  3URZ A;  4G2V A;  3VTX A;  2XEV A;  5HQ8 A;  2WQH A;  2GW1 A;  4KBQ A;  3TG4 A;  2P58 C;  4UQZ A;  3CKC A;  5A6C A;  4WNG A;  2XCC A;  3LY8 A;  2LNI A;  4N3A A;  3PE4 A;  2E2E A;  4GCO A;  3CK8 A;  4O6F A;  4U0S A;  5AYW D;  5HI7 A;  4UQX A;  5FZS A;  3GZ2 A;  4CGW A;  1A17 A;  4UQY A;  4JHR A;  5DIZ A;  4N39 A;  3EDT B;  3S7J A;  2C0L A;  1B89 A;  4NQ0 A;  4GYW A;  4YVO A;  2FBN A;  4EQF A;  3HYM B;  1NZN A;  3MKR A;  1HH8 A;  3QDN A;  4WNE A;  2VGY A;  3QWW A;  5KJN A;  3ULQ A;  1ELW A;  3CK7 A;  1TJC A;  4WNF A;  3QWV A;  2VYI A;  5ARG A;  5FT9 A;  3RIB A;  3LCA A;  4UI9 J;  3Q4A B;  5G05 C;  1ZU2 A;  5BNW A;  2YQ8 A;  3MA5 A;  3OXF A;  5BW8 C;  3S7B A;  3ZFW A;  5CHE E;  4KXK B;  3ASD A;  3MEK A;  1HXI A;  5JJ7 A;  2V5F A;  3S7F A;  4I9C A;  2OND A;  5LCW C;  3RO3 A;  4A1S A;  2KC7 A;  3ZPJ A;  5M72 A;  3CVP A;  3AS5 A;  3UQ3 A;  4WUY A;  2PZI A;  2C0M A;  5KJL A;  4N2S A;  2VSY A;  1E96 B;  4GYY A;  5G04 C;  3TAX A;  2BUG A;  4J8F A;  4H7X A;  5G05 J;  4XIF A;  5CCM A;  4KYO B;  1XNF A;  3ZHE B;  2Y4U A;  3CEQ A;  2JLB A;  3CK9 A;  3CVN A;  4IN3 B;  4G1T A;  3LKU A;  3ZN3 A;  4GZ5 A;  3GW4 A;  1NA3 A;  4GZ3 A;  2I6H A;  2HR2 A;  4RG9 A;  1YA0 A;  2HO1 A;  4N3C A;  5KJK A;  2PQN A;  3PE3 A;  2OOE A;  1P5Q A;  2NC9 A;  2VGX B;  2VQ2 A;  3MV2 B;  4ME2 A;  4G23 A;  3WXX A;  2YHC A;  4Y6W A;  4AY5 A;  4HOR A;  5EX3 A;  4G24 A;  4CDR A;  4U0Z A;  5ARF A;  1KT0 A;  1Y8M A;  3CV0 A;  1IYG A;  4N5C A;  2WPV A;  3ASH A;  5A7D B;  1W3B A;  4UI9 K;  1IHG A;  4U0U A;  2FI7 A;  3Q5M A;  3AS4 A;  1WAO 1;  5KJM A;  3CVL A;  5G04 J;  2PQR A;  3GYZ A;  3OXG A;  3ZHE A;  3U3W A;  2XCB A;  2KAT A;  3Q15 A;  4I1A A;  4U07 A;  2FF4 A;  2J9Q A;  2Q7F A;  1QZ2 A;  2C2L A;  4JL0 A;  4G25 A;  3ASF A;  2IF4 A;  3S7D A;  4GPK A;  4J8E A;  4I9E A;  4GA2 A;  3R9A B;  4BT9 A;  1KLX A;  3FFL A;  4AIF A;  1FCH A;  3RJV A;  3ZGQ A;  4BTB A;  4GA0 A;  3TG5 A;  1ZBP A;  5EKQ D;  1WM5 A;  2UY1 B;  2L6J A;  2VGX A;  4NRH B; 
#chains in the Genus database with same CATH topology
 5A23 A;  3KEA A;  3CHR A;  3TWU A;  3TGO A;  2P9S G;  2HYZ A;  3MKQ B;  3IEG A;  4JD2 G;  3DPD A;  2J8S D;  5ITZ F;  5D0O D;  4N3B A;  5CEC B;  4JHK A;  4UWL A;  4OVV A;  2EIJ E;  4HOQ A;  1AP7 A;  4XKB A;  1N52 A;  1QNF A;  4EBA G;  2VTB B;  2ION A;  2J49 A;  5LOZ A;  3SNX A;  2P58 C;  1H2U A;  4I1O B;  3L16 A;  2IOS A;  4I6E A;  4GTV A;  3ULY A;  1FVF A;  4EQF A;  4E85 A;  3QDN A;  4ANV A;  3PEU B;  3DRA A;  2YQ8 A;  2X6F A;  3ASD A;  3ZNG A;  3ZPJ A;  4U63 A;  2P9I G;  1HFA A;  1IKN D;  1E8W A;  3CEQ A;  3DSX A;  4JB8 P;  2I6H A;  4L1B A;  4HOR A;  3DBS A;  5EX3 A;  1QBQ A;  3APC A;  1SA5 A;  1U3D A;  2XZD G;  3E34 A;  1KT0 A;  4WWN A;  3D9L A;  4CDN A;  4UI9 K;  5CMY A;  2C2L A;  3CQC B;  4D10 C;  1JCS A;  3R9A B;  3VLF A;  3TG5 A;  3RAU A;  1KZO A;  1TN7 A;  5KWD A;  3DEO A;  3PVL A;  3VTY A;  3FH8 A;  3E33 A;  4XEI G;  4F3V A;  4GTT A;  3APD A;  1GW6 A;  1H2V C;  5T4Y A;  3ONK A;  2WXJ A;  3RKV A;  3FDH A;  3SQV A;  3UM2 A;  4PS8 A;  4WAF A;  4MLP A;  5B1A E;  3SZ7 A;  4XZ4 A;  2I9C A;  1LF8 A;  1PC2 A;  2XGM A;  4FAD A;  5JJ6 A;  4AY6 A;  3KD7 A;  4DI4 A;  2WXQ A;  4YDO A;  4KBQ A;  2GRO B;  2XZT G;  4JEH A;  3EJN A;  5FZS A;  4K03 A;  5AAO A;  1HS6 A;  2C0L A;  4NQ0 A;  3EHQ A;  3DXK G;  4GML A;  3EHM A;  3D9K A;  2R02 A;  4NIK A;  5T3R A;  4BSX A;  2CG3 A;  4GTS A;  1OWM A;  3ABK E;  3LDZ A;  3BQO A;  4GYY A;  2VJ8 A;  3D9I A;  4XIF A;  2J09 A;  3FTV A;  3UT7 A;  3GW4 A;  2L6B A;  2WB2 A;  4FHJ A;  2ETB A;  5CMW A;  4YDY A;  2XPY A;  2XEH A;  2WXG A;  4U0Z A;  1O5M A;  5EYL A;  4EHM A;  4N5C A;  2WPV A;  3EUV A;  5A7D B;  1AWC B;  2F8X K;  4U0U A;  3B7T A;  4DX2 A;  2KAT A;  4GZD A;  3AG4 E;  4HI8 A;  3FU3 A;  4L9P A;  5FQ8 A;  4GA0 A;  3DEP A;  2XEE A;  4F1P A;  2B0O E;  1H2T C;  2KCK A;  5FQ7 A;  4YDW A;  2OEW A;  4FJZ A;  2FO7 A;  2MRI A;  1KPS B;  3KSQ A;  2XRZ A;  3V2O A;  1H6O A;  3ESK A;  2RFM A;  3PDN A;  3DXM G;  3NAW A;  3JYS A;  4GTQ A;  5B3S E;  1D8E A;  5ANR A;  2B6C A;  5AQ9 A;  2V0P A;  4QQI A;  5LCW J;  3TWV A;  5CED B;  1FVH A;  4UQX A;  3BG1 B;  3RK6 A;  4GMJ A;  2ZGG A;  2RG8 A;  1INZ A;  3P2B A;  3BU8 A;  3V30 A;  4F1S A;  5EIB E;  3HIZ A;  3ZFW A;  3RSE G;  2V5F A;  3DSS A;  4U96 D;  4L23 A;  2VSY A;  2XRY A;  2Y69 E;  2KZT A;  5AQA A;  1OWO A;  4N3C A;  1OT8 A;  3PS6 A;  5J90 A;  4G24 A;  1DC2 A;  5AEN A;  4FLB A;  3CV0 A;  3NB2 A;  2P9K G;  4RSY A;  4K0R A;  3LS8 A;  4GTM A;  4NRH B;  3V2X A;  2XEN A;  4UI9 C;  2CHZ A;  5BXU A;  1TN6 A;  4AOF A;  3SFX A;  4N2Q A;  5BT1 A;  4JA9 A;  4E6H A;  1OWP A;  2BKK B;  5D0Q D;  3LY7 A;  3FEX A;  5AIJ A;  4XI0 A;  3FH5 A;  4G11 A;  4A55 A;  5E76 A;  3JQ0 A;  3UM0 A;  5FQ4 A;  5CRV A;  2DIW A;  2FUL A;  4JHJ A;  4XE0 A;  5HKP A;  4CRW A;  4GMR A;  2LNI A;  4U0S A;  3LVQ E;  2FO1 E;  5JHA A;  5DIZ A;  4N39 A;  2GRN B;  2P2C P;  4DUI A;  3UT8 A;  3FY4 A;  3RRM B;  3ULQ A;  1ELW A;  3OTN A;  2VYI A;  3L08 A;  3Q4A B;  3ABL E;  4JXT A;  3EHN A;  4I9C A;  4HNA D;  4N2S A;  5CCM A;  4TV3 A;  3T5X A;  1RW2 A;  4DPR A;  1E8X A;  2DZO A;  3LKU A;  4EZJ A;  4DK5 A;  5LFA A;  4JZY A;  4AY5 A;  4U8Y D;  3B7S A;  5ENN A;  4FJY A;  3ZYQ A;  1FT1 A;  3AS4 A;  2NYJ A;  1DCQ A;  2J9Q A;  4DX6 D;  3DWL G;  4TRQ A;  1IHB A;  2IQC A;  3RJV A;  2BKG A;  1LD7 A;  2UY1 B;  2L6J A;  4U7E B;  1EDU A;  2WXF A;  1DNP A;  4FUL A;  3ASO E;  2A5E A;  4I2Z A;  4IYP A;  3NOG D;  1H6K A;  4WWO A;  4KMO A;  3CST A;  5E75 A;  3CVU A;  3FP3 A;  1TNU A;  2IEJ A;  4YND A;  2XPZ A;  5AN8 A;  2HE0 A;  4HRN A;  3ZYL A;  4HLL A;  1TNY A;  1JWF A;  3LJN A;  4GYO A;  4Q69 A;  3AU5 A;  4L2Y A;  3MX3 A;  4B93 B;  3EDT B;  5B1B E;  3ML8 A;  2KXP C;  3FTS A;  3MKR A;  1HH8 A;  1Z5S C;  3CHS A;  3UT4 A;  3QWW A;  1TJC A;  3QNK A;  3RIB A;  4DX1 A;  5BNW A;  1O1T A;  5T8I A;  3CVP A;  1WDY A;  3T8K A;  3TAX A;  4UWG A;  1XNF A;  3LVR E;  4IUL A;  3PRZ A;  3I4G A;  1Z3X A;  3PE3 A;  3TWW A;  4AV7 A;  1UJK A;  4BER A;  2GRQ B;  1JCR A;  1IHG A;  3ASN E;  3PZD A;  3U3W A;  3VLD A;  2X6K A;  4BX9 A;  2VGE A;  1U2V G;  4BSZ B;  4BY6 A;  4ACL A;  3R9M A;  2AVP A;  2LAH A;  2LSV A;  3G2V A;  1MX2 A;  4APO A;  1E8Y A;  4F6R D;  3IHV A;  4TUU A;  3HXC A;  4JPS A;  4EEC A;  4J0U A;  1BI8 B;  4Y6C A;  2J4B A;  4O1O A;  3CKB A;  5BV0 A;  2DVW A;  2R05 A;  3VTX A;  3DPY A;  2XEV A;  2QZA A;  3R7Q A;  3ONL A;  3CQG B;  3HXB A;  2RFA A;  3TJP A;  1ELK A;  4JHR A;  4ANU A;  4BX8 A;  4DX7 D;  4YVO A;  4B89 A;  3P1U A;  4OVU A;  4YDE A;  2LXM A;  4UI9 J;  5BV1 A;  2OVF A;  1N4P A;  2PZI A;  2BUG A;  4K5A B;  3NOC D;  3UXG A;  5LP0 A;  1UJJ A;  4BES A;  3FUN A;  4GZ5 A;  3B7B A;  2PQN A;  4EZK A;  3WXX A;  4ME2 A;  3L9T A;  2P9U G;  3D3M A;  3HG0 D;  5BXO A;  3Q15 A;  4U8V D;  3QAR A;  4I1A A;  3UIP C;  2FF4 A;  3FUD A;  4G25 A;  2BF0 X;  4WWP A;  4I6J A;  4CCA A;  4L2L A;  3UTM A;  2VGX A;  4A3T A;  2XGO A;  5AAR A;  4V3I A;  1OCO E;  2NXP A;  3PUJ A;  3EHR A;  4M3O A;  2J07 A;  2H6G A;  1BPO A;  5HS0 A;  1HG5 A;  3QWP A;  3AG3 E;  1IQR A;  2F0Y A;  5FJY A;  4J8Y A;  1TNZ A;  3PZ3 A;  4GTO A;  4H7Y A;  3U4T A;  4C9B B;  3D9H A;  1MQS A;  4O1P A;  1OY3 D;  2AWI A;  1H19 A;  5ENO D;  3AJI A;  2IO3 C;  4B8A A;  5AYW D;  3G2W A;  2E2E A;  5HI7 A;  2ETA A;  4LNB A;  1N4R A;  1A5E A;  1O1S A;  1UN8 A;  1PY1 A;  2X38 A;  1K8K G;  3FU0 A;  4HBD A;  3ESL A;  3MA5 A;  3Q9U C;  2BTD A;  4A1S A;  3Q7F A;  3ZRH A;  2P9N G;  4IN3 B;  1LD8 A;  3ZN3 A;  1JUQ A;  2J4D A;  4GZ3 A;  3E37 A;  2HO1 A;  3IKO B;  1P5Q A;  3SBT B;  3E30 A;  1MHQ A;  5ARF A;  4G8L A;  1UW4 B;  4ACK A;  3ABM E;  1HU3 A;  5G04 J;  2PQR A;  1L5J A;  4B8C B;  2Q7F A;  2IF4 A;  3PRE A;  1FCH A;  3QJZ A;  1SZ9 A;  3BUA A;  3Q49 B;  4HOU A;  3SF4 A;  4RLY A;  4W9R A;  1O1R A;  2PM6 A;  4J8D A;  3UPV A;  4A1G A;  3B13 A;  1EF1 C;  4C0E A;  4ILI A;  4BEP A;  2DYR E;  3Q75 A;  3LJ3 A;  2IJG X;  1DVP A;  1YCS B;  3CHM A;  3I4R B;  2CFZ A;  3FUK A;  3O48 A;  3ML9 A;  3SFY A;  2R5S A;  3K9I A;  3FUI A;  3UKR G;  5IY5 E;  3URZ A;  3CVW A;  1MX6 A;  1N54 A;  3TG4 A;  3CKC A;  3NZU A;  2AXU A;  4K5B A;  2F37 A;  2LAI A;  4DX5 D;  5ENR D;  1D9S A;  3FTX A;  4GYW A;  4BET A;  2L0I A;  3UX4 A;  2EIM E;  2VGY A;  4PS3 A;  4OAU C;  4WNF A;  1BU9 A;  2H6H A;  4LNU D;  2CFU A;  4KXK B;  2DWZ A;  1SW6 A;  3O4Z A;  2ZIS A;  3UMV A;  4GZC A;  4H7X A;  5G05 J;  3Q78 A;  3Q73 A;  4ZHB A;  4ILG A;  2CHW A;  4FA6 A;  3FEY A;  4FU3 A;  2GRL A;  5ENT D;  2FI7 A;  3CVY A;  3GYZ A;  3OXG A;  2XCB A;  3C3Q A;  5CEA A;  4U07 A;  1N0R A;  4QFV A;  5FWQ A;  3FTU A;  2X6I A;  1HG2 A;  4ABN A;  4ATG A;  2YIN A;  4RQI A;  3NBN B;  2FEZ A;  2EIN E;  1YYH A;  4GA1 A;  3JUE A;  4HOS A;  4OYS A;  2J08 A;  3I3N A;  4MS6 A;  1QQE A;  4LG6 A;  4F53 A;  1U3C A;  3FU5 A;  5EYP F;  3KEZ A;  1NL4 A;  2BED A;  4HQD A;  4AP2 A;  4TXR A;  4XX5 A;  4FLH A;  3U64 A;  1OCR E;  3C3R A;  3HDX A;  2GW1 A;  3J5Q B;  2WXM A;  4KT6 B;  5D2M C;  4GCO A;  3CK8 A;  5ANL A;  1FPP A;  4CGW A;  1B89 A;  2DCP A;  3AG2 E;  1NP7 A;  3CK7 A;  1UN9 A;  3G2U A;  3UIN C;  3JUI A;  2PM7 A;  5AQB A;  4J7W A;  1NI1 A;  1HO8 A;  1EPU A;  4Q94 A;  2I2O A;  2HR2 A;  3FU6 A;  3MV2 B;  2VGX B;  1Z3Y A;  3ISM C;  2AW6 A;  2XS8 A;  1TEZ A;  1V54 E;  4GAA A;  4BFR A;  2DZN A;  4IRU A;  4HXI A;  3WG7 E;  2P9P G;  3SFZ A;  1E90 A;  3S7D A;  3LXU X;  3S2A A;  4PDX A;  3FWV A;  3RRU A;  3L82 A;  3MJW A;  3ASG A;  2WQ6 A;  3HXF A;  2QYU A;  2I1K A;  5CCL A;  3FUF A;  2HM8 A;  2F8Y A;  4MBG A;  2GRR B;  5C1D A;  1NA0 A;  3B7R L;  2KZT B;  2DBA A;  4U04 A;  1HF8 A;  2PNN A;  2V5Q C;  3ZVV A;  1KT1 A;  3SHF A;  1BD8 A;  3C5R A;  4LSZ E;  3ZUV B;  3D9O A;  4DI3 A;  2IO2 C;  1JPL A;  3LY8 A;  4ZFH A;  4Q96 A;  2DYS E;  2WMN A;  2I1J A;  2WXO A;  3HYM B;  3ZYK A;  3PEV B;  4FP7 A;  4WNE A;  1ZU2 A;  5FIO A;  4I6G A;  2MOW A;  1K1B A;  5M72 A;  1OCC E;  3QC1 A;  1S63 A;  4N5Q A;  4KVO A;  3IBE A;  3ZHE B;  3CVN A;  4O60 A;  4JC8 A;  1NA3 A;  2OOE A;  2LO6 A;  3MKQ A;  3Q7A A;  4A63 B;  5HRY A;  4M7C A;  2V4L A;  3FHE A;  3CVV A;  3JXJ A;  4I9E A;  4BT9 A;  3FFL A;  4CDM A;  2ZGD A;  1WM5 A;  5CBN A;  2MHK A;  4L7T A;  5ENQ D;  5JJT A;  2EIL E;  1SA4 A;  5AJD A;  4LEU A;  3BG0 B;  3CGH A;  3NF1 A;  3KS2 A;  3KAE A;  4GZ6 A;  3HRA A;  2LSU A;  4J8S A;  2H6F A;  3ZXS A;  4FHK A;  2UWJ G;  4RVB A;  4HI9 A;  4AM9 A;  3E4B A;  5H7P A;  3HVE A;  5EX0 A;  2KCL A;  2Y4T A;  2XGS A;  2WXK A;  1TN8 A;  5FZR A;  4WND A;  1VDY A;  1N11 A;  4WNG A;  4I1M A;  3T5V A;  3UM1 A;  3TXM A;  4AXH A;  1MZC A;  4APF A;  2P9L G;  3LCA A;  4JEU A;  3DSV A;  5FIN A;  3ZYM A;  4PH4 B;  3T8M A;  2C0M A;  5KJL A;  4G8K A;  3EU5 A;  5G04 C;  1UG3 A;  2Y4U A;  5BPP A;  1WG0 A;  2WXL A;  5C2Y A;  2ZXW E;  3MGB A;  4BTA A;  5ENP D;  4CDR A;  1X81 A;  4C0M A;  2WMO A;  1MX4 A;  2M63 A;  3W9G A;  3SO8 A;  4R7L A;  3HVE B;  1KLX A;  4GPM A;  3UIO C;  3ZGQ A;  1EYH A;  5CER B;  3F6Q A;  3EIQ C;  3D9N A;  1N94 A;  4UWK A;  1RZ4 A;  3L54 A;  2OCC E;  3UUX A;  3QKY A;  2LUH A;  1DCE A;  1Q2Z A;  4B94 A;  2A5U A;  4JA7 A;  4BT8 A;  2IFU A;  3IV0 A;  5KBA A;  4LUN U;  3LY9 A;  4LCT A;  4ANX A;  1S0P A;  2OEV A;  3FTZ A;  2E0I A;  4I17 A;  4U95 D;  4A3V A;  3QOU A;  3FUM A;  3Q9N C;  5AJL A;  3TWS A;  2GRM A;  2R17 C;  1MJ0 A;  4O6F A;  5EDS A;  4HLE A;  1S64 A;  2AJA A;  2RKK A;  3EU9 A;  3TWT A;  1A17 A;  4HFG A;  4K5C A;  3RRN B;  3FUE A;  4Z68 A;  1JWG A;  2YHE A;  1NZN A;  3FTY A;  4EPZ A;  3PNL B;  3D9P A;  2ILR A;  3MEK A;  2WXN A;  3SI5 A;  1IXV A;  3AAA C;  2V8S E;  4PS7 A;  3PUK A;  1OXJ A;  3ZXP A;  2JLB A;  4G1T A;  5LX8 A;  3EIJ A;  1H6P A;  1TNB A;  3ZU7 B;  2QYJ A;  2Y1L E;  4ANW A;  4C48 B;  2JAB A;  2NSZ A;  4HB5 A;  3I5P A;  4UWF A;  3ASF A;  4NAC A;  4MRU A;  3L13 A;  2JEK A;  1XGW A;  3G2T A;  3GZS A;  2L0T B;  3DST A;  3Q5M A;  1SZA A;  2WM9 A;  4I43 A;  1TR4 A;  1OCZ E;  4DLQ A;  1N95 A;  2R59 A;  3AS8 A;  1BLX B;  3CVQ A;  3C98 A;  2Y0B G;  4RG6 A;  3OAW A;  3Q47 B;  5AQ7 A;  3V31 A;  4X8Q A;  4ATZ D;  2R03 A;  3FH7 A;  3GZ1 A;  1S70 B;  3Q79 A;  5EID A;  4MKT A;  2GGF A;  3OXL A;  4G2V A;  4N3A A;  3NZS A;  4TUM A;  4UQY A;  4GTR A;  3V79 K;  4HS2 A;  2VSX E;  3S7J A;  4CT4 A;  1TYQ G;  2X6J A;  1JCQ A;  1HX8 A;  4F7A A;  1G3N B;  3QAQ A;  2QC9 A;  3OXF A;  3S7F A;  5LCW C;  2KC7 A;  4LER A;  2XQ0 A;  2ZU6 B;  1E96 B;  4RG9 A;  4EZL A;  3PZ2 A;  4G23 A;  2YHC A;  1V55 E;  2QY7 A;  3ASH A;  2R2L A;  3CVL A;  3ZHE A;  4TXP A;  3IHY A;  1OWN A;  2ETC A;  3D9J A;  3JXI A;  4GA2 A;  1PAQ A;  3G2S A;  1N4S A;  4P29 A;  2IU1 A;  4BTB A;  3CIA A;  5BUZ A;  4XI9 A;  3ZEF A;  4CGV A;  3L17 A;  5D66 A;  2AXV A;  3DSU A;  5KNH D;  2A4Z A;  5CRU A;  3SBS A;  2OVB A;  3ZW3 A;  2KM4 A;  1ZB1 A;  3CHP A;  4G26 A;  3BEE A;  4YVQ C;  3CLJ A;  4BWR A;  5KCM A;  3W9F A;  3QK0 A;  2QFC A;  1QYM A;  2L9B A;  4OAV B;  1WY6 A;  3MZL B;  2X3M A;  3MYV A;  4DJA A;  4GCN A;  4KZ0 A;  5G2N A;  5HQ8 A;  2RD0 A;  2WQH A;  2AXZ A;  3TXN A;  1MYO A;  5JJ7 A;  3TWR A;  3SD5 A;  3GZ2 A;  4UUC A;  2WVI A;  1N0Q A;  2WXP A;  4GB9 A;  5G55 A;  4LRZ A;  4B0Z A;  1N4Q A;  3D9M A;  2EQX A;  3QWV A;  5ARG A;  2YNQ A;  1YMP A;  2X6H A;  1IQU A;  3TWQ A;  2WQ7 A;  3QB2 A;  2OND A;  1OWL A;  3KSL A;  5CBO A;  4KYO B;  4PUC A;  2WXH A;  3U66 A;  3ULE G;  1K1A A;  5JMN D;  3T9K A;  1N9A A;  5KJK A;  4ILH B;  3PH0 C;  4JVS A;  2VTB A;  3APF A;  3X2Q E;  2XHE A;  3UKU G;  4DLO A;  4AVX A;  1Y8M A;  3CHQ A;  1W3B A;  1WAO 1;  2V4H C;  4KZC A;  4AIF A;  1ZBP A;  3SGH A;  2CG2 A;  2IY0 C;  3B7U X;  4J6I A;  2XPI A;  4U8H A;  1TNO A;  2IOL A;  4HOT A;  2MYO A;  3C3O A;  3RU0 A;  4GTP A;  2WXR A;  4NUR A;  5FZQ A;  2ZIR A;  3RO2 A;  5EN5 D;  5DBK A;  2UY1 A;  3VLE A;  3FUJ A;  1E8Z A;  3N71 A;  3ENE A;  2VSO E;  3LYA A;  4CYM D;  1D8D A;  3PZ1 A;  5A6C A;  4JW1 A;  1SVX A;  3RO3 A;  3FUH A;  3PE4 A;  3AG1 E;  4CT0 A;  3MCX A;  3E32 A;  1TJF A;  1E7V A;  5KJN A;  4HRM B;  3UI2 A;  5G05 C;  4LNG A;  3S7B A;  5CHE E;  1BI7 B;  1HXI A;  5ENS D;  3L22 A;  5EIL A;  1Z6T A;  2NC9 A;  3ZIM A;  2VQ2 A;  4Y6W A;  1K3Z D;  2WXI A;  3PNT B;  5KJM A;  3CR3 A;  3ZKJ A;  3L6A A;  4J8E A;  3FTW A;  3HHM A;  5EKQ D;  3CVX A;  2EIK E;  4AJW A;  1FT2 A;  2VSN A;  4GU5 A;  1H0A A;  2LXL A;  5FTP A;  1HZ4 A;  3LEW A;  4AEZ C;  1NFI E;  5JA4 D;  2Y3A A;  2KCV A;  3UM3 A;  3J5P A;  1OUV A;  3IXE A;  4DRX E;  3MV3 B;  4I2W A;  3CSF A;  3DSW A;  1ELR A;  1X5B A;  1KZP A;  3LPZ A;  2PL2 A;  3SY2 A;  3NQP A;  3HXE A;  3B95 A;  4TXQ A;  4UQZ A;  3U9W A;  4HVB A;  2XCC A;  2XS1 A;  4URK A;  2FBN A;  1HE8 A;  5FT9 A;  4EBA A;  3TL5 A;  4FC8 A;  4HRL A;  3C72 A;  5BW8 C;  5J08 A;  1UOH A;  3JCK C;  1LTX A;  3CHO A;  5JHB A;  2GRP B;  3AS5 A;  3UQ3 A;  4WUY A;  4XKC A;  4J8F A;  2OV8 A;  3PZ4 A;  2H6I A;  3AU4 A;  3CK9 A;  3R7R A;  5FQ6 A;  1SQM A;  1YA0 A;  1E7U A;  3JQ1 A;  2KBX A;  2CHX A;  4UWH A;  1IYG A;  4CZ2 D;  3FUL A;  4CEM A;  4KVM A;  5KNG A;  1QZ2 A;  4GPK A;  4JL0 A;  3TWX A;  1Y6I A;  3HXD A; 
#chains in the Genus database with same CATH homology
 2X6I A;  5A23 A;  1HG2 A;  1EDU A;  1SZA A;  4ABN A;  2WXF A;  1DNP A;  3CHR A;  4FUL A;  4ATG A;  2YIN A;  3TGO A;  4I2Z A;  2FEZ A;  2WM9 A;  4IYP A;  2HYZ A;  3MKQ B;  4I43 A;  3IEG A;  3DPD A;  1H6K A;  4WWO A;  4GA1 A;  4DLQ A;  2R59 A;  4KMO A;  5D0O D;  3AS8 A;  4N3B A;  3CVQ A;  3C98 A;  4HOS A;  4OYS A;  3CST A;  2J08 A;  4RG6 A;  3I3N A;  4MS6 A;  4JHK A;  3OAW A;  5E75 A;  1QQE A;  3Q47 B;  4F53 A;  4UWL A;  3CVU A;  1U3C A;  3FP3 A;  3FU5 A;  3KEZ A;  4OVV A;  4YND A;  2XPZ A;  4AP2 A;  4HOQ A;  3FH7 A;  3GZ1 A;  4XX5 A;  4XKB A;  1N52 A;  4FLH A;  1QNF A;  3U64 A;  4EBA G;  3ZYL A;  1JWF A;  2GGF A;  4MKT A;  4GYO A;  3OXL A;  4G2V A;  2VTB B;  3HDX A;  2ION A;  3AU5 A;  4Q69 A;  2J49 A;  5LOZ A;  2GW1 A;  3SNX A;  2P58 C;  2WXM A;  4L2Y A;  1H2U A;  3MX3 A;  4KT6 B;  4N3A A;  4GCO A;  4I1O B;  3CK8 A;  3NZS A;  5ANL A;  3L16 A;  4CGW A;  2IOS A;  4I6E A;  4UQY A;  3EDT B;  4HS2 A;  2VSX E;  1FVF A;  1B89 A;  3ML8 A;  3S7J A;  4CT4 A;  4EQF A;  2X6J A;  2DCP A;  3FTS A;  3MKR A;  1HH8 A;  3CHS A;  3QDN A;  4E85 A;  1HX8 A;  3QWW A;  3UT4 A;  1NP7 A;  3CK7 A;  1TJC A;  4ANV A;  3PEU B;  3QNK A;  1UN9 A;  3QAQ A;  3RIB A;  4F7A A;  3G2U A;  5BNW A;  2YQ8 A;  3OXF A;  2X6F A;  3JUI A;  2PM7 A;  5T8I A;  3ASD A;  3S7F A;  5LCW C;  2KC7 A;  3ZPJ A;  3CVP A;  4LER A;  4U63 A;  1HFA A;  2XQ0 A;  2ZU6 B;  3TAX A;  1E96 B;  1HO8 A;  1EPU A;  4UWG A;  1XNF A;  1E8W A;  3CEQ A;  4Q94 A;  2I2O A;  3LVR E;  4IUL A;  2I6H A;  2HR2 A;  4RG9 A;  3PRZ A;  3I4G A;  3FU6 A;  1Z3X A;  3PE3 A;  4EZL A;  3MV2 B;  2VGX B;  4L1B A;  1UJK A;  4AV7 A;  1Z3Y A;  4G23 A;  2YHC A;  4HOR A;  3DBS A;  5EX3 A;  2AW6 A;  2QY7 A;  3APC A;  1TEZ A;  1U3D A;  1KT0 A;  4GAA A;  4WWN A;  3D9L A;  4BFR A;  3ASH A;  4CDN A;  4UI9 K;  1IHG A;  3PZD A;  4IRU A;  3CVL A;  3ZHE A;  3U3W A;  3VLD A;  4HXI A;  5CMY A;  3IHY A;  3SFZ A;  1OWN A;  1E90 A;  2C2L A;  3CQC B;  3D9J A;  3S7D A;  4D10 C;  3LXU X;  3S2A A;  4GA2 A;  3R9A B;  1PAQ A;  3G2S A;  4PDX A;  2X6K A;  4P29 A;  2IU1 A;  4BTB A;  3VLF A;  3TG5 A;  3CIA A;  3FWV A;  4BX9 A;  5BUZ A;  4XI9 A;  3RRU A;  3MJW A;  3ZEF A;  3PVL A;  4CGV A;  4BY6 A;  4ACL A;  3L17 A;  3VTY A;  2AXV A;  3ASG A;  2A4Z A;  2AVP A;  3FH8 A;  2LAH A;  2LSV A;  2OVB A;  3G2V A;  3SBS A;  3ZW3 A;  2WQ6 A;  2KM4 A;  3CHP A;  4G26 A;  4APO A;  4F3V A;  1E8Y A;  3BEE A;  4YVQ C;  3CLJ A;  3APD A;  1GW6 A;  2I1K A;  4BWR A;  1H2V C;  5T4Y A;  3ONK A;  3IHV A;  2WXJ A;  4TUU A;  4JPS A;  3RKV A;  3FDH A;  5CCL A;  5KCM A;  4EEC A;  3QK0 A;  4J0U A;  3FUF A;  2HM8 A;  4PS8 A;  2QFC A;  4WAF A;  4MLP A;  3SZ7 A;  2L9B A;  4XZ4 A;  1WY6 A;  5C1D A;  4Y6C A;  1NA0 A;  2I9C A;  3B7R L;  2J4B A;  1LF8 A;  2XGM A;  1PC2 A;  2KZT B;  2DBA A;  2X3M A;  1HF8 A;  3CKB A;  3MZL B;  3MYV A;  4U04 A;  4DJA A;  5JJ6 A;  4AY6 A;  3KD7 A;  4DI4 A;  5BV0 A;  4GCN A;  2WXQ A;  4KZ0 A;  5G2N A;  1KT1 A;  3ZVV A;  4B8A A;  5HQ8 A;  3SHF A;  3VTX A;  2XEV A;  2RD0 A;  2WQH A;  4KBQ A;  2AXZ A;  3D9O A;  3TXN A;  3R7Q A;  3ONL A;  4DI3 A;  3LY8 A;  1JPL A;  5JJ7 A;  3CQG B;  4Q96 A;  4JEH A;  3EJN A;  2WMN A;  3SD5 A;  5FZS A;  3GZ2 A;  4K03 A;  1ELK A;  2I1J A;  3TJP A;  2WXO A;  1HS6 A;  4JHR A;  4ANU A;  4BX8 A;  2WVI A;  2C0L A;  2WXP A;  4GB9 A;  4NQ0 A;  4LRZ A;  5G55 A;  4YVO A;  4B0Z A;  3HYM B;  4B89 A;  4GML A;  3EHM A;  3D9K A;  3ZYK A;  3P1U A;  3D9M A;  3PEV B;  4FP7 A;  4OVU A;  4WNE A;  2EQX A;  3QWV A;  5ARG A;  2YNQ A;  5T3R A;  4UI9 J;  5BV1 A;  1ZU2 A;  1IQU A;  2X6H A;  4BSX A;  2OVF A;  4I6G A;  2CG3 A;  2MOW A;  2WQ7 A;  3QB2 A;  2OND A;  1OWM A;  5M72 A;  3LDZ A;  1OWL A;  2PZI A;  3QC1 A;  4GYY A;  4KVO A;  2BUG A;  2VJ8 A;  3D9I A;  4XIF A;  3IBE A;  4KYO B;  4PUC A;  3ZHE B;  2WXH A;  5LP0 A;  3U66 A;  2J09 A;  1UJJ A;  3CVN A;  3FTV A;  3FUN A;  4GZ5 A;  4JC8 A;  3GW4 A;  1NA3 A;  3UT7 A;  5KJK A;  2WB2 A;  4FHJ A;  2PQN A;  5CMW A;  2OOE A;  3PH0 C;  4ILH B;  3WXX A;  2XPY A;  4EZK A;  4ME2 A;  2LO6 A;  4JVS A;  3MKQ A;  2VTB A;  3APF A;  2WXG A;  2XHE A;  4U0Z A;  4DLO A;  4AVX A;  1Y8M A;  3D3M A;  4N5C A;  2WPV A;  3CHQ A;  5A7D B;  1W3B A;  4U0U A;  2V4L A;  1WAO 1;  3B7T A;  2KAT A;  3Q15 A;  4GZD A;  3FHE A;  3QAR A;  4I1A A;  3CVV A;  2FF4 A;  3FUD A;  4G25 A;  3FU3 A;  2BF0 X;  4I9E A;  4BT9 A;  3FFL A;  4KZC A;  4WWP A;  4AIF A;  4CDM A;  5FQ8 A;  4GA0 A;  4I6J A;  4L2L A;  4CCA A;  1ZBP A;  1WM5 A;  2VGX A;  3SGH A;  2CG2 A;  2MHK A;  4L7T A;  5JJT A;  4A3T A;  1H2T C;  2XGO A;  3B7U X;  4J6I A;  4V3I A;  5AJD A;  2KCK A;  2NXP A;  4LEU A;  3PUJ A;  5FQ7 A;  2XPI A;  3BG0 B;  3CGH A;  3NF1 A;  4M3O A;  3KS2 A;  2J07 A;  3KAE A;  4GZ6 A;  4FJZ A;  4U8H A;  2FO7 A;  2MRI A;  2IOL A;  1BPO A;  4HOT A;  1HG5 A;  2LSU A;  3QWP A;  2XRZ A;  3RU0 A;  1IQR A;  4J8S A;  5FJY A;  2WXR A;  4NUR A;  5FZQ A;  3ESK A;  3ZXS A;  3PDN A;  4FHK A;  3RO2 A;  4H7Y A;  3JYS A;  3U4T A;  2UWJ G;  5DBK A;  2UY1 A;  3VLE A;  3FUJ A;  1E8Z A;  5ANR A;  4C9B B;  3N71 A;  1MQS A;  4RVB A;  2V0P A;  4AM9 A;  3E4B A;  5LCW J;  3HVE A;  3ENE A;  5EX0 A;  2KCL A;  2VSO E;  2AWI A;  2Y4T A;  2XGS A;  3LYA A;  2WXK A;  1H19 A;  5FZR A;  4WND A;  1VDY A;  5A6C A;  4JW1 A;  1FVH A;  4I1M A;  4WNG A;  3FUH A;  5AYW D;  3G2W A;  3PE4 A;  2E2E A;  3RO3 A;  3T5V A;  5HI7 A;  4UQX A;  3TXM A;  3BG1 B;  3RK6 A;  4GMJ A;  2RG8 A;  4AXH A;  3P2B A;  4APF A;  1INZ A;  1UN8 A;  4CT0 A;  3MCX A;  1PY1 A;  2X38 A;  1TJF A;  4F1S A;  1E7V A;  5KJN A;  3FU0 A;  3HIZ A;  3LCA A;  4JEU A;  5G05 C;  3ESL A;  3MA5 A;  3S7B A;  3ZFW A;  5CHE E;  2BTD A;  1HXI A;  3ZYM A;  2V5F A;  4A1S A;  4PH4 B;  3T8M A;  3ZRH A;  2C0M A;  5KJL A;  4L23 A;  2VSY A;  5G04 C;  2XRY A;  1UG3 A;  2Y4U A;  2KZT A;  4IN3 B;  3ZN3 A;  1JUQ A;  2J4D A;  3L22 A;  5BPP A;  4GZ3 A;  1OWO A;  2HO1 A;  2WXL A;  4N3C A;  5C2Y A;  3MGB A;  1Z6T A;  3IKO B;  1P5Q A;  2NC9 A;  3ZIM A;  2VQ2 A;  4BTA A;  3SBT B;  4Y6W A;  3PS6 A;  5J90 A;  1MHQ A;  4G24 A;  4CDR A;  5ARF A;  5AEN A;  1UW4 B;  4FLB A;  3CV0 A;  2WXI A;  3PNT B;  4ACK A;  4C0M A;  5KJM A;  1HU3 A;  5G04 J;  2WMO A;  2PQR A;  3CR3 A;  2M63 A;  3L6A A;  1L5J A;  4B8C B;  2Q7F A;  4R7L A;  2IF4 A;  3HVE B;  4J8E A;  4RSY A;  1KLX A;  3PRE A;  1FCH A;  3ZGQ A;  4K0R A;  1EYH A;  3LS8 A;  3FTW A;  3HHM A;  3QJZ A;  5EKQ D;  3CVX A;  1SZ9 A;  4NRH B;  4UI9 C;  3EIQ C;  2CHZ A;  3D9N A;  4AJW A;  4AOF A;  2VSN A;  4GU5 A;  3Q49 B;  1H0A A;  4HOU A;  4UWK A;  5FTP A;  3L54 A;  3SF4 A;  4N2Q A;  5BT1 A;  4JA9 A;  3UUX A;  4E6H A;  1OWP A;  3QKY A;  1HZ4 A;  3LEW A;  4W9R A;  5D0Q D;  3LY7 A;  4AEZ C;  4FAD A;  2PM6 A;  4J8D A;  3UPV A;  4A1G A;  3FEX A;  4B94 A;  5AIJ A;  4XI0 A;  2Y3A A;  2KCV A;  3FH5 A;  3B13 A;  1EF1 C;  4G11 A;  2A5U A;  4C0E A;  4JA7 A;  4ILI A;  4BT8 A;  4A55 A;  2IFU A;  3IV0 A;  1OUV A;  4LUN U;  3LJ3 A;  5E76 A;  3JQ0 A;  2IJG X;  3LY9 A;  1DVP A;  3CHM A;  5FQ4 A;  3I4R B;  2CFZ A;  4LCT A;  4ANX A;  1S0P A;  3FUK A;  3O48 A;  3ML9 A;  2DIW A;  3MV3 B;  4I2W A;  3CSF A;  2E0I A;  3FTZ A;  4I17 A;  4A3V A;  2R5S A;  1ELR A;  2FUL A;  1X5B A;  3QOU A;  3K9I A;  3LPZ A;  2PL2 A;  3FUM A;  3FUI A;  5AJL A;  3NQP A;  3URZ A;  4JHJ A;  4XE0 A;  3CVW A;  1N54 A;  3TG4 A;  2GRM A;  4UQZ A;  3CKC A;  3U9W A;  3NZU A;  4CRW A;  2R17 C;  4HVB A;  2XCC A;  2LNI A;  2AXU A;  4O6F A;  5EDS A;  4HLE A;  4U0S A;  3LVQ E;  1A17 A;  4HFG A;  2LAI A;  5JHA A;  5DIZ A;  4N39 A;  3RRN B;  3FUE A;  3FTX A;  4GYW A;  4URK A;  1JWG A;  2FBN A;  2YHE A;  1NZN A;  3FTY A;  2L0I A;  3UT8 A;  3FY4 A;  3UX4 A;  4EPZ A;  2VGY A;  1HE8 A;  4PS3 A;  1ELW A;  5FT9 A;  4WNF A;  3RRM B;  3OTN A;  2VYI A;  3PNL B;  3ULQ A;  4EBA A;  3D9P A;  3L08 A;  4FC8 A;  3TL5 A;  3Q4A B;  5BW8 C;  2ILR A;  5J08 A;  2CFU A;  4KXK B;  3JCK C;  2WXN A;  3MEK A;  3CHO A;  4JXT A;  3EHN A;  4I9C A;  3O4Z A;  3SI5 A;  5JHB A;  2V8S E;  3AS5 A;  3UQ3 A;  4PS7 A;  3PUK A;  4WUY A;  3UMV A;  4N2S A;  4XKC A;  5CCM A;  4J8F A;  4GZC A;  4H7X A;  4TV3 A;  5G05 J;  3T5X A;  2OV8 A;  4DPR A;  1E8X A;  2JLB A;  3AU4 A;  3CK9 A;  4G1T A;  3LKU A;  3EIJ A;  3R7R A;  5FQ6 A;  4DK5 A;  1SQM A;  4EZJ A;  5LX8 A;  5LFA A;  4ILG A;  1YA0 A;  1E7U A;  2CHW A;  3JQ1 A;  4JZY A;  4AY5 A;  4ANW A;  4FA6 A;  3B7S A;  3FEY A;  4FU3 A;  2CHX A;  5ENN A;  4UWH A;  1IYG A;  2GRL A;  4FJY A;  3ZYQ A;  2FI7 A;  3AS4 A;  3CVY A;  2NSZ A;  3FUL A;  4CEM A;  3GYZ A;  3OXG A;  4KVM A;  2XCB A;  3I5P A;  4UWF A;  4U07 A;  2J9Q A;  1QZ2 A;  4GPK A;  4JL0 A;  3ASF A;  4TRQ A;  4NAC A;  4MRU A;  3L13 A;  2IQC A;  1XGW A;  2JEK A;  3G2T A;  3GZS A;  1Y6I A;  4QFV A;  5FWQ A;  3RJV A;  3FTU A;  2L0T B;  2UY1 B;  2L6J A;  3Q5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...