4GAGH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 412-423)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
212
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 212
sequence length 218
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gagH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gagH02
2YXFA 3KYOB 2JCCB 5C0BB 4JFFD 4OZGE 2EIDA 5EU5A 4LRIC 2AJZB 2ZCHL 3D3VE 3RPIA 1DN2A 4GLRH 4BSVB 2HFFB 5MEOB 4RGNC 3SDDA 1T66C 2A6DA 2MSPA 4HPYL 2DL2A 4HWNA 3QXDA 2CKBA 3UPCA 3JWDL 3KPOA 2Y6SD 1ZHNA 5JPNA 1UJ3A 4CVZB 2NR6C 4LHQB 5DK0A 3GEWB 2CDFB 1JN6A 5J1SC 1EVTC 3WFHB 2HJLA 4G8GA 2AXJA 4YAQB 3LN5A 4YDKH 3PGDA 2IBBA 3BAEH 3U9PL 3ZKNC 1S5IL 4Y1AD 1VEOA 4I8DA 4ENEC 5TH2B 4OGXL 1UA6L 1EO8H 1A9EA 3GIVA 4NM8H 4I48A 3V6FB 4JANA 5FUCC 5ANME 1DBAL 4PRIB 4NZRL 4N0YH 4B7IA 1IAOB 2LQRA 1KC5L 1XGRB 4L1DA 1F4WH 5LAXA 2ADIB 3BPNB 4MXVE 4NKDA 4OAWB 3VXUB 4BZ2H 4JFZH 2ZNXA 5HHNB 4LQ1A 2R0KL 1AI1L 1I3RB 1N4XH 5HI5C 1CE1H 4OF8A 4BJLA 3UO1L 3QNZB 4OI7A 3MOQA 5FGCB 4JCLA 4ZFOA 2ICWI 5E8OB 4Z7WA 2H45A 4OFDA 5F6HI 2R1XB 4WEUD 5IBUG 4NT6A 1YJDL 2IGFL 2GJ6E 2YPKA 4JJ5B 1DQJB 4Z8FL 5IWLA 1G7HA 1BAFL 4HJGB 3RWCA 5FO7A 1CBVH 1GC1C 1IC7H 5HGBA 5JR1H 4QWWD 1N6VA 5I15L 4YHIA 1XGTA 1HDMA 4KKAD 4X6EA 4MSWA 3BKCH 3IDXL 4KQ4L 3ABZA 5FYJE 5DHVA 1AR1C 5E70A 3MRFA 4NHCH 3S8WA 4I0PD 2WWMC 2IG2L 3BPNC 2R2HA 1DLHB 4BZYA 1WAAF 5FYLL 1LHZA 4FQPA 2WBJB 4KI5F 4KQ3H 1BVLB 2PYEB 3IDIB 1RZGB 1I85C 3CCHB 4O9HL 4HMCA 2VZSA 4XMPL 5DC9B 3SQBA 4ZTPL 5TQ2H 2IH1B 5ACZB 4XVUD 3M17B 4IOIA 4LSPH 5CJQL 2V5MA 4HUUB 1MFEH 2NY1B 3NVQA 5KN5B 5C2UB 1G7QA 1D9KB 5EU4A 3QIUD 1KJ2L 3QPQD 3W5MA 3OKDA 1J8HE 1T22B 4HF5L 1QTYT 3WLWD 3QEHB 2IAND 1HIMH 5E94B 2V2TA 1UB5B 3EO9L 1JL8A 5T3ZE 3TBTB 4RFOH 4GRLA 3OR6A 1KLUA 3WUZA 4GG6A 4W81A 1ORSA 1IQDB 2WBJC 3QDGA 4XC1L 2EYSA 2V6HA 4QKXB 1Q9WB 3B6SA 2XWTB 1ONQA 4GUPB 4OUOA 4FFZH 1IGYB 4YC2B 1PYWA 2VDLL 2H32A 1TPXB 4FTVB 3BZDA 1G0XA 4W4NA 3JWOL 1OT2A 1FYTD 3DUHA 4L9LB 4PRBB 4F33B 4F57L 1YEJL 3C5ZA 3MRDB 3WUWG 5HI4C 3SE8L 4PRNA 3BP6B 4URTB 1WQVT 4QNPF 1N2RB 2FX7H 1NSNH 2NY1C 1CTOA 1D9KC 1NPUA 2LAAA 1GGBH 3ECBB 3KXFD 4MJIE 1QBAA 2JJTA 5I76B 4GAJL 4GSDL 4FXKA 4K2UH 2ATKA 4MA8H 1W0VA 5EU6D 5GISH 3DVFA 4UQ2B 1NGZB 3BVNB 4DGVH 2FX8H 3IJHA 1FFOA 1F11A 3H3KA 2ZKHL 1XR8A 4QHKJ 3NZHH 4YC2C 3FB7B 1TJIH 1YQVH 1KCSH 2AK1L 3MPCA 1G7PB 4LEXH 4PV9A 4J3XA 1DBMH 1FCCA 1RD6A 1QO3B 3FQUB 4L9LC 1OY3B 2H3NB 1KSRA 1IJ9A 4WDIA 3S37H 3SCMA 1FG2A 3X3GH 3SE9L 3LV3A 3VRJB 3LB6C 4N5ED 1SMOA 4JFYB 4F9PC 2NX5B 2X4UB 2Y06L 1AP2B 1DEEB 3OQ3B 4OZHA 3U30B 2YS4A 1NFDA 4M3KB 3GKWL 2FX9H 3FMGL 1KPUB 3REWA 1T6VN 1MCOH 2CD0A 1VGEH 4PJ7F 1HYSC 2H2SD 4ZS6D 1WZ1H 3G9AB 2DQJH 2IPKB 4XPFL 3X17A 4LLMA 3RWIA 3M07A 3Q6GH 1BEYL 2PUQT 4XWGL 3LIZL 4O58L 2HJKA 3GJFK 1KJMB 4F8QA 4YFLI 5SV4A 2XNAB 2KPNA 5I8KL 4M6MH 3L7FA 5IR1A 2D0FA 4G8FB 3V9FA 4Y5YA 3IFPB 3V4UL 1HILB 1OT1A 3KVQA 5H94B 3WV0A 1JPGA 4TULL 4WFEE 4OCMC 1XF2A 3BGMB 3FRUB 4JRYA 4DN4H 2FYYB 2PYFB 3TO4A 4NPYA 4LPCA 5JW4M 2ED9A 3U30C 4NC1E 4EI5D 3ZHDA 3MBEB 1UXSA 2CSPA 3W11C 1M6OA 4BA8A 1J88A 4A6YH 1KN2H 4FZ8L 1LEKA 3IU3A 1TITA 1TJHL 4C57C 2R8SH 5L2JA 4QRRB 4XNMA 3KPTA 4POZC 5AZ2L 5FCUL 1NMAL 1PVHA 2CXGA 3SQOH 1J0IA 1WZMA 3STZA 4ZXBA 3VWJA 2ATPA 4LPWA 3RQ3A 1YDPA 5IHUH 3MREA 1NC4D 5T5FH 1AD9A 3L5IA 5KVFL 2HVJB 4C83B 3QNXA 1CQYA 4PR5B 2A9NH 2XFXA 4O5LL 4OBRA 3WFCL 1F8TH 4MA7L 2P5WB 4UTBH 3UAJD 2R4RL 2AABL 3MO1B 4R2GD 1U6AH 3IDUA 5F7EL 5IQ9A 5EZLA 2DS4A 2VDMH 4YFLF 3W39B 1HSAB 3EYOB 3VD5A 4GRWH 1KIQB 1PG7H 1LE5A 2WP3T 3PJSB 5IBUB 3B5TA 3MBEC 4WI7A 5HPOA 5IW1A 1IM9B 1K5NA 1BQLH 4QYOA 5ADPL 2PXYA 4IRSD 3PL6C 3IFNL 5EBMA 2VLME 1INEH 5KW9L 5HHOD 5KVGL 4I13B 5TFSH 2XTJD 1HSBA 4P3CH 5F3BA 1S3KL 1K6QH 5I73B 1QFWL 4N8CH 2XIDA 3MCLH 3QCTL 5KOMC 2CKBH 4PRPA 5FV2A 4Q2ZB 3KPSE 1NCAH 3B83A 4Y16D 3CX2A 1MHPL 2AQ3A 3NCBB 3HNTH 3J8F7 4JVWA 3GNML 3CNKA 1MFDH 5DUPH 1WAAA 1XH3A 3AU1B 4L4JA 3HMWL 3MV9D 3OKKB 4P46B 1CU4L 5SWZA 2YD3A 1W0WA 3RIFF 2YSSB 4M7LL 4ODHH 1NCWL 1OGAB 1U8IA 3GSNL 1KCRH 3OXSA 5M95B 1FL5A 3BN9D 5EC1B 3F8UB 2H2PD 4QXGL 4TUJA 5FF6B 1V7NH 4AEHL 2X05A 5D6DC 1ETZA 5IHZA 4K55A 1WFOA 3MA7A 5FA3B 1NGXB 1T3FB 1RUMH 3PQYD 2ICWA 4HGWA 2AJYL 3QUKA 1DUYB 5F9JB 4S1RL 1XGQA 5E4IA 4JFXA 3LS5H 5D1ZB 1NL0H 3WFEH 3IS0X 5ICXB 5I1CH 4MNQA 3RWJA 3KPRE 3K2UL 2D7TL 5DURB 5E99L 2XN9B 3AS1A 5DQDH 3PIQA 1MUJA 4E9LA 4XTRD 3KJ4B 5DEGB 3JV6B 3TBVB 1CG9A 3O6FB 3MUHL 3AM8A 3LEVL 4P46C 3S35H 4UZGA 3BPLB 4FS0A 1FBIL 1QRNA 4NUGH 2E9WA 3T2PA 2X7LB 1QFOA 4PJHF 2H41A 3LEXB 4PJDE 3LH2L 5IM7B 4NQCA 4HKXB 5IMOB 1HQ4B 3GMQA 4M5YH 4RNRB 5TE4H 2AJUL 4HWBA 5T1DL 5DHVH 4OZIF 1IAKA 4XHJD 1OCWL 4G8GB 3RBGA 2X70A 4NYLB 1RHFA 3HUJE 4UTAH 4JLRB 1VHPA 3WUWB 4X9GA 1CK0H 5IB4A 1CTNA 2VDKH 3RVTC 4GOSA 2AI0H 3QWOB 4PTUA 4PJ5E 3WKNA 1MFNA 1NLBL 3PWPD 5B3JE 5C92A 4K3HA 5JO5A 5HHXH 1FLRL 1J11A 4I48B 5FUZL 1OP5H 2YN5A 2YD7A 3ULUC 4KAQH 5AZEH 5IT2H 3S36H 3GI8H 1KCVH 2EIBA 3KJ4C 3Q48A 1CXHA 4R0LC 5FECA 1O0VA 5SX4H 3B9EA 3O6FC 4X6FB 5EB9A 2WLZA 3BPLC 4KMQA 4Y89A 2DI9A 4HSQA 2E27H 2AXFB 4DZBB 4IRZH 2K7PA 4KKLD 3QIWA 3G5ZB 3WNNA 4QOKD 4JFDA 1B0RA 3MNWA 3G6JE 4XBPB 2DLGA 2V2WB 1DBKH 1G7HB 3PP3K 4GKOA 3WNPA 3VFVB 3WFDH 1E6JH 3Q5YA 4RMUA 5CILH 4OLUH 3UTTD 5D7LB 4H26A 2DQDL 4ZS7L 1YMME 3L5JA 4PJ7A 2FGWL 2OMBA 1I1AA 4H1LG 1V8HA 4ZPVB 4NKMA 3RWEA 5C86A 1F3JA 2EXWC 2DQIL 4JAMB 2X4PA 4FQCL 2H32H 2PN5A 5ETUA 3EJYC 5F7DB 2H26A 4ODBD 3OAUL 4ZDHA 4IIQA 4XMKH 4P49A 3QFDA 5L9DL 3A67H 2KL6A 1EHLH 2VZVA 2FBJL 1VKXB 1EUUA 3KAAA 5F1IB 3JV4A 5SWQB 4XVSL 3KDMB 1HHKB 4U6YA 4L4VA 5HI3C 3VXSD 4W68A 2OQJA 4FQIH 4JQXA 3JV5A 4FQQA 3WBDA 3IS1X 1R3KB 2X6MA 3DX9B 2IAMA 3HHRB 2YXMA 5IFAL 3C9NA 1TVHA 3JTSB 3NCJH 2FD6H 2BFVL 4G8EA 5AD0B 4IEFB 3QUZD 2WIIB 1IC4L 4TUKL 3V4VH 4D3CH 4CW1A 5D96C 5HDBE 1C1EH 2NLJA 2OZ4A 1B3JA 3MA9H 3CMOH 1AC6A 4Y7MA 1UZ6E 1TVBB 5D7IE 2BOBB 5MHSE 3MLYL 3VDAA 5C0FA 3VRIA 1SYVA 5JORB 1T2XA 4NC0B 1YECL 3UEZA 4PJBF 4U33A 1A6TA 2IBGA 3SJVE 5CEXB 2DQEL 5K59F 2BVOA 5KZCB 2FHBA 3I6GA 2FCBA 4ZYKB 4KY1H 4Y8AA 3L3IA 4XCNA 3L3KB 4XPTL 3AUVA 2VQ1A 4PRNB 1IT9L 3JTTA 5F7WC 3TCLB 1BZ7A 2NXYD 4XAKD 4KROB 32C2B 3VFRA 4K7FB 1VGKB 2X9YA 2EYTA 4CVXB 1XZ0B 4WY7L 2VXSL 4P48A 1RURL 4WTWA 3MBXL 1YEKH 3ARZA 1VEPA 1G9MC 2P1YA 5JXED 1OM3L 3P3YA 3ZO0A 5BV7C 5C6WH 2OSLA 1R3IL 4WUUB 2W07A 4JDVA 1W0VB 1EGJA 2EC8A 4HEME 4C58B 5D1QB 4OJFL 1OAZH 5I74B 5GXBB 4QCIA 4JFQA 1IGIL 2YK1H 1MHCA 1J7VR 2BX5A 2D7QA 3MTRA 2PNDA 5A1AA 5DHYB 3UZQA 1E4XL 3TVMC 2HT3D 2V5YA 3O2WL 2R2BA 4PGEB 3MJ8B 4UQ3B 4JZOB 5HPMB 3C6LB 5IIEA 4EJ1C 5DD1H 4UV7L 5CSGA 3NTCL 3WEXA 2HJFA 4OSUL 3W2DH 5L7XL 4DVBB 4J1UA 2QADD 2RGSA 3S96A 1G7IA 1HK6A 4GAYA 4PRDB 3W9DA 4DKFH 3V52L 2EDYA 4CVUA 2BNQD 3MRRA 1AGBB 2YMXH 3GBML 1PGRB 5TDPB 4HD9A 1QA9A 5D1QC 2HFEB 5BS0A 2Q86A 1QP1A 3QPXH 3RTQA 5IR1B 1DN0A 3BW9B 3SGDI 5C0NC 3HZKA 1TNNA 3BWAB 4U1HA 2OJEA 4JHWL 5I1KH 3LSOB 4QHMB 1A1MA 3O11A 4PY7B 3NPSB 4PJHA 1ZLWH 5FO8A 1EZVY 4GXUM 5FYLE 1Y6MR 3C6LC 1RZKC 3L5XH 4OZIA 4N8VG 4YBQD 4FQLH 5FA4A 3RWDB 1J1XL 3DRTA 4EI6A 4ZNEA 4PUBL 4UBDD 4K8RL 1XR9A 3MODL 1ZS8A 4HUKB 5F93C 4TRPH 1A7OH 2DQTH 1H3WM 4Z78A 1MCJA 5D71L 4JO2L 3E6HA 1IARB 5D2NA 4PJFF 5I18H 5MERA 3QQ9C 2LU3A 1FFNA 4PRHD 4V1DE 3NAAL 4S1SL 4NO0B 1C5DB 4K7PX 4JFFA 2AV1A 3ULVF 2IH3A 4JN1L 4MD5A 2W0FB 3GBNH 5SX5K 2CLVB 5GJTH 3RZCB 2QQNL 4KHXH 2AJ3B 3I50H 1FNEA 3QUYB 1MWAA 4HK0B 3QBTB 2DIJA 4LSSL 1AKJD 3D2UD 5IQ9B 3NPSC 1ND0A 2C1OA 5DVOA 3KLSA 3O9WB 2OI9B 4LLWB 5DI8B 3MRIA 4NO2B 5IP4A 3HI6L 4JKMA 1Q0XL 3BUYA 1JYVA 43C9A 4NRXA 1CICD 4XP4H 1LE5B 1RZFL 1D6VH 1JPST 3F7VB 3GJEB 1QKZL 4IRJB 1YYML 1OPGL 1CGSH 3M8OL 5EBMB 5GS0D 2FATL 2P5EE 3CIQA 3CSYB 5LJYH 1I7ZB 1IGTB 1QLEH 4ORGA 3WE6A 1BFSA 2V9RA 3QYCA 4BFIA 3BH8B 2EIZB 1LO3L 5I19L 4Y1AA 2XXMB 4H1LB 3BDYH 4F8TA 3CUPA 5GZND 4KZDL 4KPHL 1HINL 1DVFD 2NXZB 5GGRB 1UXWA 4P2OC 3U82B 4ZOBA 4P5TD 1X7QB 4PJCE 4CN4A 2FEEL 3PWNA 2CO7B 4Q58C 2P48B 4HWBH 1U8KB 2GFBA 1CL7H 1A6ZA 1JMXA 4TVPD 3V6ZA 4APQD 3QUYC 4PGCA 3KS0H 3VJ6B 2C1PA 1OARH 3O9WC 4W70A 1SEQH 1YEHH 4WCYH 5DFWH 3UTQB 4JM4L 2AV7B 2J8UE 1JGUL 1OGTA 1WEJL 4FXGA 4BZ1H 4H20L 4PJGE 1CT8A 4QHLB 2W9EL 4K3GA 4DFIA 3RA7L 4P5MA 4H88H 2B20A 1YNTB 3MOBL 4HHAB 5T1KD 1XGQB 2A73A 3SGJC 1EJOL 1YY8A 2BVTA 3TWCH 2OK0L 1U93A 1YMHA 3K0WA 3WDIA 5DMYA 5SWSE 3TBYA 3QJFB 4G7VL 1TCRA 4QRQB 4XXCA 2BVEA 5HYJE 4I0PA 1WTGT 4HS3B 4F9LA 5JIKA 1X4YA 4P2RD 4X4MA 1WBXA 3ZE2F 4HWEL 4YHYB 2G5BB 5CJXA 1FH5L 4PJBA 3L7EA 3VA6A 4JFOA 2ICWJ 4O00A 2VDPL 2CUIA 3CVIL 4KK9D 5C0DB 1QNZL 2RR3A 3VI3E 1QFUL 2IFGA 5EO9B 1KXTB 1ZXQA 4NZJA 1X5GA 2GJZA 5E2UH 3V5HB 2E6QA 2DWEA 2QQLH 3D18A 3SBWC 1KB5L 1OP5K 1FG9C 4HS6A 5F3HB 3FQRA 4KGJA 1NMBL 1Q9KB 4OF6A 4OLVL 3UYRH 3NIGE 5E6ID 3QHFL 4N0UA 3P40A 3MX0A 4AENA 1RZJC 2VLKA 2AJSL 4MS8C 1BWMA 1KEGL 1S9WA 2IANA 3E8UL 1IC5H 4XCEB 5DGRA 4U1MB 3LN4B 5J6HB 5K9KB 4I77H 1B0WA 3QA3B 3D1MC 3IDMB 4YHYC 1I8MB 5J6GA 4KFZC 5GS1A 3HKFA 3KS0J 3B9KD 2B4CC 3TT1L 2YBRB 1OB1A 3NFNA 2XZCL 5IJVA 1B0RB 3EO0A 3C87A 4ZG1A 4HQQL 2VDNL 4TTDD 1OAQL 4JR9H 4Y4HC 1JTTA 1FYTA 3DXAA 3ZE0F 4Q9RL 2GT9B 1DBJL 2C7UB 3MLZH 5I2IB 4B5EA 3EFDL 3DMMC 3VXTA 4NZUH 1P7KA 1P5VA 3SEPA 2VLRD 5HBBA 3MFFA 4OF5A 2FZ3A 5E0QA 1KTRL 4Z77B 3BPOC 3HG1D 4Z76B 4E41A 3DV6A 2NY4D 5F7YC 3W0WD 3KXFA 2PR4H 4LP4A 2IQ9L 5C07B 1PSKL 1JJUA 2BY0A 4KJWC 1IMHC 1ZHKB 4LNRB 5D1XD 2WUCH 1AGCB 5IVXF 4NQXA 1NCDH 4ZPTB 4JB9H 1MCSA 5L2KD 1J8KA 5CEYA 3T0ED 5EU6A 1MIML 4M4RA 3ZTNL 1JNHA 1JRHI 2B2XL 5DZLA 1ZT1A 5L0QB 3ULSB 1AQKH 5JHDB 3F7QA 1JPFB 1T0NA 2JE8A 1KFAH 5BZDA 2CIKB 1RPQA 1U8LB 2OL3B 5CLWA 5DVLA 3X14B 4MDIB 3ARED 5FUOL 3VFUA 1QBBA 5KS9F 3CDGB 4N8VB 3C9NB 3G04A 1ZHBA 4M6NH 1EGJH 1FNGB 4UIKH 1YEEL 1P53A 3SE3C 2P8MA 1DBBL 4GXVL 4V2CB 4PJFA 3HRZA 4HXBL 1TZGH 4LLUA 4EN3A 1ZANH 4ZFGH 4JHZA 4HLZG 1NC2A 3IVKB 1KXVC 3BT2L 3GSUB 5IUSA 3MV8D 3O41A 1PKOA 3TM6A 1BD2D 4I5BA 1NCBL 5DT1H 5DJ6B 1LO2L 1LK2A 3GHEL 3MRPA 1HN1A 4P3WA 1WGOA 3HZVA 3H42L 4LCIH 2VXTL 2CK2A 5IOPA 4U6HB 1A6TB 3PDGA 5GGVL 3OXRA 5IB2B 1MFBL 5T1MA 3TPUA 1BM3H 3AAZA 2COQA 2FL5A 1A6VH 3RJDA 3WIHL 5GZOD 1UM5L 3BOVA 1DP0A 1UH2A 2DYPD 4U1LA 2FH6A 4JO4H 4FQXD 1H3TA 2LV4A 2QTEA 2IC2A 2UY6A 4K3DL 2YD1A 3WL9A 4EI5A 2R39A 5AEAA 3MXVH 4PJ9B 3FT3A 3QIBA 4I2XB 3QEQB 1BVKB 3Q1SH 3TP4A 4N68A 2CMRL 5EO0A 5I1JH 4UV4L 4G5ZL 4NIKB 5ADOH 4X4XB 2Q7YA 2HKHH 3OJVC 4QRUA 2PKDA 1S7QB 3DECA 4XNQB 5C71A 3BIAX 4QCIB 3V4PH 4GMSH 4DGIH 3VXOA 4K7PL 1MHCB 3S6CA 1PFCA 2QQKL 4LGRB 3GSWB 4MAUH 4W6YB 1Q1JL 1QYGL 2V7HB 2B0SL 2X4NA 1BGXL 3B9DA 3ORJA 2YUVA 4LNVA 3T2NH 2R2BB 1ZA6A 2GJJA 4XXDA 3QUXB 4NN6C 1CDIA 5IB1A 1Q38A 1F00I 2Y36H 2FNBA 3CD4A 3P4MB 5JXAL 4JRXB 1A7RL 4PLKC 4EDXB 2ED8A 4IRSA 4JZJA 4OCSL 5C3TA 5I8EB 3V0WL 5KSBE 3V6OC 1MJ7L 1NGWA 2B1HL 3ZT7A 1VADA 1U8HA 4NC2B 4P4RA 1QG3A 1J18A 4NO5A 5EDXA 1U8OA 4Z7UE 3KR3H 1FAKT 3DHMA 3KYMA 4WI3A 4R8WL 3FRPA 2VZOA 3P77A 4Y16A 1QQDB 5M7QA 1F97A 3PP4H 5C6TH 5DD6B 3L6FB 5GS0L 3V95A 1ZLWK 3UJTH 5EORL 4OTXL 4EOWL 4OCYL 3SGKA 2EH7H 2XKNB 5JHLL 1MQKL 3QUXC 4MD4B 4P23B 4D94A 4PS4H 3O6KL 4ZSOA 1T2QH 3C2AL 2VR4A 4M6OH 4XP5H 2ICEB 2R4SH 2XACC 4GBXA 1D7FA 4OD1L 5IV2B 5J0BA 4LSUH 1OQOA 3PQYA 1X4ZA 2X4SA 2VWEE 4KJQC 3VGFA 3R1GH 4AG4H 3FQNA 3QXAB 4LARL 4L8BA 1RJCA 4UT7L 2ZUXA 4Y19D 5CAYB 3MRKA 4HX1A 3JVGA 5C8JA 4O2FA 3DX6B 2HYMA 4UT6L 1MJ8L 2NY6B 4OGAC 1FQ9C 3PG2A 5HY9B 3L9RA 3HC4H 3DROB 5D7JA 4D8PB 4MJ5A 4O2CA 1X5HA 4P23C 4HPOH 4ZFZA 5BVPH 2JELH 1XCTB 4PV8B 5DD0L 4DOHE 4YGVA 25C8L 1X9QA 3ARBC 3QFJE 2DM2A 5MP6H 3FOLB 2IWGA 5I1IH 5INDB 4HLZH 5IBTL 2ZWLT 4RDQF 2K1MA 2N56A 3QULB 3T8XB 1N5AA 1UVQA 5IFJA 5FDWB 3IFOB 1GOFA 4PG9A 5E5UB 1CXEA 2IPUK 4G80B 4J3WA 2Q1EA 4ALAH 4LBEB 4OIBA 3CK0H 3PDOA 5I1HH 1J1OL 1HNGA 4BSJA 1GGTA 3LMJL 5D2LE 5IVXA 2GTZB 5DLMH 3ZTJG 3QDJE 4HT1H 3CC5B 4ODTL 4G9DA 5E4EB 2C4FT 1BJ8A 3Q5OA 3STLA 3HI1A 2VE6A 4Z95H 5DHXB 4YHZL 2ADFL 3OR7A 2BVYA 3M1BB 3U36A 3KLDA 2DJSA 4ISVA 3A0OA 2CGRL 4XVJL 1OGTB 3FN0L 4PB0H 3HC0B 4QOKA 1R5IB 4H5SB 1LEGB 1XGPA 5KS9A 3WSQH 5IGXH 1FE8L 4DN3L 4DVRL 1I3VA 3LKNB 3N1MC 1UWEH 4ODVL 4L3ED 3UTTA 5I1LB 5GGTH 4POYA 4RAUB 5ID1A 3FB5B 3GSVB 3GDBA 12E8H 4ELMB 4X7SH 1A1NB 3MNZA 1ZHLA 3DX7B 5LGJB 5LXGL 2BP3A 3VXRB 4P4KA 3FRPG 4RWYL 2VRAA 5KTEL 3ULUL 3TJHD 1IEBB 4M1DL 4LMQI 1KCUH 3IDGB 4PREA 2DMKA 2RBLA 2VR5A 5HYEA 1S7WB 5E4EC 1N0XL 4NUJA 3SY0B 5EN2A 2JJWA 2ZCKH 4Q6IC 1T20B 4JKKA 5C0IA 1JNJA 1A22B 4KJYB 1NANH 2R1YB 5IEHB 2DWDA 4M5ZH 4PYGA 5F7KC 3FFCE 1T89C 3RGVB 1MRDL 3H3PH 3BMWA 3SKOA 4WWKD 5D5MB 5HHOE 3BJLA 4GAGL 1GYAA 3TF7C 2XTJE 2JJSA 2QSTA 3ZDZE 4OZGB 4L8SA 4L8DB 4IDLA 3AY4A 1CZ8H 5DA0B 5GJSH 4YUEL 1BIHA 2IALA 5BW7A 3D3VB 3OZ9L 1J5OL 3HN3A 1CD1B 5EO1A 35C8L 3VI4F 4LSVH 2VLLA 2A83A 4R90H 3MV9E 3L3JB 4O2EB 4MXWH 3AMLA 3L1OH 1P4BL 2HLFD 4KXZI 4MDJB 1J05A 4WI9A 5LGHH 1FPTL 5HYQB 1T2JA 2BNRA 3BRGC 1IGML 4Z7NE 4X5WB 4BSWB 5GS2H 1EEYA 2DIAA 4WEBL 3ZDXE 1KELL 1T5WB 4AEEA 2P8LB 4HBCH 1EUTA 4G9FE 5FYJH 2X4OA 4Z0XB 2MCPH 3ZL4L 3RGVC 5TJWK 1ZLSL 2DTSA 1H3PL 5E1HB 4Y4FA 2F58L 1KPRA 4OQ1A 4R7NB 4S1QL 4CADB 3U2SB 4N5UA 1AO7E 4NQDD 4U3HA 5C0RL 3ULVH 1DANT 1LO5A 5DD3H 2KKQA 4WW1B 3SE4C 2BSRB 4L4TA 5ANMB 4PJIF 3VFPB 3GMRB 4OZ4B 3BXNB 1IAIH 5JW3L 4GXUN 3SDAD 3D9AL 3TZVB 3VMOA 1GL4B 1YEFH 3V8CA 1CFQB 1L9NA 3I6LD 5KG9A 5JXEA 4Y8DC 2FJGA 4DQOL 1C5CH 3SGDH 1QVOB 3QB7C 1JZ4A 1IZKA 3MGOB 2ZSVB 4XP6L 4QHNB 2NY5L 2WUBL 4LEOA 1BIIA 4LK4A 1ZWIA 4CNIB 2DQUH 2AERT 5ID0A 5J3HD 1H5BA 3TBSB 5CKAA 4HUWB 1JPSL 3RI5F 3TYFB 4R97B 3FT4B 1E4WH 1IBGH 4EUPG 4PRAB 1E6OL 3PWPE 2VZ1A 1NEZA 3VFTA 1AJ7L 1UACH 4PP1C 2V17L 5HGAA 3C2SA 4NNPH 4EEEA 4EN3B 1HH9A 3QT2A 3DYMA 5I17B 3ZTJH 3MQIA 3TZVC 3SDXE 5DK2B 2PF6A 4LASL 4Z9KB 1MI5D 1FO0A 2VUOA 4QTIL 5MENA 1HHJA 2VH5H 1I8IA 4I5BB 5BV7L 3ZE1E 1KEMH 4QO1A 3MRBB 2DBJA 1UWGL 4XMLL 2KUTA 1FAIH 2H6PA 1NBVH 2HA1A 5GSRB 2HP4A 2RFXA 3RKPA 3OKOA 5FUCE 3RL2B 4X7FC 4ZUUA 1PQZA 2EO9A 3AAZB 2BK8A 2FL5B 4R97C 2LFGA 2AK4D 1ZSDB 2H8PB 5CZVL 4OV5A 4YDIH 5BCAA 3P4LA 3TN0A 2IMMA 1U58A 4HK3N 3GM0A 4U1LB 5EOTB 5KVMC 1U8PA 3NIDE 3TYGL 2ZOKB 1BFVH 3IYLW 4MZ3A 3UPRA 1J8HB 3MJ7A 4AMKH 4P2QD 4OLEA 3S88H 2DTML 3SGEI 3QXTA 3P73A 3KLAB 5DJDB 1UKSA 4XCFH 4F7PA 1NBZA 1R3JB 2Z4QB 4GKNB 3IT8D 1E28B 3ME0A 1T7ZA 3O2DL 5H37G 4YGAB 1I9RL 1GZQA 2W9DH 5E2JA 4LKCA 5IG7A 5B39G 1G7LB 1RJYB 4XC3H 1IQWL 1ED3A 4XWOD 5E1AA 1GGUA 1KXQE 5T3XL 4Z7VE 3VXNB 2WZPD 2UWEF 5T33L 1V05A 1R5WB 5DTFA 4D9QE 2FO1A 3WXVL 3C8DA 1D5XB 3CSPA 4I3SL 3ZDYF 5JMOC 1Q8MA 1EFXB 2Y7QB 3DETC 2QR0A 1SJHB 2IEPA 3BX7C 1KG0B 2K3TA 2VIRA 3D2UA 1MVFA 4YWGL 1K3IA 3P0YH 5C08D 2C9AA 1DL7L 3TBWA 3ARGB 3DGGA 2DLTA 4MJIB 3QDME 1CICA 2UZXB 3BP4B 3FFDA 2BY3A 4P99A 1BOGA 5ICZA 3U9UA 4ODSH 4KTEL 2ENYA 3PV6B 2E7LA 1IILE 3KPLA 4PP2A 2CJUH 3WNMA 4Y4KB 4AEIH 1GOGA 3G5YA 4OLYH 5A3IC 5IBLD 5DMJB 3MR9A 4KRMB 4TPRL 2Y72A 5K9OA 1CFSB 3I3EA 2Q8AL 2JIXA 4HWZB 1EEUA 5J1AB 3IAQA 4P5TA 3FB8B 3WKMH 3D25B 4LLQA 3ARXA 1A0QL 8FABB 1C5BL 1AFVL 1B0GA 4MAYB 3MNVA 2RB8A 2PTVA 4GMTH 5IW3A 4XAKE 2A1WL 3DI3B 5FKAA 1JK8A 3LQAH 4TNWK 4YHPB 4JJHA 3QCVL 1KIRB 5DRXA 5T1LB 5EWIL 3T1FA 4HUVB 3LPFA 5CP3A 3K81A 1JPTL 2RQ8A 3KPNB 1HEZA 4IS6B 5HGHA 5JOPD 5C0BD 1T6WA 3DVGB 4Y4KC 1FGNL 4Q9QH 4ZAKB 3D69B 2W0LA 1Q0YL 4QY8A 4X7TB 4O2FB 4YHLL 4RSVA 4PJEE 2RJMA 1A3RL 4LRNH 1P2CB 4OIIL 4OQTL 4KHTH 3SOBH 3L9RB 5F7LB 5BOPA 3PWJA 2PCPB 4M8VA 4XX1E 1Z9LA 5EUOE 5HI5D 3Q6FA 3HS0A 2EE9A 4MAYC 4PJAF 2DQHL 2VN7A 3S3SA 3U46B 3F5WB 3IXTA 1R5VB 5IJKA 1Z3GH 1E0OB 5GRWA 3EJZD 3ZZ1A 5ESQA 4LKXA 1BQHA 2LVEA 1DQQB 3ET9F 4PJIA 4YO0B 4QF1A 2D7MA 4HIJB 2BNQE 1JZ6A 4F58L 3GBLA 4K07A 4U3CA 1QOKA 1F45A 2PTTB 4JHBA 4QT5B 3IRPX 4LLYA 1FZKA 3CVHL 3PDOB 4Q7DA 4PRID 4F7CA 5E6IA 1R0AH 2GUOA 1N6QH 2IQAB 1RIVL 1T80A 4H0IA 4CMMB 1WC7A 3RWHB 3FT2A 3U0PA 2P7TA 1U92B 3O3DB 2FWOA 5E2TL 1ZA3A 5JZ7D 1UCTA 1U3HB 4F3FA 1AXTL 3BHBA 4R3SA 4NGHH 3B9KA 5EU3B 3MV7D 2BHYA 1R3LB 4YNYA 4AT6A 1HH6B 5DMIL 3LRHA 3QO0A 2EKSA 3QSKB 1NUDA 4EUPB 1N5YH 2DBLH 3NH7L 5CEZL 5H37H 3TNNA 2IBZY 3X11A 2RCSH 4PRHE 4S11A 2Q7NA 3KPSB 2DD8H 4ZUVB 3HB3C 2LE9A 1MHHA 4UOJA 5DVMA 3VWKC 2YUWA 5ID1B 2VLRA 4WUKH 4NNYB 2HFGL 1ZHLB 3G08B 3I02A 3N0PB 4P4KB 4NQTA 2UZIH 2YZ1A 3W0WA 5DJYB 3T77A 1RZJL 2ILLA 1B88A 4QHUA 5E00B 3GMOB 5D1XA 1IGJA 3ALWA 2VDOH 2A9ML 2F19H 5C0CD 3IDJA 3DURB 3VFOB 4P9HH 1DFBL 2WBJD 5L2KA 3T0EA 1NFIB 2VDRL 1EV2E 3MLUH 5TPWH 4AIOA 1YEDB 3NCMA 3IJSB 3NACL 1BX2A 5HHVH 4U1SA 3PWLB 3EYUL 5ESVB 3F58H 4J8RB 1QEWA 4OD3L 4I18B 3KHOA 3MLXL 5DUBA 3GSQB 1RU9H 2XOTA 4QTHA 2DQFB 3CFEA 4J6RL 3AREA 1CFVL 2JB6A 3S34H 3LRSA 3O0RH 3KPRB 1X44A 3NFSH 1M7DA 3CSGA 5DWUL 2YUZA 3DV4A 5IMMA 1D9KD 1SVCP 1T1WA 3LY6A 1MNUH 2EEBA 1MQ8A 5EA0H 3CPLB 1I7RA 4LAQL 4WTZA 2A83B 4BUHA 1GIGL 4GQ9L 4L5FL 1N26A 3UTSD 1J05B 4ODUA 5HDQH 5B39B 5DJCB 4R6UA 1BD2A 1KLFA 4HC1L 2UWEA 4XNUL 1JV5A 1A1OA 4NNXA 4PJDB 2QKIB 2XRAH 3BE1L 2JJTC 2LVCA 4PG2C 2V5SA 4CU8A 3E6FA 1LK3L 4MNGE 3U0WH 3IFLL 3HUJB 4C56A 4JVUA 1JHLL 3BP7B 4I18C 4DAGH 2XQBL 5TF1H 2Z31D 4G7YH 4PJ5B 4HV8A 3IETA 3CAFA 5DJAA 5EBLB 1FO0H 2R56L 4NZDA 1I7TA 3UPAA 1E27B 3LB6D 3KPQA 3BZ4B 5F9OL 2EDEA 1QFPA 3MJ9A 1KB9J 3UYPA 1X5YA 4X9BA 4LSTH 1NGQH 1S7SB 4D9RD 4G6AD 2DIBA 1FL6B 3PNWB 3QXUA 4MCZA 3LS4L 1KBGH 1KLGB 4LMQE 4P2RE 2V9TA 2X1OA 1B9ZA 1T04A 2QSCL 4ODXA 4ZO6A 1D5MB 1E4XI 2O5XL 4OF0A 1IM3B 2VNCA 5DJ0A 1J0ZA 5AUMB 3MACL 3PGFL 1NGPL 3O45A 4NRZA 1SYSA 5MEPB 1P1ZB 4PYHA 2D7PA 1MSPA 1RJZB 3IJYB 5DD5H 5CZXC 5C9JA 2VUYA 5JIPA 1Z9SA 2YPVL 4CUCA 2ZOLB 1YMMB 1AXSA 2NX5D 4ONHB 4OUUB 3CXDL 2ESVA 2NW3A 3PGCB 4OIAA 1S7XB 3CFJA 4KK6C 2UYLB 3RVUC 1PBYA 2ZCHH 3CZFA 5CGTA 1SMAA 4JPIA 3QEUA 1QD0A 3SPVA 4UDUB 1W72A 1CXKA 2BDNL 2BVQB 3BDBA 2HRPH 5GHWL 3ILPA 4HPYH 1YNKH 4M93B 2HMIC 1V3LA 1P4LB 4WU5A 2YA0A 1TZIA 4NQEA 3WLBA 5H35A 4P5KA 1QR1B 3EIFA 1MJJB 4X0KA 2EZ0C 5GRUH 5DS8B 5C0JB 3T3MF 4PJAA 4R26L 1FN4B 1S5IH 1U8MB 3TH3T 3U4AA 3S98A 3FB6B 1RSFA 1P7QB 4HJ0D 1MF2L 2QQQA 1UA6H 5D72L 3WHXA 3MJ7B 3MBED 4DK6A 3HG1E 5BQ7B 3DGCR 3NIFF 4LHUA 5ALCL 3INUH 4NQSA 2CQVA 4OZFA 15C8L 1KC5H 3TA3B 3KPPA 4LVHB 3I2CH 4YPGB 3MLSH 1NBZB 2YEZB 1T1YB 4YX2H 1R3HB 1U95A 5D7IB 5L88L 1MCRA 2GK0A 4M93C 3EBAA 2R0KH 1AI1H 5CJBA 3DRQB 1XGUA 2XPGB 3AXLA 2B1AL 1RUKH 2VSCA 5E9DE 5F6IB 3UO1H 1CGYA 3LKRB 2FB4L 5DMKA 4Y19A 2NQCA 2EDXA 4YE4L 5JPMB 4X6DF 3AS3A 3VW3L 1YJDH 2IGFH 5EIIB 3BD5A 3QUMA 5F89A 5F70A 1RZIA 4Z8FH 3S3PA 4PJXF 5CP3H 1FHGA 3WIFB 3JUYA 3TFKC 4LLVB 4LGPB 2GSIB 3EYQC 3P0VL 5ILTL 5CD3A 3IDXH 1EEZB 2HG5A 4KQ4H 1HHIA 1YPZE 3MV11 3TA3C 4X6BB 5CHNB 3IXAB 4WFHD 3MV8E 2BMKB 5BJTA 1JF1A 3D39D 1ZGLA 1I8LC 3BDXA 3VRLF 2A77L 3FQWA 4F2MB 4NKOB 5F6IC 5SV3A 5KSAC 5HDOA 3RL1A 4O9HH 3ZDXF 2CIIA 5I8CA 4KDTC 3ZSTA 4R4FL 4P46D 2QHRL 4ZTPH 3SDCC 1N64L 1PG7W 1F4XH 3B2UC 2XICA 1JGLH 3JWDC 1IL1B 3ROLA 3CGTA 3VE0B 3RUGE 4RAVA 4MXQC 1WT5A 5CJQH 3F12A 1CXFA 1HXYA 2VZTA 2Z8WC 5FKAB 2R23A 4G3YL 3AROA 3ZYJA 5ISZE 2C26A 3CFBB 1WWAX 5GIRB 2AQ1A 4WV1A 5KBNC 1WBZA 1HI6B 2VN4A 2NMSA 1RY7B 4O51A 1KTDB 4M61B 3DHJA 2IJ0C 4IMLA 4L3EA 3OKNA 5D1ZD 1WVZA 2DICA 3R0NA 2YPLE 4KXZH 2MTPA 3H9ZA 5DURD 3SN6N 4XBGB 2ZG2A 4HH9B 2XN9D 2VDLH 4U4BA 2NY0D 1NBYA 1ZVSB 3JWOH 3SDDD 3O6FD 4Z0BH 3PWJB 4PBXA 5E2VL 1OW0C 3EHBD 4X99B 2XY2A 3B9VA 3O8XA 3SE8H 2WQ8A 2ERJB 5ESAA 3DUUA 1KTLA 1T21A 1OTSD 1FZJB 3O3BB 2CK0L 5GGSA 3VXPB 2GTWA 4LHUG 2A0LC 4G8GD 4GAJH 4OZFG 3MFGB 5HVGB 4GRMA 4V1DB 4QF1B 3G6AB 3RVXD 4NBXB 3FO2A 4M8QB 1NCNA 1KJ2B 2ZKHH 1HKLL 5AG8A 2JCCF 1MVUB 4F7TB 2FJFA 2MJWA 4QRPE 5EG6C 1LNUA 5ITFA 3MUGA 2EXWD 4BZ2L 1BLNB 3TH2T 4FQ2H 3HMXA 3FZUD 3UC0L 3RX7A 4ZQKB 5JTWA 4MJ4A 3UTPE 1I1FB 4MCYA 1N4XL 4OGYL 3H7BA 4CJ1A 1A02N 1KJVA 1QSFE 5JDSB 3SE9H 5DQ9A 5I1AB 2PO6B 5ITBL 2ERJC 2HH0L 2O61A 5F97E 2EC9U 2Y06H 3JUZA 4R3SB 5TGBA 1U8NA 4OCWH 4AT6B 5T3XE 2P5EB 5HI3D 1CBVL 3BEWB 2AEPL 3UTZB 4X8XA 4MQXC 3TO2B 5ACLA 5JR1L 5FKPB 3QRGL 4LCUA 3W9EB 1KB9K 3EOBA 4PFEA 5EUKB 3V5DB 5KAQF 1C7SA 1IZJA 4XPFH 1AGFB 5FOBA 1TXKA 4MNHB 5GRVK 1ES0A 1JWMB 2DRUA 1S7RA 4FFYL 1YEGH 4XAWH 4XWGH 3LIZH 3UROR 1A4JA 4O58H 4WI6A 4Y2OA 4PJCB 4E5XA 3S35X 5I8KH 1X3DA 5DMGC 5CLTA 4IJ3B 4ZUSB 2VR9A 3PXJA 3IGAA 1C12A 1JGEB 5CBAB 1V5JA 1OAKL 2N4IA 2J5LB 1DE4B 3CU1A 5FV1L 3HE7B 1UG9A 4TULH 4TSBH 4YDJA 4JG1L 2BC4B 1M4KA 1S7VA 2M26A 4LIQH 1TZHA 2J8UB 4PJ8A 1VFBA 4MYWB 1ZE3C 4PJGB 3MJ9H 5TQ2L 4PY8I 4WJ5A 2FO4B 5AZ2H 5DUBB 4LSPL 4FFWC 4KK5C 4KK8C 1MFEL 1NMAH 1F42A 3SGEH 3V6BR 3MMEB 1FFRA 1UB6B 5GRZA 5C09E 3S36X 3KYKL 1P9MA 3GMMA 3MGAA 5F9AC 4GJTB 1HIML 4BM7A 4O5LH 5SWSB 3KG5A 3SHSA 3WFCH 4RFOL 4OT1H 3F6LA 4EBQL 3TH4T 5HYJB 2L7UA 3DPBA 4IJ3C 2F74A 4GRLD 2J6EL 3T3PF 1BFOB 2A6KB 2J5LC 2ZUQC 3BEVB 1EPFA 2VLJA 3HE7C 3TNMA 3LAFA 3QDGD 4X6DA 4FFZL 1Z9MA 2OX5A 3QO1B 1NJ9A 5ADPH 4QHKI 4PJXA 3IFNH 5KZCD 5KW9H 4ZUTB 3SKNA 3GSRA 3C5ZD 4ODWB 2FX7L 1CLOL 1I7TB 4ZFFB 1S3KH 1QFWH 1R24B 1JZ8A 4Y5VB 3KPQB 1ZLVK 2APXA 4KROD 4QRTA 1BMGA 5JNYB 4HMEA 2JJUA 1D5IL 1KIPA 3GNMH 3TGXA 1OAXH 3DUSA 4A2LA 1KPVB 2VL5B 4HS8H 1CXLA 2VAAA 3HMWH 1T1ZB 5E8NB 2R0WH 4HKBB 4MLIA 3C60A 4RQQB 5DJZA 1LGVA 5J8OA 4OKDA 1EIBA 1LO0H 2FIKA 4WUUD 1CU4H 2Z35B 4KU1A 4MA3B 3FJTA 4M7LH 5DRZA 3G5VA 1N3NB 3T0BA 2P8PB 3NZHL 1TJIL 1YQVL 1KCSL 4QXGH 5HYSB 1FV1B 3U48A 4AEHH 2ADJA 1CLCA 1NH6A 4NM4L 5C0ND 4PTTA 1LE9A 3X3GL 4OZFH 1RK1A 3MRJB 4UT9H 2AJYH 1ODAA 3SCMD 5HXMA 1K4CB 3T4AA 4IHOB 3UBXG 4A2MA 4S1RH 2APWA 4TTGA 1A7NH 1H15B 1JGDB 1CGVA 4Y5VC 1MCWW 1VGEL 4JY6A 1X5IA 1Q94B 1TTGA 1WIPA 3K2UH 1FZMA 5DEZA 1CIDA 2D7TH 3GJFA 3WXWL 1UQSA 2DQJL 4R4NC 2VB5A 3HFML 3GMLB 3QUMH 3E1F1 4WFGE 3MOAH 3LEVH 4KDVA 2MNUA 4LHJB 5IQ7H 4Z5RA 4HIEA 4M6ML 3OHXB 1JNNL 4LRIA 4LGSB 1Z5LB 4BQ6A 1G7MB 1D5ZA 4HIIA 3OAYH 4XZUA 2AJUH 3G5XA 5T1DH 4DN4L 5BRZA 3MROA 2MHAA 5E56A 2A6JB 4OV6F 1J0JA 3MRQA 4NQDE 1RHHB 3GSNB 2Z91B 1NLBH 4OCRH 3P4NB 1GGIL 1KN2L 3KWWA 5FUZH 2R8SL 3VGDA 1Z9OA 2MQ3A 3O3AB 1OP3H 3FN3A 3H9SE 3C09B 4BQ8A 4X8JB 3GMPA 1H8OA 5C6PB 2XA3A 1ZGLP 3KPPB 1J9CT 3ES6B 3S7GA 5T3ZL 1QLRA 3I6LE 4JO1L 5FGRA 4O4YH 4ZD3L 2Y6SC 5IW6B 4H25B 5T5FL 4BKLB 3KYOA 2JCCA 5C0BA 1U91B 3WO3B 2GIYA 5F8QC 5J4MA 1NCCH 2AJZA 3IF1B 1YC8A 4WFFE 4BSVA 2HFFA 3RZCD 1U6AL 5MEOA 2W1NA 3IDNB 1MAKA 1IE5A 1DR9A 4PGZA 4OFPA 2G5RA 2WK2A 3ARFB 4YFEA 2AXHA 3EOAB 4U7SA 4JVPA 2DQDH 4CVZA 3ZKMC 1CFTB 3D87B 1OTUD 5KSVB 2CDFA 1I9IH 2FGWH 3R06B 1INEL 4IRJD 4LCWA 3C09C 3PWVB 3WFHA 1ULVA 4N8CL 4FQCH 1MI5E 3MCLL 5BJTB 2CKBL 4YAQA 1KB5A 5CMAB 3OAUH 1MCCA 3BO8B 1GZPB 2EDHA 2ED7A 3QH3B 4UDTB 3VDBA 5TH2A 2FBJH 5DUPL 2HN7B 3IDYB 1AY1L 3V0VB 4X80L 3BSZL 1CE6B 2NXZD 4PRIA 4MJ2A 4NN5B 2EH8L 2DN7A 5CWSB 4N0FA 4XPAL 1XGRA 3BGAA 1EXUB 3UXFA 2AK4E 4K9EC 3VXUA 1AXIB 4QWWC 5SWZD 5HHNA 3ARFC 1V7NL 1I3RA 4KH2A 4UUJB 2DLEA 5ALBL 5EZOH 1F4YH 1LWRA 2IADB 1IKNC 2PETA 3QIUB 4S0SD 5IFAH 1UKQA 1I85A 3QNZA 4GW4B 3RIAF 4P2QE 4P59H 1RUML 4XXCC 5E8OA 2G75A 2YC1B 4I3RH 2R1XA 3L95B 5KSBB 1DQJA 3ESUF 4WV1B 4XPHL 1T5XB 1A8JH 3BKYL 4HJGA 4JQVA 2FLRT 4Z7UB 5I1CL 3T0WA 4ZFOL 2FHCA 3MLYH 2E9IA 3RI5K 3MLWH 3IDYC 1YECH 1VFUA 1UM6L 3FO9B 2YWZA 5B22A 3S35L 2DQEH 1MCQA 2Q3AA 2ZZUT 3VGGA 1QSEE 4XVUC 3HR5B 3DOSA 3GIZL 3I9GH 5C08E 1WITA 4GW5B 4ZO9A 4XPTH 5C2BH 3K3QA 4UU9B 1IT9H 4G42A 2WBJA 1KTLB 3QIUC 1BVLA 3PHQB 2PYEA 3IDIA 4NQCD 2RHEA 3WLWC 3CCHA 1WBYB 1JYXA 1BBJA 1B4RA 1ACYL 1X5KA 2VXSH 1CK0L 3MBXH 4AIZB 2AI0L 1OLLA 1OM3H 4JPVL 3N06B 2IH1A 1R3IH 5HHXL 2LU4A 5ACZA 2F15A 4YBLB 3VD4A 3M17A 3MYJB 2OCFD 4LPUA 4HUUA 2VKWA 5EZJB 5IT2L 1D9KA 3S36L 5FYKD 1KGCE 2H9GA 4X6CE 4CU7A 1EERB 1B4JL 1T22A 4NRYB 5CINH 5GS3A 1AD0B 4XP1L 1GGCH 2CDGB 3QEHA 4UNTA 4MQ7B 3CH1B 1UB5A 3ULUF 1E4XH 1FL3B 4J12A 3O2WH 1FIGH 1HXMB 4DOHB 4E0RB 1IQDA 1RJLA 1PKQE 2Z8RA 3QFJB 4KV5F 5E8PB 4X5LA 1U8NB 3MLRL 1Q9WA 1EBPA 1QLFB 2XWTA 5F7NC 4GUPA 3MRCB 1LDSA 1IGYA 5HJ3B 3U4EB 2J3SA 5L7XH 2FSEB 2AEQL 3WFDL 5CILL 4FTVA 5KAQG 4OLUL 3WIHA 2VWEC 3UBXB 1OSZB 2J12B 3EOBB 1XGYL 5JOPE 4L9LA 4PRBA 4F33A 4R96B 4W6WB 2MCG1 2WIMA 4NZTH 3V52H 3MRDA 5J57B 3B2VL 2F53E 3BP6A 4C59B 4F9PA 1E4KC 4CMHC 3GBMH 2Q87A 3WJJA 3T65A 1N2RA 3UX9B 1ADQA 3C5JB 4OKVB 5D2LB 3FCTB 1I1AD 4M43L 3QDJB 3ECBA 1D5BA 4FP8L 1YA5A 4NN7B 5E95B 5KOVC 5I76A 1XF4B 1BQUA 4OGZA 4JHWH 3A67L 4N5EC 4KMLB 2FJHB 3BN3B 3WN5B 4HZLB 2NY3B 5D7KE 4HLJA 4C4KO 4UQ2A 1NGZA 5D4QA 3BVNA 1NQBA 2LTQB 5GGUB 2FECL 1OSPL 2F5AL 5J9PB 4GG8B 4FMKA 4M7ZC 3BQUB 5JHDD 3L3OB 4FMFA 4K8RH 3MODH 3FB7A 2RIKA 5ENWB 1V7ML 5D71H 4JO2H 1G7PA 3NOIA 1QO3A 3FQUA 3NCJL 5HHQB 2H3NA 1NC4B 3D48R 1HHGB 1U8QB 1B6DA 3VRJA 4B0MM 3DBXB 5LKNA 4JFYA 2X4UA 3U7YL 5IEKB 1AP2A 2IMNA 1DEEA 4D3CL 3U6RA 3S5LA 4JN1H 5BO1H 1C1EL 1IEAA 1KPUA 4DUWA 5E2WL 2E7HA 3MA9L 4OFVA 5KVDL 3MLPA 3DNKA 4K3EL 2QQNH 4M62H 5B4MD 4LSSH 1K4DB 2VLJB 2ITDB 1K3ZA 3WN5C 4TVSa 2NY3C 4KMTH 3LZFL 1Q0XH 4EI5C 1TJGL 2LTQC 3FFCB 3VD3A 4LSQL 3MV7E 1KJMA 4M48L 1NJ9B 1QKZH 2XNAA 5HHOB 1OPGH 4P9MH 1WCBB 4J3TA 5D9SB 3I3DA 4G8FA 3FOMB 3IFPA 2ORBL 2FATH 5KVEL 1T1XB 1HILA 3SKNB 1BF8A 1U3ZA 5H94A 5EU7C 2F54E 2P42B 1H9VA 3BGMA 3FRUA 3N9GH 3PABB 2A2QT 2FYYA 1LO3H 1YUHB 2PYFA 1EK3A 3N50A 1MRFL 3MBEA 4KZDH 4KPHH 4OI9A 5IK3B 3EYFB 1HINH 3MV9B 4PJ9D 4PLKD 4QXTB 1P5UA 3JV0A 3QEQD 1G0YR 2NYYD 4QRRA 5M94B 3PV7A 1AGDB 4G6ML 1F2QA 3V8OA 1U3YA 5C0CE 4JFHE 2HKFH 4XX1G 5FFLA 3GRWA 4G9FB 2WINB 4OD2B 4C83A 4PR5A 4GAFB 4JM4H 1JGUH 1UGNA 5K9QG 5CGYD 4JZJC 3RX5A 1WEJH 4PTTB 4M1CD 4KKCD 4NKQB 1LE9B 2P5WA 5DZOA 2XTJC 1AO7B 3MCKA 1NAKH 3RA7H 3MO1A 1X5JA 3QUXD 3UJJL 4DZ8B 1K9TA 5C7XL 1LILA 2BHZA 4Y16C 3W39A 1HSAA 3EYOA 1EJOH 1KIQA 3OWEA 4MB3A 4QRSB 4FG6C 3TLRA 3PJSA 3T2OA 4WI4A 5D6DA 4LF3B 1IM9A 1CF8H 1FGVH 4KUZL 2Y07L 4G7VH 4I0CC 3JXAA 2X4QB 1HKFA 3UTSE 4GW1B 2BY1A 3RNQB 1UWXK 4HWEH 4JCMA 3BN9C 1ZMYA 2H2PC 2NY7L 1T7XA 3OTTA 1LP9E 2AJXL 4Q2ZA 5BS0D 1HZHL 2VDPH 3CVIH 5I1KL 1YEIH 4HMDA 3LQMA 1QFUH 4NKIH 3AU1A 4BH8B 3PWPB 3OKKA 4P46A 5DUML 3CMGA 2AW2A 3MRQB 5F71A 5CIPB 5CFHA 3L5XL 4ZODA 1KB5H 4P23D 4FQLL 3OV6A 2YSSA 1GC1H 1NKOA 1OL0A 1OP3K 1OGAA 5DYOB 5EC1A 4TRPL 1VACB 1NMBH 2DQTL 5FF6A 3RDTB 2W59A 2WWKO 1QSZA 3QHFH 4FABL 5TF0A 4XTRC 3SDXB 1MLCB 2AJSH 3S5LG 4D9RE 5FA3A 5TE6H 1NGXA 1T3FA 2XTLA 4TNVF 3E8UH 2VQTA 2BSED 2BCKB 4AJ0A 1DUYA 4KGLA 5F9JA 4OCXH 5JOFB 1CDGA 1ZT7B 5FCSH 2DMBA 3GBNL 5D1ZA 4NO3B 3O6LL 3TT1H 4RGOL 5GJTL 5ICXA 4KHXL 2YRPA 3I50L 4X4YB 4XHJC 2NY6D 1G9EA 5HHMB 1NDMB 2XN9A 2VDNH 5DEGA 1FNSL 3JV6A 3TBVA 3O6FA 4N0CD 4N1HB 5HGDB 4JFPB 4B53A 1XF1A 3EFDH 4ERSL 2X7LA 3ZT5A 4YK4B 3LEXA 3RVVD 5IM7A 1JZ5A 3RDTC 4HKXA 5IMOA 1HQ4A 3MRGB 4LCWB 3WO4B 4RNRA 1PAMA 3O4LE 3OKLB 2IQ9H 1GHFL 3UZEA 4XP9H 4NFBA 4DKEL 4NYLA 5C0AE 1KT2B 4JLRA 3WUWA 1KB5B 2XKSA 5DEFB 5I16B 5EOCL 3QWOA 4BUGA 1BZ9B 2VXVL 1MIMH 4Z7VB 4KKLC 1HNFA 4KTDL 1SVZA 2B2XH 2D9CA 1LO4H 3UDWA 4NJ9L 5IESH 4N0FB 4JFEE 2CRYA 2C3VB 1S7UB 4X6FA 5FM4A 4WCYL 3P9LB 3D0LB 3QDMB 3QUZB 3HTLX 1JIBA 4BZ1L 2AXFA 4DZBA 1F13A 1YEEH 4YK4C 1DBBH 4GXVH 3G5ZA 4HXBH 3WO4C 2G75B 1WWCA 4YZFF 1CLZL 2ZP0T 5F7HA 4XBPA 3BT2H 2V2WA 5FK9B 3VFVA 1JYNA 4N90D 1NCBH 1LO2H 5D7LA 3PP3H 3VXME 4IMKC 2X09A 3WJLC 1IGFL 2EKJA 1KN4L 3H42H 4U1NB 3VXRD 1RULL 2VXTH 2X4RB 3RKDD 4ZPVA 2G2RB 4MQSB 1LVEA 1MFBH 2JJSC 4JAMA 4BK4A 5EOQH 4OFKA 1EAPB 3FN9A 1MH5B 5F7DA 3WIHH 1UM5H 5BW7C 3RNKB 5INCB 2NXYB 1GAFH 1HHHB 4G42B 3QUZC 1CL7I 1VKXA 5DJXB 5F1IA 4K3DH 2E7CA 5SWQA 1ADQH 5A16B 2CO6B 5CJOH 1BBJB 5E2UL 3KDMA 1HHKA 1J1PH 2QQLL 5JUEH 2MPAH 1B90A 2R0ZL 5AYQA 1J12A 1SJEA 2CMRH 3D39E 2YKLL 3T04D 1R3KA 4UV4H 3UYRL 4ESKA 3DX9A 4G5ZH 1F3RB 2Z92B 3JTSA 3D3VD 5AD0A 2EDDA 1BP3B 3QQ3B 4K7PH 4PJEB 2QQKH 2JLLA 2H9GB 2VLKD 4U1KB 2WIIA 1Q1JH 1QYGH 1XCQB 4CJ0A 2QL1A 5EUOB 2P24B 3RZWA 3QG7L 1H3UA 1OF2B 4YHKL 1DCLA 5D70H 3OKEB 2NXYC 4BQ9A 1TVBA 3QI9B 4HFWB 1RJLB 2BOBA 5JIHA 5E6ZA 3EYSH 4XVTL 2AVGA 2QADB 3RJQB 5JORA 4LVNB 4PY8J 5JXAH 1M7IB 4CDHA 1A7RH 3GMNB 2OZ4L 5CEXA 3MUJA 1K2DB 4U7KA 3FONB 5DZNA 3TVMA 3DXAD 3V0WH 3SO3B 2BNQB 4OM1L 4S2SB 1MJ7H 4ZYKA 4GRWE 5E08H 1H3GA 2B1HH 3A6OA 3L3KA 2MQCA 5IMKB 2EE3A 1WUNT 1INQB 5CD5D 5BXFB 4L8CB 3TCLA 4PP1D 3T65B 32C2A 3BMVA 4K7FA 4GH7B 1VGKA 3NZ8B 4E41D 1D5BB 4CVXA 1XZ0A 2WUCL 3C08L 2HT3C 2CRIA 4HGKC 5CP7B 3O2DA 5EORH 4OTXH 1T4KB 4EOWH 1L7TH 4OCYH 4WUUA 2W9LA 1DLFH 3O6KH 1I3GL 3QI9C 4TSCL 4XGZB 2I9TB 5D1QA 3CH8A 4JM2B 5E5MB 5C70A 2QADC 4OD1H 4LVNC 3WS3B 5DHYA 4G8GE 4PRHB 3SO3C 1EGJL 4PGEA 3MJ8A 4UIKL 4UQ3A 4JZOA 2AJVH 5GS2D 5HPMA 1A21A 2P4AB 2W60B 4LARH 2A74B 1TZGL 2WAHA 1MOEA 2VZUA 3C6LA 5FYJD 3GRWH 3ZYZA 3U6RB 3RY5A 1NBQA 3QG6B 4RMQA 3S5LB 2BOCB 2FIRT 1RUQH 2VITB 4JEGB 1IEAB 4EN3D 4UT6H 1MJ8H 5GGSY 1NC2D 4DVBA 1AKJB 4LSRL 3THMH 3OMZA 3HC3H 4CN1A 3ULVD 3KYAA 4PRDA 2EDTA 1QFHA 5C0GB 3K1DA 3V5KB 4YBQC 4LCIL 1TCMA 2XZQH 2E3VA 2HAZA 1AGBA 3IKCB 4WNQA 4FQ1H 5DO2D 5TDPA 4UBDC 4YBHA 25C8H 4JM2C 4Z7WE 2HFEA 2DLIA 3DJ9A 5FM5O 1A6VL 3ZHLA 3BW9A 3MJ6A 4U31A 3RPKA 5IBTH 4RFEB 3BWAA 3LSOA 4QHMA 1JWSB 2X42A 2XY1A 4PY7A 4RMVA 5IMLB 2B5IB 1G7JB 4XNZC 5AG9A 1DVFB 1J8HD 2V7NB 3BP5B 4JZNB 3DIFB 3O3UN 1JUFB 3RWDA 3HI5L 1CD8A 2OR7A 3VH8G 2V5TA 3PL6B 2NPLX 3QIBD 2Q8BL 4J3UA 2FHFA 4JRWA 4ODTH 1YN6B 3WHE0 2AKRB 4BQCA 2V2XB 1AH1A 1MFAH 4OM0L 4DGIL 5F1KC 3MCG1 2ADFH 2OMNA 5EBWB 1F4HA 4NO0A 1C5DA 5IVOA 5DC0A 1VPOH 1K8DB 4MNGB 3SO5A 3ARVA 1H8SA 2CGRH 5GS0C 2W0FA 2V9QA 4P2OA 2CLVA 1G9NC 1MCNA 2HLAB 5T1KB 3RZCA 1EFXD 2AJ3A 1FDLL 6CGTA 5SX5H 5J11B 3MCKB 3VGEA 3SKMB 3QUYA 1FE8H 4HK0A 4DN3H 4DVRH 4DEPB 3O9WA 3ESVF 1OQXA 4LLWA 4XPBL 2B5IC 5DI8A 2IF7A 5EULV 3ARGD 4LLDB 4NO2A 1VERA 1EJ6A 1XF5B 5F88B 5GZNC 1DVFC 1JFQL 4JO3L 5CBEB 3CFCL 3F7VA 3LKSB 3GJEA 4P5TC 5LXGH 2EDWA 4IRJA 4RWYH 5DRWB 4APQC 5KTEH 3ULUH 1MWAL 3EGSB 4P2RB 1JWUB 3CSYA 2NZIA 2R1WB 1I7ZA 1IGTA 4GG6E 1N0XH 5CCKL 4YFDB 4Y4KD 1MJUH 3BH8A 2EIZA 3QDGE 3PP4L 3SGJA 3K8MA 2ZPKL 3UP1A 2Y4SA 1DSFH 4H1LA 2XZAL 1SJVA 3P4OB 5DFVD 3UJTL 3CLEH 4C4KT 5GGRA 2I9LB 4CN6A 2YD2A 3EKCA 2OTUB 4Y2DB 2VC2L 3X12B 1X7QA 4NFCA 1RQ5A 2BSTA 1U8KA 4PS4L 5J11C 3MLVH 4Z7OF 3VJ6A 3DSFL 2APVA 4M6OL 2R0LL 4BYHA 4PGBB 4DEPC 2ADGB 4RAHA 4MAYD 4YUEH 4YHNB 4H8WC 3PHOB 4I9WD 5EBGA 3UTQA 1J5OH 4GBXD 2AV7A 4Q97A 3QHZH 3ARWA 2O5YL 1I7UB 35C8H 4GQPH 1MREH 2CH8A 1MY7A 4JDTH 1D3CA 1FCGA 3RY6C 1JNLL 3B43A 3WFBH 4QHLA 3CDCA 3VGBA 1YNTA 3IAGC 4HHAA 3SBWA 1NAMB 1W0YT 3MUY1 4ZAKD 1I9JH 1IGMH 4KK9C 1MPAH 4WEBH 1KYOJ 1KELH 3MZGB 1VESA 4KRPB 4MX7B 2I24N 3WIIL 2IFFH 3ZL4H 1CVSC 1M71B 4RZCB 3HC4L 4NHUB 3QJFA 1H3PH 4Y2DC 1CD9B 4QRQA 4WFED 5IKCB 4R0LB 1J87A 2OJZH 2JELL 5DRNB 4HS3A 5IVNA 4K9EL 5D7JD 2BVPB 5C0RH 4TN9A 1FNHA 3I75B 2G5BA 1KNOB 1X5XA 5FB8B 3HG1B 4OZHE 1NFDE 5I1IL 4FQHB 4F15B 3X13B 3EYVB 5J13B 1AGEB 3RU8L 5JW3H 1UEMA 3TIDB 5C0DA 3BIBX 3T0XA 3WHE1 1Z2KA 5EO9A 2DOCA 1T83C 5EC2B 3V5HA 3F7YA 5IROC 4ORZC 5E9DB 3ROOB 3B9KC 4DQOH 3QXWA 2Q76B 3B4NA 5CSZB 4XP6H 4AYFA 5DLML 5F3HA 3U0TB 1Q9KA 5LG1A 3MXWL 4KRPC 4MGXA 2ITCB 4HT1L 3ARPA 2B8OT 1A5FH 3HNSH 4TTDC 1ZEAL 2EDNA 4P3DB 1JPSH 2VTFA 4Z95L 4I4WA 1MCWM 3QXVA 4XCEA 4JRYE 3LN4A 4U1MA 5J6HA 5K9KA 4EKXA 1E6OH 3QA3A 1U3HD 1FJ1B 3IDMA 4ELKB 1I8MA 3D85B 3PWUA 5B21A 1AJ7H 2NY4C 2YBRA 4XHQA 4F15C 5J13C 1YPZB 1FZOB 2CLRB 2OTPA 3OSKA 2I26N 3O4OC 4Z18A 3MV8B 1F6AB 5JW5B 1UWEL 1KCKA 4LASH 4K94C 1G9MH 2GT9A 12E8L 5BV7H 2C7UA 2QJDA 4X7SL 3KPSD 3STBA 5I2IA 3GHBL 2F8VA 1KTKE 1UWGH 4XMLH 3HLAB 3SE3A 4D0BB 4Z77A 4P4KD 4NBYB 4IOFC 4Z76A 5C1MB 5D96B 5C07A 5IHLB 2ZCKL 4LQFL 1QBLH 1ZHKA 4LNRA 3K7UA 2DYPB 4LAJH 3RUGB 4FQXB 1AGCA 4TNWF 2ICCA 4ZPTA 3OB8A 3H3PL 2ID5A 3L3DB 2W38A 2XI9A 1H0DB 5ISZB 2GSGB 1S7TB 5D93B 4WHYG 3ULSA 2I60L 3QQNA 1KJ3H 5EZIH 5JHDA 1JPFA 3ILQD 3PDDA 5I8OL 2OR9H 2WWKT 2CIKA 1A4KB 4J23A 1SJEB 1U8LA 2OL3A 3O2DH 1I9RH 3X14A 5HVFB 4MDIA 2NTFB 3DX8B 4PRPE 2YPLB 3CDGA 4N8VA 3KPRD 1FNGA 4J4PC 4R90L 2C3GA 3VH8B 1UZ8B 2X40A 4MXWL 3QQ4B 3L1OL 5T33H 4CVWA 5F9WB 3QDAA 3WXVH 4HUXA 2W91A 4I3SH 5AAMA 4ELMF 3IVKA 5LGHL 2ARJQ 4KI5E 3GSUA 43CAA 1T0MB 5SWZE 5BV7B 4OF3A 2D4FA 1MHEB 4FQXC 3NFPB 4YWGH 5DJ6A 2BNRD 1DL7H 4HBCL 4Q0XH 3L3GB 1EEQA 3BH9B 2NY5C 1CR9L 1S9YB 3CFDB 1RZKH 5HHPB 1A6AB 3LEYL 3LCYA 5D93C 4U6HA 3C8KB 1ACZA 5E6YA 3LN9A 1NANI 5IB2A 3QCUH 4Y4FD 3GO1H 3TVMB 4PJ5D 1Y0LB 3B8SA 3FO1B 3AB0B 2J88L 5D7SH 5D5MF 1PZ5B 1LMKA 3D0VB 2F8XC 2EXYC 4L4TD 4MNQE 4OCLC 4QRPB 4OZGF 1YEFL 2Q8AH 1B2WL 4EXPX 4G6KH 5F9WC 4PJ9A 2W65B 5JMRA 4I2XA 3QEQA 2EDLA 1BVKA 1QSFB 3CU7A 1J0HA 3MRLA 3N85H 4D0DA 3V6OA 2DLFL 1A0QH 1QRNE 1C5BH 1FVEB 1AFVH 4X4XA 3SKJH 4K23H 4R4BB 1SBBA 4XNQA 1S7QA 3C6SB 4KVNL 1VA9A 4NQCE 2A1WH 1C16B 2O93L 3OKMB 3GSWA 1E4WL 1QRKA 4U7MA 2EZ0D 2DDQH 3B3IB 2V7HA 1FVCB 3TV3L 4QNPE 3KYNB 3E2HB 1JPTH 3GK8L 1UACL 3AB0C 3QUXA 5K93A 5FAAA 3IAPA 3BRFA 2GCYB 5DSCB 1U8JA 1Q0YH 4YEFA 3GSXB 3P4MA 3LHPH 4JRXA 4YHLH 2X41A 4O02L 4ETQB 1A7QL 4XRCA 4WGVB 4EDXA 2VH5L 3TJEL 3Q0HA 1A3RH 4CL7A 3RIAK 5MEND 2VXQL 5I8EA 1IAII 2WSKA 2J4WL 4MXVF 1NBVL 2D31B 4HGMA 3B5GA 4N9GB 5JQ6L 4WNQB 2DQHH 4X83A 4OLXH 5B38G 5D6CB 4F7EB 3WS6C 4JFDE 1QQDA 1U2CA 3LDBC 4WO4B 5DD6A 3L6FA 1PY9A 4EVNB 1ORQB 4JPKL 4YDIL 2FR4A 4E42B 4JN2B 3E2HC 3NCYP 1BFVL 2D7OA 3QWRD 3TN0D 2XKNA 3TFKD 5C09B 4MD4A 5GSVA 4P23A 2VXUL 1P7QD 3EYQD 4F58H 4PJ7E 2Q6WB 4M9PA 2DLHA 3MGTB 2ICEA 2ZUWA 3ARBA 4XCFL 4RCAA 3CVHH 4H1LH 5IV2A 3LKPB 1H3VA 5FHAH 1GXEA 1RIVH 5GGVY 3TA3D 1KYOK 3NA9H 4BH7B 2I5YH 4HDIB 5MHSD 3CZJA 2CDEA 4UIMB 3QXAA 4U1JB 2DQCH 4HCRA 5E5RB 3B9AA 3LOWA 2GITB 5A2IH 3P11H 3A6BL 2ARWA 3FQXB 2YD6A 3DX6A 4WHYH 4L4VE 4GKZB 4P2OB 5DMIH 4WO4C 2HWZH 3BPCB 4M7JL 1ZV5A 3QAZC 5HY9A 4LU5H 5CEZH 5T5NF 3DROA 3A6CL 3P9WB 4D8PA 3V7MA 1XCTA 4PV8A 3IB4A 2HFGH 4K7PY 4RX4D 3AVEA 3WNLA 3FOLA 5TDNB 5INDA 1X5LA 3ARDB 1RZJH 3LKQB 3OX8A 4XH2B 4AEIL 4OLYL 4DGYH 1EAJA 3TT3H 2BSSA 1WT5C 3QULA 3T8XA 1LQSR 2X9WA 5FDWA 2A9MH 3IFOA 4YXKL 4HIHB 2CLZB 1DFBH 1SEBB 1N59B 3L5WA 4G80A 5EFIB 3VFGH 4LCCB 3CVHB 3H2WA 5BZWB 1D6EB 2B4CH 4LBEA 2JIXD 1UH4A 4WWKB 1XF3A 4NQUA 2AAVA 3NACH 1KENL 3WKML 2GTZA 5GGQH 4ZUWB 1CN4A 2BJML 2R9HD 2BSTB 2PW2B 3CC5A 5LWYL 3MLXH 3BKML 2E6PA 4I3GA 4Q6IA 5AYUL 4XI5D 4N9OB 1FYHB 3M1BA 3BFOA 4JGUA 5DWUH 3UMTA 3TJHC 4U3XA 2XWJB 4LAQH 3HC0A 4EDWL 2A0LD 1DUZB 2VAJA 3GGWA 1R5IA 1GIGH 5FYKH 5F1NB 3ARDC 1LEGA 4GQ9H 4H5SA 1JF5A 1RUPL 4Q9QL 1WJ3A 2HTKC 3LKNA 2LU7A 5J1TC 4XNUH 3N1PC 5I1LA 2SEBB 4AH2B 4RAUA 4LCCC 3FB5A 3GSVA 4ELMA 4G8IB 1QBML 1A1NA 3DX7A 5LGJA 4WWKC 3VXRA 3SOBL 1LK3H 3IFLH 1IEBA 4YHMH 4I1NB 3IDGA 4XNYL 5HYIA 1JHLH 4NQDB 1UEYA 2DL9A 5E8EB 1S7WA 5FYLD 4MVBD 1YZZA 4N1CA 4UOW0 3SY0A 2MKWA 3VG9B 4RMWA 1UH3A 3LVEA 1T20A 3ARTA 4KJYA 2R1YA 3H9SB 2BXYA 5IEHA 1ZTXL 3SDAB 2E8ZA 1RVFL 1MFCL 5JW4Q 3RGVA 2DF3A 2HLFC 3F65A 2F9BT 3NN8B 5D5MA 5KJRL 1I1YA 1EHXA 4Y4HB 5F9DC 2FEDC 3LS4H 4X5XB 3VFSB 3V7AE 4OB5L 4V1DD 3F7YB 4OZGA 5DJ8B 1M05B 5IB3B 4L8DA 1QR4A 3DMMB 3SE4A 3L3HB 1N6QL 1JHKH 3D3VA 5DJ2B 5BS0E 2XKUA 2O5XH 3BPOB 1CD1A 4AM0B 3MACH 1JRHL 3PGFH 1NGPH 2N7AA 2JB5L 4BFEA 2J6EA 3L3JA 4O2EA 2O5ZL 4I4WB 4PJHE 4N0RA 3OL2A 4MDJA 2YPVH 1JHTB 3CDFA 5GGTA 5HYQA 2OL3H 2PO6D 3VG9C 1TIUA 3PWUB 4OZIE 3CXDH 4X5WA 2JKXA 4BSWA 4ZNEE 1AQDA 1T5WA 1RIUH 3SDAC 2P8LA 1N5YL 2DBLL 4Z0XA 2HT2C 2RCSL 5D2NE 4AQOA 3KLHD 4KK5D 2BDNH 4R7NA 4XCYB 4CADA 3U2SA 1TTUA 4KRLB 4WUKL 3EO1A 3O6MH 1PZUB 4NSKA 1O7VA 4JFFE 4WW1A 2BSRA 1YNLH 4KVCL 4XNXH 5ANMA 3VFPA 1Q9OB 3GMRA 4OZ4A 3BXNA 4YDVA 5J3HC 5BOZG 1NLDL 2I07B 5I9QB 2E8YA 2AK4B 3GI9L 3QZWA 3TZVA 2VDOL 3BKJL 2F19L 5JW4N 5B8CB 3EW3B 1CFQA 2J7LA 5GRJL 5HSFA 1UJTA 4R26H 3VD7A 1OAUH 4HG4J 1EA9C 2I27N 3HE7D 1RIHL 3MLUL 2D03H 3BD4A 1LEIB 4KRNA 5B38B 1QVOA 3MGOA 2ZSVA 1MF2H 3CX5J 4QHNA 4EIZC 5H2BB 4G6JL 3REVA 2C3WA 1XFPA 1T7VA 2GJ6A 3I6KB 4CNIA 2EO1A 4DTGL 4JHAH 15C8H 3NCYS 4DW2L 3H0TB 3TBSA 4HUWA 3TYFA 3FT4A 4PRAA 3NFSL 4FHBD 3BZFB 4Y1AE 3FQTB 4NJAL 3LQZB 3EFFB 1F58L 1VFAB 5SWSD 4WTXA 2XXCB 1RFDL 2F5BL 1X5AA 4J3SA 4YE4H 2UV3A 4D9LL 1QSEB 3U1SL 4HUXB 4N1EA 5HYJD 5I9QC 5I17A 3VW3H 4HUNB 4QXUL 4UOW1 2XT1B 5DK2A 43CAB 5C08B 5B8CC 3ZSSA 4LDEB 1LDPL 4W6XB 4L3CB 4MMZC 2AEIT 1FLTX 1IKFH 2ZG1A 3MRBA 3H3BC 3RWFB 1S78D 3P0VH 4TNVK 1DDHB 5GSRA 5TF1L 1CDCA 1G6RL 4YIQB 3RL2A 4C56D 1FO0L 1L0XA 3GUTB 4N90E 1ZSDA 2H8PA 4NN6B 4KJPD 4XWOC 2A77H 5D8JL 4HXAL 1OTTC 1WFNA 5EOTA 2ZOKA 1NGQL 3VCLB 2G9HA 4X6CB 3TIEB 1J8HA 4UI2A 2X89A 4RBPH 1PLGL 1JI1A 1KBGL 1IRAY 3KLAA 1FNLA 4UB0H 5DJDA 4AQ1B 1J0YA 4R4FH 3MRLB 1R3JA 2Z4QA 4GKNA 4D0DB 1E28A 4TSAL 3CLFH 4X4ME 1N64H 3S4SG 1BF2A 4XCCL 1PKQB 5HGGS 4PJBE 1G7LA 1RJYA 5K59E 4DFHA 4K3JL 3FKUS 2L4OA 3VXNA 4G3YH 4PJDF 1EMTL 1R5WA 3TC9A 3KNBB 1D5XA 1RZ8A 2H1PH 4Y5XB 3AGVA 3VA2C 5I1DA 2Y25A 4P57B 1EFXA 2Y7QA 1A14H 1SJHA 2HT4C 5L8KB 2F53B 1KG0A 3EDKA 3HUJF 4YQXL 5IBLC 1HQRA 2D4DA 3VFWB 5FO9B 2ESVD 2Z93B 3ARGA 3QDHA 3X3FL 2EIEA 4HCRH 1U8JB 4MQTB 2P43B 4MJIA 4HULB 4YPJA 5B3JF 4JKPL 2EC9T 4N0UE 1ZOXA 3BP4A 2VLKE 4MD0B 1RMFL 2HRPL 4HKJB 4XRCB 2IANE 1YNKL 3QZWG 1YYLL 3PV6A 3QEGL 5IB5B 1MLBB 5E2VH 3RRQA 2OS7A 5E8DL 1T7YA 2CKNA 4Y4KA 5E24E 1I8KB 4NQED 3OAZH 5GRUL 1QPXA 2CK0H 1CFSA 4QGTA 4HWZA 3MRMA 5J1AA 2FR4B 4Y5XC 1G9NL 3FB8A 3G6JF 1FYTE 1MIEL 3DXAE 3FAWA 3D25A 2CPCA 1AIFB 5LQBH 8FABA 5GSVB 4R7DA 4LL9A 4PLJD 4MAYA 2CRMA 3ZKMD 3INUL 3VFMB 3ARBB 1MAML 3DWTA 1HKLH 4E41E 4LHUD 3I2CL 4F7MB 3MLSL 3KXFE 5IVZB 1P84J 4YX2L 1MCPH 4YHPA 2X10A 3UC0H 1KIRA 4TVPL 3TESA 1KACB 5T1LA 4HUVA 4OGYH 2HVKB 2AGJL 1RUKL 4IS6A 1RK0B 3KPNA 2OBGA 3HPJB 3VXQB 2CDEB 5EU6E 5ITBH 3DVGA 3MV7B 4WU7B 5HD8D 2HH0H 3HA0A 4ZAKA 3EAKA 3S9DB 3D69A 1WFTA 4X7TA 5AWNL 1REIA 3MC0A 3UJIL 2YA1A 1N8ZB 3EJZC 4PGDB 4PD4J 2W0KA 2AEPH 5T5NG 1P2CA 2F54B 3QRGH 5C0EB 2XG4A 5JW4R 1BOYA 2VOTA 3ARFD 2PCPA 1ZT4B 5I66B 1RUAH 3H9HB 4D0CB 4FFYH 4KTYA 1TTFA 4X7CC 4H8WL 4PJFE 1Y6KR 3U46A 3F5WA 1R5VA 5I1EH 4LDOB 3T4YB 3OX8B 4LDLB 2Z8SA 5CUSH 5C0CB 1OAKH 3ULVE 5JZ7C 2BSSB 5HDBF 4JKWA 1DQQA 2B7DT 4YO0A 4HIJA 4HKZB 4JG1H 3L5WB 2XA8H 3PE9A 3VWKA 1YY9D 4G43B 1UZ6F 5D7IF 5DDHB 2PTTA 4QT5A 6FABL 4GKSB 1XF3B 2EEAA 4HZAA 2IQAA 4IDJL 1F4XL 5EPMB 1IAIM 1JGLL 4JQVC 4CMMA 3ZMRA 1BVZA 3RWHA 5KSUB 2AXGB 4J3VA 1U92A 2Z8VC 3O3DA 3HZMB 4ZOAA 3OJDB 4Q6IB 4HFUL 3EZ8A 2X1PA 1U3HA 4YR6B 2GAZB 3KYKH 3BZEB 5EU3A 1R3LA 2VABB 1JGVL 1HH6A 4EBQH 1V3MA 3GGWB 4JGMA 3UTSB 4EUPA 2J6EH 1LP9B 1S9XB 2ZCLH 5EU7E 2VISB 1NAML 3KPSA 4ZUVA 3F62A 2J8HA 5DK3A 4HG4K 4JPWH 3OBAA 4NNYA 4U6VL 1HOCB 2YN3A 3G08A 4Z0BL 2QHLA 2MQ0A 2Z31B 4Z7QE 4WW2B 5DJYA 1F2XK 3CX5K 1TLKA 5E00A 1A3LH 1NCUA 3GMOA 1FFPB 3O8XD 1CFNB 1CLOH 2R2EB 4TUOB 3DURA 3VFOA 1KULA 5I75B 1NFIA 4PG2A 1T7WA 5FHBL 2EECA 1D5IH 1YEDA 3HCVA 4WGWB 3IJSA 3PWLA 1FSKB 1P4IL 2IPTL 2ZSWB 5ESVA 4J8RA 2BRQA 1I1YB 4I18A 1A9BB 3GSQA 4MWFB 1EBAA 1F90H 2ARJB 2DKSA 3ELAT 4HJJL 3HZYB 4K94L 5JLZB 1AHWB 2DQFA 4K71B 4NWUH 4CGTA 1IAMA 4J3OC 3FTGB 2DKMA 3KPRA 4FQ2L 1NUGA 3OB0H 1TPXC 1GSMA 3CPLA 3ZE2E 3OKYA 3MRNB 2Z31C 4NM4H 4BELD 4WW2C 2EYRB 5ERWB 2NZ9D 3S4SB 2NW2B 2J1KA 4MHHG 3DTXA 3VFNB 3GM8A 4FA8A 1SM3L 4U6XB 3WJJC 5B39A 5DJCA 4OCWL 4ZSOE 4PJDA 3QFJD 2QKIA 5I75C 4I9WE 4QXWA 4TOYH 3NABL 3SDYH 1ROWA 1AQDB 3O4LB 5TDOB 4G6AC 3WXWH 1FSKC 3HUJA 5C0AB 2OTWB 1JMZA 4S1DD 5GGRY 3PQYE 5FXCH 3BP7A 3HFMH 1PJ9A 2ICES 2OLDA 1A6WL 1YEGL 4PJ5A 4XAWL 1GPOH 4FFVC 5EBLA 3EO1B 2X2YA 1E27A 1AHWC 4K71C 4U1GB 5DQJB 4NSKB 1T03L 3BZ4A 1KCLA 3K1KC 1JNNH 4YDVB 3QDJD 3F7PC 3F6IA 2YRZA 4JFEB 4MJ6B 1S7SA 1BBDH 3QZWB 5LBSL 4TSBL 1FL6A 3PNWA 4LIQL 1KLGA 2Y5TB 4DCQB 2NY3D 2E7MA 1ZLUH 1XIWB 3AS2A 1IFHL 3WD5L 4X4ZA 4RIRB 3K8LA 5DR5H 4PJ8D 3MJ9L 1GGIH 3H7LA 1D5MA 4MA1B 1VEMA 4YJZL 1IM3A 2C4XA 3G6JA 3REVB 5AUMA 3BQUD 2OXGA 3U7WH 2GJ6B 3ZE0E 3NMEA 2P44B 5MEPA 1P1ZA 4JDZB 1AE6L 1RJZA 4KKBD 5T3ZH 3KPMB 1E4JA 3IJYA 4JO1H 4ZD3H 3VXMB 2D2OA 1OHQA 2ZOLA 1YMMA 1MCBA 3H6JA 3RAJH 4U1GC 4YHOL 4ONHA 1A6UL 4OUUA 4G6FB 3PGCA 4OT1L 1S7XA 2HTLC 3OJMB 4KUCF 2UYLA 1LD9B 5IVXE 1P69B 3K74B 3O3EB 4HAGA 4UDUA 3FO0H 1F3DH 2DQGL 4PJCF 2BVQA 1L0QA 2YD9A 3KJ6H 3CFIC 2VLJD 1A7PL 4HJ0C 3ZHKA 1XIWC 1P4LA 1G1CA 3FFCD 4X98A 5ICYB 4U1IB 5TQ0L 2CR3A 3OGCB 1WWBX 2GKIA 4MA1C 1KOAA 3P9MB 4FNLL 4QOKE 4XB8A 1W72L 3K80A 4RA3A 2J8UF 1QR1A 3Q3GB 2X9XA 5KS9E 1MJJA 3D39B 4PJGF 5DS8A 5C0JA 4NQVB 3I3BA 1P84K 3U83A 1FN4A 3GB7B 3UTTE 2DB8A 3QWRA 4A6YB 1U8MA 4S0TD 4JY4B 5HVHB 3QJHB 4RBPK 3FB6A 3HE6B 1P7QA 1OAXL 4FG6D 2G9HB 2VJXA 1AY1H 4HS8L 4K8RD 4X80H 5K9JH 3BSZH 5BQ7A 5MEQB 2R0WL 2EH8H 3EJJX 3GSOB 2EDBA 1LO0L 3TA3A 4XPAH 4YPGA 3C60D 5FGBC 2YEZA 3QWQB 1T1YA 1R3HA 3FHAA 1CLYL 5D7IA 1I1RA 1I8LA 4PD4K 3HPLB 3DRQA 5CZKA 1N6UA 2XPGA 5ALBH 4G9FD 1K8IB 2Z9TA 3LKRA 3MSPA 5KSAA 1NDGB 1TETH 1UYWH 2A38A 3SJVA 3DO7B 5JPMA 4UT9L 4YXLH 1RZ8B 4M7KH 3VXSE 4KDTA 3VI3F 5EIIA 1AO7D 5I1DB 5I73C 4XPHH 4GRWB 1A7NL 3SDCA 2N1KA 3BKYH 3WIFA 5EU5B 1HQRB 3GKZA 5HVHC 4YLQT 4LLVA 3RPIB 1X4XA 2GSIA 3HE6C 1HE7A 2AQ2A 5K33A 2WBKA 1EEZA 2NY0B 1GGYA 4RX4A 1UM6H 1QFWI 4UNUA 3SDDB 3NIGF 3QUML 2A6DB 3MOAL