4GAGH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 412-423)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
212
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
total genus 45
structure length 212
sequence length 218
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gagH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gagH02
2BRRH 5F7UA 1N4XL 3O6MH 4NO0D 3KJ6H 3U2SA 5JW4Q 2E8YA 1MHCA 1Z9SA 4K94L 3QH3B 3DMMB 4WJ5B 5GRJH 4MX7B 1NEZB 1XCQB 3LKOB 3UBXB 2W0FB 1I8LC 1MLBA 1I3UA 3FQXB 5IM7B 1CG9B 4G7VL 4LLWA 3T2PA 4XNZB 4FFYL 4U2ZA 1KUMA 2EC9T 5E99L 1BWWA 5IHBA 1CL7I 4N0CC 2XWJB 4MHHG 5ILTH 1KTLB 3MFFB 5E9DD 2Y36L 1ZHNA 3V52L 3UPRB 4NKOA 1F4HA 3VXOA 1JRHL 1M05A 2SEBB 3UYRL 4E5XA 3GHBH 3L3KA 1U2CA 3TBSA 4AQ1B 1A5FH 3FB6A 3RIFF 3G6JA 3ZKND 3OV6A 4BK4A 3I6LE 1IM3A 3WJLA 5DR5H 3WUZA 5FK9A 4HIHA 1HWHB 1IGYA 1DVFD 5C0CA 3LRSA 3SJVA 3VFTA 3W0WB 3VXUA 1LQSR 2AEWA 3WFHA 2X9WA 1TZGH 3MLYL 7CGTA 4OB5L 2GJ6E 6FABH 1U41A 3RWJB 5EO0B 3OGOE 4X5XB 5AZ2L 3UTTE 1M7XA 3GKWH 4S1SL 4ZAKA 3PWVA 2W60A 5FA3A 3MRLA 1I9IH 2ZSWB 1YY8A 3S37X 1CCZA 3P0YH 5JHDA 1MCBA 4NZRH 1Z0NA 5C0IB 1N59B 3GSVB 2RGSA 1LO3H 2D0HA 2CLZB 4FXGA 3QG7H 4PJHE 4HS8L 2BC4B 5F7NC 3U46B 2PCPA 2HJLB 4PPTA 3VFSA 1M7DB 3OXRA 1BBJB 1J0HA 4XPTH 5IHZB 1NCDH 2O5YH 3PHOB 2J6EA 4CKVX 3IDIA 1T5XB 4NRYA 3SO3C 2HLAB 4U6XA 3WEXB 2DWEB 2H32B 3QWOA 4GBXA 4L4VD 2OLDA 4ZYKB 4NKIH 4OD3L 3HMWH 2FHCA 1KJ2L 1JI1A 1NGXB 3NABH 4NQCD 2OTPA 3RA7L 3WIIL 5DJ6A 2UUDH 2RHEA 3GBLA 2IWGA 1YUHA 2AJ3B 3IGAB 5E2TH 4RGMC 3GSOA 2EE3A 3TA3D 3O6KH 2W91A 3CC5B 4HK0A 4UT6L 4EUPH 3NCEB 3ESUF 1P4IH 1KEGL 3P9LB 5C9JB 5HHQB 2AABH 2HLFD 3DUUA 2YK1L 4LSSH 1CK0L 4H26A 2DLGA 5JOPE 1U92A 2YS4A 4U0RB 1P7QA 5CD3B 4UTBH 3QHZL 3QHTC 1YMMA 1ACZA 5GQBA 1YNKH 3KLHC 1JPSH 4W68A 3RGVD 1R3IH 1OTTD 4G3YH 4WGVB 5GGRA 3HR5B 2EDNA 3KPSD 3MOAL 2F8OA 5BXFA 1QEWA 4Q0XL 4KK8C 1TVHB 5F96H 4UU9B 2PYFB 4POZD 1MWAB 3P9MB 4J12A 4XC1H 3O8XD 1C5DA 5J13C 3E3QE 3QA3B 2Q76B 3ARPA 2H2SC 5DI8B 4JANB 4IOFC 4OZIA 1YDPA 4OLXL 4MD0A 4LKCB 3RVXC 4QO1A 4IHOB 2V7NB 3FHAA 4NM4H 4Y88A 4KROC 5HI3C 3TBTB 5I75C 5I71B 3DX6A 3KHQA 5J6HB 5SWQB 2DTMH 1ZTXL 4H8WL 1U3HD 2ENYA 2ARJA 3F7RA 3GMOB 3G5XA 3OAZH 2Z0BA 4KJQC 2WK2A 5BV7H 4KVNL 4OZHF 4LSUL 5D1ZB 2D03L 2G75A 5E6ID 5C07D 5IVOA 1BLNA 3ULVD 1VFUA 1LEGA 5JUEL 2JE8A 2GCYB 1MEXH 3EFFA 1N7MH 5FYLE 3U0WH 3UBXA 3KYMB 4LSVH 2FX9H 1T1WB 2V17L 4JQIH 2VDRL 2UY6A 3IETA 2Z31D 5CAYB 1P9MA 1NFIB 1JPTL 1AQDB 2FEEI 3IS0X 4ZXBA 4NRZA 4BUHA 1D5MA 3OGCA 1JRHH 5L8LB 4R97B 4MNQE 2X4OB 4APQD 3O4LE 3HZVA 1WAAE 3CX5K 3UZEA 2IPKA 2P4AB 3FONA 5DYOA 2VZ1A 2JJTC 1AFVH 2X4UB 2ZSVB 2YRLA 1C5CH 2YZ1A 1PGRB 5SWSB 4YHKL 2VDQL 2R2EB 4P9MH 5GS3A 2JTDA 4I2XA 4JZJA 4LK4A 5DZOA 1G7QA 2X4SB 1RK1A 5KN5B 5J11C 1JUFA 1UXWB 1RI8A 1ZLVH 1I9EA 3GNML 1U42A 2BOBA 5HHVL 1FGVL 1SVCP 1MI5E 4LSRL 5IB2A 4UDTB 5DLML 1AD9A 1ZVYA 1BBDH 5EO0A 1P2CA 1ZGLP 5CEZH 2BRRL 2X7LA 4P46B 4ZAKB 3QXDA 4NP4H 3UAJC 3GSQA 2W60B 3JSSA 1D9KB 2AEQH 4H0GA 4I2XE 4L29A 1U3YA 5C09D 4XP9L 3ARVA 1F4XL 5KOVC 3F8UB 2IALB 3FRPA 2OR9L 4PJBA 4F7MA 1YPZF 4BH7A 1UH2A 1IAKA 2WBJC 2Z91A 3FQRB 1I8IA 2E7MA 1FIEA 2EYTA 4OSUL 4AZ8A 2OZ4A 4LARL 5LJYH 4DQOL 4PV8A 3BPLC 5JA9A 5EB9A 4N9OB 3VG0H 1FZJB 3O6FD 1MIMH 2CSPA 1LK2A 4N0CD 5DJDA 4G6AC 1WEJH 5DGRA 3DSNA 4XPHL 4GRLA 1B2WL 3WEXA 3FB8A 1CFTA 3H9HB 3T2NH 1I1YA 2Q8BL 2FJHA 2HWZH 4F58L 5BZDB 4CW1A 1MCFA 3ZL4L 4ZMAT 5K93A 4W4OC 3ULUD 2A83A 4HHAB 2AJXL 4X4YB 2P49B 2NZ9D 2OBGA 5DJ6B 4TUKH 2WUBL 3ZKXB 4XWGL 3BP6A 5DR5L 2Q3AA 3Q3GA 2QSCL 3U36B 4Q6IA 5I15H 5ACLA 1CLYH 5E08L 2D7NA 3AB0C 2HFGL 5IFHH 3FHQA 1RY7B 4YHNA 3O4OB 5KW9L 3D3VB 4JKWA 4NJAL 4P2QA 1J1OH 5CP3A 3EFDL 3GSNH 3IFNH 4ZUUB 4XVTL 3DUUB 5IVZA 1ZA6A 4QXGL 3X14B 5FECB 3T1WA 3LKNA 4N1EA 4CN6A 2JB6B 5IHUL 4S1QL 3FN0H 4BFBD 3B5TA 3EZJB 5CEXA 1FAIL 3FT3B 3WD5L 4NFCA 5CKGA 4QRTA 4Z78B 1SYVA 4XX1E 4XNQA 3MO1B 4JQVC 3LDBC 4MXVE 1VKXB 1BWMA 3L3HB 1AE6H 3KVQA 4MXWL 3LS4H 2HKHH 3TA3C 2EEAA 1GZQA 4MS8D 1Z5LB 5DI8A 2XA8L 4WHDA 3IRPX 5D7SH 3S4SB 2VQUA 4GG8B 4KJPD 2Y5TA 1K3IA 1UWEH 1NUGA 2V7NA 3HLAB 1A0QH 4K8RH 4ZXBD 2B2XL 3RTQA 4BQ6A 5JMRA 1JK8B 1HSBA 1TZHA 2I9TA 2EIBA 3O4OC 4K23H 4PRPA 2AV1A 4U1KB 4YZFE 4DCQB 5HYJB 1TPXC 1GGBH 1Q9KB 2CKBA 4YDLB 4NO2A 1RUPH 3T0DA 4NGHL 3WFCL 4RMQA 3HTLX 5HHOA 3TVMD 2E8ZA 3U0WL 1EHNA 3WFBH 4HD9A 2Q7YB 3V0AC 3SDAB 4S1QH 3BZFA 4KXZH 3UCRA 4M93B 4KKLC 1OM3L 1OP5H 5KSAC 1MPAH 1NUNB 3BFOA 3IFLL 5BS0D 1XCTA 1GOHA 1Y0LB 1YEHH 2D7QA 1RIHH 4TNWF 4GSDH 3U30B 4PY8I 2P46B 1T89C 3L3DB 1J8HA 4ZXBB 3V8OA 3HZYA 3TO2A 1A7QL 2A77H 5JQ6H 2HRPL 4FZEL 4WWKA 5CWSB 3AS3A 4U3CA 3L5IA 4JKPL 1TJHH 3S3SA 1DR9A 4I4WB 2F54A 3O3UN 3LEYH 5MI0B 3ULUH 3KR3H 5F8RC 1YEEL 3ARDB 5AWNH 4BSWB 4OQ1A 5F72S 5EBWB 3F7PC 5KS9F 4R4ND 2R2EA 3I2CL 1OGAE 3LQMA 5E6YA 3TJHC 1S7SB 5BS0B 3QHZH 4J4PC 4W81A 4PJDA 1PZ5B 4KTDL 3KAAA 1C16B 2AAVA 3PNWB 3ZKNC 1FDLL 5C0BD 5I1HH 5A43C 4B53A 5KAQG 3PUCA 5ERWA 1WC7A 2G5RA 3H42L 1EFXB 4JFFD 4ZS7H 4MHHI 3NH7L 1H3XA 7FABL 2DBLL 1B4RA 3LN4B 1Q0YL 3R4DA 2OK0H 2DQEL 3I6GB 2FR4A 5I73B 4GAGH 4G43A 5I17B 5FGRA 4MB3A 1XGPA 3EO9H 4S1RL 2NZIA 3KPQA 3ISWA 4DGIH 1DEEA 1YC8A 2M26A 2VKXA 2DTSA 1RULH 3HB3D 3CVHA 4OD1H 5B22A 2NTFB 3BMVA 4H25A 4M1CC 3WNMA 2PTTB 4KVCL 3CLFH 4FG6D 5I18H 4ZFOB 3B5GA 3IFOA 2G2RA 3DX8B 3SDAC 5DHYA 4RZCB 5IV2A 5ECJE 3RIAF 4OZGE 3UJJH 4X4XA 5IW6A 4NHCL 2DS4A 3RZCD 5HDLA 4LHUB 5LBSL 3WIFA 3ZL4H 4QT5B 1IC7H 3NCBB 3QIWD 1OP9A 1Y6NR 4EBQL 4HC1L 4ZOCA 1KIUA 3VXQA 4Y4HA 3MXVH 2F15A 4F7PB 3MV7A 3T08A 1JJUA 4J8RA 1FZOA 4IDJL 4LSQH 3FMGH 1JPGB 4Z7QF 2EYRA 3Q3GB 4NQDB 4J3UA 1F6FB 1LK3H 5DSCA 2FX7H 4HMDA 4PJXF 5L9DH 1NEUA 4MSWB 5IVXE 3HMWL 5E00B 3W5MA 4N0UB 5AG8A 1MCOH 1WBZB 4XVTH 2J6EH 4QWWC 3TN0B 3MV8B 1Q9LA 2VDLL 4HWUA 4DGVH 1RVFH 3ES6A 4JB9H 5ANMB 5IB4B 1X5YA 2A6KB 1X4ZA 2WIIB 2XZCH 4P23D 3DARA 3T0EC 2AV7A 5I66A 1ONQA 1FAIH 3HS0A 1I7ZA 5GGVH 8CGTA 2Y36H 4PRNB 3L7EA 5IMLB 4LPXA 2XOTA 5GISH 4YC2B 5TDNA 3BXNB 2BMKA 4MB4A 5D7JD 3GMPB 3QWRA 3V5HB 1IVLA 2K7PA 3DTXA 1U8QA 4P2RA 4RAUB 3MO1A 3QBTB 4LQ1A 1JZ4A 3QO1A 3V6BR 4NC1E 5ALCL 3RNKA 3RIAK 5E6IC 2AEQL 4M5YH 4XPGH 3U48A 3O6LL 4OZ4A 4KKCC 4F9LC 5DK2B 4I0KA 3IVKB 3SE3A 5A1AA 1NQBA 5CINH 5DHVH 3MLYH 2CJUL 1CDGA 1IGFH 1I1RA 1HK6A 3ARRA 3REVA 2I9TB 4H88L 3UDWC 2ADGA 3V5KB 2VDKH 1FG2A 3PDOA 5FB8A 5JHLL 5FYKE 4KZDL 3C8HA 5CMAB 4GKSA 3TVMB 1XZ0B 4WIQA 3RX5A 4HXAL 3A6CH 4P3WA 3P77A 4LPCA 4XRCB 5J06A 4G8IB 3PGDB 3PABB 1C7TA 3WBDA 3WIHH 4HDIB 5HXMA 3MA9L 1XCTB 1Y0LA 2YMXL 2A6DB 5AUMB 5TH2A 1NL0L 5LGKA 1EV2E 2VE6B 2ZPKL 4WWKD 3UZQA 1NMBH 1CL7L 4Y19E 1BPVA 1A7QH 4XHJC 1HHJA 1RHFA 4JPKH 3DGGA 4NNYB 1HI6A 4KV5F 5IFJA 3BP5A 3BH9B 2HFEA 2F53D 2OCFD 5KS9B 3JUYA 1IGCL 3CDGA 1KIQB 4NKMA 4UV7H 2Y6SC 3GM0A 4DOHB 3DVIA 3NFNA 4IEFB 3R8QA 1R5IA 1YZZA 1FNEA 5DFTA 1PW3A 1NGWA 2X4RA 5MEOB 4JAMA 3QEQE 4NM8L 5E8PA 5K9KB 5ISZD 5IFAH 1FFNA 3LS4L 1EA9C 1T7WA 3PWUA 4B7LA 2BNRA 2R2BB 1HHGA 4HWBH 3LS5L 3O0RH 1A6UH 4GUPA 5FYKH 2E7LC 1BF2A 3SN6N 4NQEA 1J0JA 1U58B 1FYTB 5IKCB 2NCMA 3PWPD 4G5ZL 3HAEB 1R3HB 3WIHA 5C86A 1CGVA 1G9MC 1MCJA 5BQ7A 1RZGB 2ZPKH 1EJOH 1UADC 5HHPA 4OT1L 4RISH 1BQHA 3HI1A 1Q9WB 2AXGB 4UQ2B 3MFGB 3VCLB 1XGPB 4U6HB 1T04A 4QHNA 3C60D 1RIVL 4ZPTB 4OV5B 4K23L 4FTVE 3CH8A 5J3HC 4W6XB 1IJ9A 4GAYB 2VLRB 1BFOA 3QCUL 4P49A 3QIWB 3T77A 4ZFOA 4NRXB 2HG5A 5HI4D 3A6BH 3MACH 3C60A 4PGZA 1MI5D 1KFAL 1LE9A 3RZCB 2C7UB 4RAVB 4U1JB 3SY0B 3FQNB 1KJVB 4QT5A 4X98B 1FVDA 1ZHLA 1R5WA 4OLZL 4JZOB 2NXYD 1NUDA 3X12A 1MJ8L 2E7CA 1JPST 3QEGL 1WEJL 4YBLB 3QDGD 4Y4FA 4OCNC 5I16A 1X5ZA 1NFDE 3JUZA 3G9VA 3G6AA 4OB5H 4NQDA 5AAMA 4NBZB 3NN8B 4X0KA 5A2FA 5FA4B 5DO2D 3WS3A 1FYTE 1FHGA 2UUDK 4HPYL 4HBQA 3ZZ1A 4N8CH 4Z18A 4Y5VA 3O2DL 1TVDA 2ZUSA 1K3ZA 3NFSL 2J88H 4R0LA 1WZKA 4TYUA 3U0TA 2Y9RT 4QF1B 5EULV 3TWCL 4X6BA 3U6RB 4UDUB 4BQCA 5E5RB 3MV8A 5ID0B 4EKXA 4LDLB 1H3UA 2EC8A 2FBJH 1JZ3A 3B9AA 1MCNA 5L7XL 5D7JB 4BZYA 2HFGH 3O6LH 3LB6C 4Y16C 5I66B 2FIKA 2Z92A 2C26A 3HS0B 1MFCL 1KCRH 3QDJB 5LGHH 1YEFH 2WBKA 1FN4B 5JXAL 1LO0L 2H45A 4I77H 4YHOL 3RVVC 3PWJA 2VLJB 3Q2CA 2VDKL 3RWHA 4JJ5B 3AREC 3AGVA 2DKMA 4PY8J 1R24B 1F4WH 2LABA 3VXSA 2NYYD 4RFNC 2GHWB 2HVJA 3VI4F 3U2SB 3VWJC 4N90D 4W4NA 2VZUA 3VWJD 3QH3A 2P7TB 1KLFA 2Y5EA 4NUJB 1RZIB 3WJJA 4XP4H 3V52H 1QFUH 5CZVH 2CGRH 3OKLA 4JM2C 2YD3A 2EE6A 1WJ3A 3G5YA 1R3JB 1CDCA 3QI9B 2JIXA 5GS2H 3QB7C 5BMFH 1HCVA 1BBDL 1S3KH 1S9YA 3O4LB 2ZUTA 4EI5B 4JN2B 5KG9A 2D2OA 3NAAL 1RURL 2MHAA 5GJSH 4P4KD 2YHGA 1XZ0A 3IDJB 4YHLL 2VH5L 5IB3A 1RSFA 4G8IA 3OXSB 1ZS8A 4LASL 2WMPA 3AAZA 1QSEE 3VXOB 3K80A 2VOTA 1WISA 5IWLC 1RZ8A 4QGYA 3UMTA 1V7ML 2PTUA 4GS7B 4U0RC 2J6EL 5HGHA 2BHYA 3G6JB 4D8PA 2CR3A 4DGYH 1I1AA 5AZEL 1NC4D 3KYOA 5T3ZL 4LCIH 2YN5A 5FK9B 3NBNA 4M8QB 4WUUB 1T4KA 2ZOKB 3N1FC 3IDXH 3NIGF 3KXFE 4FTVB 3VXUB 5CJQL 1J18A 2ERJC 1FFRA 3FOMB 4UZGA 1GGUA 2OTUA 2HWZL 4F58H 1TLKA 1F5WA 4KI5E 3Q6FB 2JJWA 3AUVA 5IQ7H 5FUZL 3T04D 3GSXA 5EPMB 2IAND 3TIEB 2YD4A 1EJOL 3AS1A 3I85A 4GMSL 1CLOL 4MCYB 4B7IA 1JHTB 5FA3B 2XI9A 4OZHB 4EOWL 2ID5A 3STZA 4IIQC 1CXHA 1NCTA 1JHLH 2LU4A 4PRDB 1FYTD 5K9OA 3O9WA 1S8DA 1A3LH 1BM3L 1DFBL 2GUOA 3VGEA 4Z0BL 2J3SA 3HAEA 2BNQD 3B2VL 3RWDB 1HDMB 1N7ML 4C4KO 1YMHB 3KPSE 1RZGA 1PEZA 5FIEA 4M6ML 4Y4KC 4P2RE 3BPNC 4JFDD 3TYFA 1DL7L 1L7TL 4XH2A 1BQHB 4GG6E 1UZ6E 2NX5A 1E4JA 2R0WL 4EI5C 3DGCR 2OXGA 3QWOB 1NBQA 3QPXL 2VRAA 2R56L 5ICXB 4WO4D 1RUQL 3O8XC 5K59F 1DQDL 3TJEL 4OZFG 4DKEH 5E8NA 3BRDA 5FUZH 1WUNT 2AQ3A 3TGXA 4M93C 3HC3H 3ROOA 5JXEA 3F7QA 4NRXA 1CFQA 3KWWB 4NIKB 3M8OH 4G8EB 5DA4A 4IRJD 2Y06L 2X4NB 4JEGB 4Y1AD 3BT2L 3ULVE 1QP1A 1OB1A 2P44B 4KHXH 2VWEE 1OT1A 5INDB 1Q8MA 1IEBB 4YHYB 1IE5A 3MOAH 3WFEL 2Y6SD 4LVNB 3RL1B 1JF6A 4PJAE 2FYYA 5FO7A 2DQDL 3VWKD 3AVEA 1OSZB 1I3RA 3O8XA 5HSFA 3I50L 4RDQF 1JPSL 4HLZH 4JFPA 4Y5YA 5BOPA 2V9RA 1EAPB 3BDBA 4YK4C 1N5YH 1YMMB 4PJGE 1A6PA 4WFGE 5F9AC 3UTPE 2HT3C 4IDJH 3BD3A 1HOCA 2PW2A 4OZFA 3OTTA 1DANU 4QYOB 3P9WB 2PYFA 1KJMB 4CVXB 4OI8A 3H3PL 5EU5A 3MLTB 2AJVH 2VXVL 3CDYA 4NQSA 3UTTA 2KQMA 3M8OL 4EZMA 5HI4C 3G6JE 2VABA 3L3OB 4PV9B 5D1ZD 3E6FB 4ALAL 5SWQA 1WZ1L 2FH8A 4QXUH 1T80A 4XBEL 2YRZA 4F8TA 2W0KA 1PY9A 4ZO6A 4KJWD 4C4KT 2DBJA 4OCYH 4AIOA 1RURH 3VXUE 1B0GB 1ED3B 2AEPL 3GI8L 4OKVB 5HD8C 4ORGB 1KGCD 4MNGA 4P0DA 1X4YA 4Q9QH 2Q8BH 3RKPA 3LSOA 1F3JB 1CWVA 5JOPD 4NUJA 3PP4L 2UYLA 3OX8B 5BMFL 2IMNA 4FABH 2EDKA 1VFBA 1TQCB 3QUYB 5C0EB 5IR1B 4KRPD 1WZLA 1NAMA 5D5MF 2APWA 4CJ1A 5L2JA 2W9DL 3EYSH 5FCSH 2ICES 5KSUB 2Z31C 4GQ9H 1EHXA 1QRNB 3BKJH 1QFHA 5I30H 5MI0C 4HEPG 4NZTH 3OXSA 4O2EB 1EBPA 1RMFL 3FONB 5DYOB 1AIFA 4DEPC 4QWWD 4NHUA 4YBQD 4C83A 4R26L 2AVGA 3OKNB 1FVCA 3I3EA 4GG6B 1INDH 4FQXC 4IRSD 5ILTL 2QSQA 3IJSB 4FN0A 1QLEL 1NGQH 1QBML 3OHXB 5F89A 5DMGC 1DLFH 1T4KB 4LHQB 2AKRB 5HHXL 3CXDL 4OV6F 5DLMH 3ZTJG 1WWAX 3PQYA 2IQAB 1MJUH 1A64A 4UAOC 1PY4A 1P4BL 4P5TD 4ZTOH 3RWFA 1LO0H 3NMEA 3E3QC 2Z4QB 3BOVA 3GMMB 3CFDA 4ESKA 1KCVL 5IBLC 3MXVL 3BQUA 2IANB 1J0YA 5I76A 3WUWG 3TPUA 6CGTA 4Z8FH 4LPTA 3W5NA 1BGXH 4V2BA 4YXLH 5D71H 1MIML 1P84K 3STZB 4K9EL 1E28B 1AHWB 3LN9A 5EU7C 4BH8A 1MRCH 2BNQA 4JM4L 4OF0A 4HEME 4O02H 3EUUA 2CDEB 3EJYD 1J87A 4LKXB 2FDBP 1NGZB 2EKSA 1U91A 2CPCA 4IBLT 4NGHH 3WFCH 2FNBA 5F88A 5T1LA 4MDIB 3D25A 2H9GA 2F53A 3U7YH 2IPUG 2I07B 5C0GA 3AU1B 2EYTB 1QTYT 3QXTA 2B4CC 2NW3B 5F7EH 3KYKH 1MIEL 5D2NB 1CICD 1P9MC 2GI7A 4GRLB 3L5HA 4D3CL 3D69A 1AC6A 3OB8A 5ICXA 1ZLUH 1S7WB 5JUEH 4D94A 4WHTB 2XN9A 4QTHA 4U6VL 4LAQH 2P5EA 4JPIA 2G60L 4Z8FL 4HZLB 5IG7B 1F3DH 2ZWLT 5HVHC 1B6DA 1A4JB 2ICEB 1Y6MR 1ZT4A 4X4ME 2YEZB 2X4NA 5FOBB 2R1XA 5FYKU 4F7CB 3ARBB 2X1WL 3ROLA 1ZT7B 1EVTC 1T0NB 1AR1C 4GRWE 1NAKH 2Q6WA 3VI4E 1S9WB 2FIRT 2YPLB 3FFCD 1ZA6B 3X14A 1YEJL 2YD1A 3UO1L 3TIDB 5FM5O 5HPMA 4HBCH 1GOFA 3DYMA 4LDEB 1MFBH 1G7IB 1EAPA 5IJVB 4MD5B 3BEVA 4BSJA 3FT3A 2WW8A 3HI6H 3W11D 4TRPH 1OAYL 2GAZA 4MZ2A 5L2KB 1FE8L 2Z31A 4LMQE 3VFPB 4OZFB 3T0EE 4YHIA 2X42A 4WRLA 1FAKT 4LAQL 1HIML 4PLJC 1JRHI 2HH0L 2VAJA 4MX7A 3GIZH 5KANG 3VMPA 1U9KA 3QUMB 1KJMA 4CVXA 3VE0B 4Q7DA 4JHZA 5C0DB 2Y7QA 4M7JH 4OM1L 5FKPA 3SHSA 1G7LA 3SDYH 3MRMA 3BO8B 1ZT1B 1A3LL 1GGBL 4ONGH 2WWMD 1VFMA 4LL9A 3B2VH 3PV7A 15C8L 4DCQA 5GS0C 3JBG7 4LNRA 3OL2A 1NUFA 4QCIA 4TTGA 5T1KD 4MS8C 4LCWA 4P5TC 4P2OB 3VXMA 2IQ9L 4FFWD 4YDVB 5D1XB 1A9BB 5DMGD 1WFOA 2QQLL 4WV1C 2FL5A 1OVZA 2XYCA 4XCFL 2GFBB 5IOPB 5GZND 5KVDH 3SE3C 4LCWD 1TCRB 5DMKA 3CSPA 4F8QA 25C8H 1S9XA 3VXMD 2R23A 3VU2A 4OZIF 3V6ZA 3HNSL 4Z7OF 1RJCA 4LNVA 5HDBF 4UV4H 1VFAB 2FGZA 2PXYD 3V9FA 3QCTL 1B3JA 2ZKHH 3SBWA 1T7ZA 1XR9B 4WCYH 5C09A 5I8OH 4WI2A 5EO1B 1ORSA 1MCRA 4ZO9A 4X5XA 4YH6A 4OZFH 3U4AA 1LDSA 4OGXH 2WBJD 4FFZL 3DVNA 3IB4A 1T2XA 4PJDE 4ZO8A 1NGYB 4X9HA 1IM9D 4KKNA 4RRPA 2MQCA 3D0VB 1TTFA 5EN2B 5JHDB 5C0IA 2EE9A 4PJCA 3TCXA 3OKDB 1KCSL 2PNDA 2VWEC 2E27L 2H26A 1GGIH 2EECA 4MJ2A 5HJ3B 5IIEA 4FZ8H 4LVEA 2HJLA 1D9KC 5EZIL 1AKJA 3VH8B 4Y1AA 5HVWA 3QO0A 3H42H 2RBLA 5AYQA 3NIDF 3BRFA 4RGNC 1Z9MA 4FP8L 4LIQH 1TNMA 3NCYP 4DZBA 3IXTB 5SWZA 4IOSD 2BOCB 4BZ2H 3VGDA 3DX9B 4S1RH 4MJ5A 3GMRA 4ZYKA 2C1PB 1TFHA 2GSIB 4HUUB 3EDKA 4L3EB 5IF0A 2XQYG 1RK0A 3TWCH 5JNYB 3O11A 1WBXB 3HFMH 4KVCH 4JHBA 3CVHB 3C6SA 4NT6B 3T65A 1DN0A 2HVKB 2JB5L 4X9FA 1IAIM 3JV0A 3GSOB 3DECA 1N8ZA 5HY9B 1AR1D 1PKQB 4LEOA 4WI8A 1HH6A 3ELAT 2Y25A 2RIKA 5TE7L 3WFDH 3S98A 2B0SL 1PQZB 4Y5XC 4PGEB 2R8SH 4LHUA 1NMBL 2R4RL 4KZEL 3ZTJH 3UJTH 4ODWB 2CKBH 4XNXH 2JF1A 4G8GE 4PLJD 1FVEA 4A6YB 1H5BC 1MCIA 2X4PA 5BO1H 1KXVC 1UCTA 2HJKA 4TN9A 5A16A 2EDFA 4M62L 5E6IA 5C07A 2ESVA 4JFFE 5I30L 2EE2A 3C5ZD 4JVWA 4X6CA 2IFFH 3KPLB 2OL3A 4K7FA 5H35A 1JNNL 3OJDB 3K1KC 1YYLH 4UU9A 1O5DT 4F7CA 3GUTB 2CDFB 4IS6A 5F9OH 4JFHE 4PREA 4QHLA 2BK8A 2DD8L 4HXBL 4WFHE 5T5NF 2Q6WB 4KMQA 4U1HA 4HMEA 2AK1H 5ESVA 5E94A 4KGJA 1NFDF 3QCVL 5SX5K 4J23A 2KKQA 4JE4B 1PSKH 2ADJB 3ULUL 1FZKB 4HUWB 1P84J 4YO0A 5CINL 3ZTNH 1MCHA 4CVUA 3QZWB 5AAWA 3BUTA 4N0RA 1FRGL 5IJVA 1CLZH 1LP9B 1X5AA 4LVOC 4XCEA 1JN6A 2P5WA 1PKQE 5F7YC 3ULUC 15C8H 3V5HA 1V3JA 3DSFL 2YZ8A 4KDWA 1YYML 3OF6D 2YR3A 3RU8H 4J3XA 3KDMA 1WQVT 4UIKL 3U4BL 4LCIL 3O41A 4R90L 4Y1AE 1VERA 1ND0A 1MHCB 2I27N 2IAMC 4BFGA 5LXGL 3SEPA 2CJUH 4PRBA 1MRCL 1T1WA 1ZK9A 1A7NL 3U1SL 3VXPB 1QSEA 1H3GA 4FQIL 5FAAA 5EOQH 1YYLL 3A0OA 1GC1L 5HYFA 5IQ7L 5C70A 1CFVL 1DBJL 3P4OA 2M1KA 5L88L 2NY2D 4M43L 2Y07L 1FG2B 5HI3D 1DDHB 4H5SA 3RFZC 1N26A 5CMAA 2G60H 3MV8E 2QQNL 4P2OD 5IVXA 1YEGH 3RVWD 1U8NA 3BH8A 3GK8L 3H9YA 3PGCB 5IW3A 1AC0A 1QFWH 1N0XL 5AYUL 4G6KL 1JHLL 5FYLL 2VZ3A 3PGDA 3WN5A 1UFUA 2R29H 5KSBF 3D3VE 5D5MA 3KXFB 3DURA 5JOEA 4WI4A 2RFXA 4XVUC 4LU5H 2FGWL 1KN2L 4KMTH 3RI5F 3D85B 3QXWA 3T0ED 5BRZB 3MV9B 4JGJA 5C2BH 3FO2A 1LP9E 1TMCB 3VJ6A 5CEZL 2ZUVA 2JJSC 1JYNA 4FNLL 3DRTA 2D7MA 4IOIA 1NGPH 3MRQB 3WFHB 4FQ2H 2AI0H 1ORSB 1QO3B 4IMKC 2C3VB 3SGEI 4AMKL 1KTDB 2DI8A 4XPAL 2OX5A 2WP3T 4JAMB 2EDYA 3VGAB 3VRIB 4APQB 1ITBB 2HMID 2YD6A 4JY6A 1GOGA 4G8GB 4M6NH 5AZ2H 2EO9A 3TBVA 3D87B 4LVOB 2NY6B 4MJID 1IAKB 4RFOH 3ZYIA 1AQKH 2PTVA 1EUTA 5IQ9B 1Q0XL 4MQTB 2R29L 4NOFA 2JB5H 5IGXL 3ZLQC 1MFDH 5CBEB 1XGYH 3U46A 1BVZA 2BSTA 2L0DA 2MOVA 1LK2B 3DRQA 4NQED 2QBWA 4Y4FC 5FHBH 1EZVY 2XXCB 4P23C 5HHXH 2A1WL 2PYEE 5D6DC 5IHZA 1RJLA 3MACL 4Y19D 1CD8A 3P73B 4UB0H 1J1PH 1AD0A 2C1PA 3VRLF 4PJAF 5I8KL 1G9NC 2FJFA 4HIJB 2MKLC 4ODUB 2I26N 3GFUA 1NBYB 4K94H 3DVFA 4JHWH 4UILL 1NCCH 1C1EH 1NCWH 3O2WL 5EU3B 2X9XA 5TDOA 4DOHE 1N8ZB 3MODH 5HY9A 5MENA 5I73C 5DZNA 4P46C 2BHZA 2UZXB 2B7DT 2QSTA 4PRAA 5IROA 4JRYD 5E2JA 2ZUWA 5D1ZC 2VLLB 1CGSH 3FB5A 4Z7VA 1UGNA 2C7UA 4RAVA 4OF8A 3RUGF 1AXTL 3SQOL 4PGEA 1ZHBA 1P6FA 5GXBB 2VDQH 5EO9A 5IVZB 1FVDB 1ZHLB 5GRVL 3MJ7B 3WO4B 4X5WB 1YMME 5GRUH 3P0GB 1OTTC 5F9JA 3NTCL 3S37H 4GRWH 4TVSa 1C08B 3WL9B 1IILE 3LCYA 4PRIB 1VFOA 4MQ7A 3HMXH 3KPPB 3KPSB 3HCVA 3HAEG 3O6FA 4PJEA 5BS0E 2E9WA 3NCCB 3BGFB 4TULH 1DQMH 2OL3B 4K7FB 4KU1A 3S3JA 5J89A 2R1YA 5CGYD 4JPKL 3SGEH 4PJHF 4DZ8A 3H9SB 3QDMD 1QEWB 1JVKA 1VHPA 3QAZB 1LEIB 4XBGA 4LQFH 5CHNA 5GS1A 3OKMB 3PL6A 3F7YB 2V2XA 1EEYB 4LHUG 1JV5B 3RX7A 3QDJA 3SQBA 4HAFA 3VFUA 2J8OA 2YD9A 2AV1B 4P59H 2NTSP 4MYWB 3A6OA 1IC5L 3BKYH 1U8LA 4UIKH 3U4BH 2YKLL 1WGOA 4XP6H 5K59E 5E5UB 1J10A 2C9AA 3RPKA 4CUCA 4HWZA 4TSAH 3VWJB 5DJZA 1FZMB 2DIBA 5IB5B 3UTSB 4M6AA 5CS7A 1QSZA 4PRBB 5E8OB 5L0QB 1A1OB 2R0ZL 3N9GH 1DUZA 4XMPH 5GS1C 3VG9C 1JF1B 5F3HA 1CLCA 3ARGB 4PLKD 5D7LD 4CVZA 3RGHA 3F12A 2XG4A 3EYFA 5AD0A 4Y4HC 3QIUD 2GK0A 2ILLA 5CBAA 1J8HB 1QBBA 5GIRB 1QR1B 1MAKA 3O3BA 3MRJA 3KPRE 5EUKA 5DJXA 4N9GB 3D18A 3MCKA 2V17H 4JQIL 4WWKB 5CWSA 4BKLB 5ADOH 3IDXL 5EORL 2B0SH 3IYLW 3OGCB 3PGCA 2MTPA 5E1AA 3V4VH 1ZEAH 4BFEA 4AG4H 4DKFL 1F4YL 3BZEA 4WHCA 2O5XH 3AAZB 3QZWG 3DURB 5M95B 2EDDA 2FO4A 4K2UL 3MGAA 4WWKC 2APXA 1NCAH 2EIZA 4H8WC 2YD8A 4LRIA 3TO4B 4HFWB 2FHBA 4I18A 4NSKA 1PYWA 3BWAA 5EZOL 1U93A 3F58H 5SWSA 3N0PB 1BQHG 2WIMA 2D7OA 2ADIB 2CUIA 2GITA 3FQTA 4Y8AA 1C16A 1KACB 2XPGB 1KC5L 5KN5A 3JTSB 2VDPH 4FTVA 4IOIB 4K7PL 5L0QC 5CSZA 1JHKH 4LOUD 2H1PH 3TZVC 3V6OE 2OTUB 3CZFB 4PJFA 3X3GL 3MROB 1XGYL 3LHPL 3SDCC 1X4XA 3I84A 4U4BA 4MMZC 4YEFA 4XX1G 5T3XH 5EPMA 4RGMB 3S9DB 1F97A 3BGAA 4TQEL 3VFRA 2VXUH 3K81A 3QQ4B 4RFOL 3THML 2FWOA 1SJEB 4G9FD 1EVUA 4JFYA 5E4EB 4FQXA 3LN5B 4O58L 3ORJA 2YPKB 3HE7D 5L7XH 3BUYB 2V5SA 3S97C 3TBWB 3T4AB 1A6WH 2DQCL 4F7MB 2HYMA 2A1WH 3MLVH 4O4YH 5HHNB 1YQVH 2RB8A 4LCUB 4LPVA 1XF1A 4KV5E 4M1DH 1MQ8A 3MREB 3QDGA 4Y4FD 1WAAA 2DLFH 5JXED 3GEWB 3GSUA 1KOAA 3KLSA 5DQ9A 1J11A 3K1DA 4OCLC 3T2OA 4I13B 5IMKB 3BZ4B 2P47B 1I1YB 4TVPD 5F7DA 2NX5D 5GPRA 1DBKL 5FFLA 3TPKA 2NXYB 4M9OA 5JTWA 1AGFB 3DXAB 4OT1H 4L8SB 1P7QD 1NKOA 3OKKA 4Y2DD 2PXYC 1EERB 2OJZL 4LMQI 3KWWA 2YPLE 3U36A 1GGYA 3RGVA 5DMYA 5M94B 1DQQB 3TCLA 1KPVA 2F58L 3VH8G 4R2GC 4RA0C 5INDA 4HKJA 5IESL 1VADB 4NNXA 4Z5RB 5C6TH 1CU4L 4PJ7B 2DOCA 2XWTA 4X7EC 2JKXA 3LQZB 2IPTH 4X6CE 5J9PA 1OW0C 5KSVA 3GRWL 3BW9A 3CFBA 3B6SA 1T22A 5T33L 4QXWA 4HIEA 1NCDL 2O5YL 1JGVL 4QXTB 4HH9B 4R8WH 1MCCA 1U8QB 4P2RB 1W72L 2DLIA 4AMKH 3RNKB 5JDSB 3BKMH 35C8L 1RJYB 1SYSA 3V6FB 2WBWB 2PW2B 1NKRA 3IVKA 3HZMB 3QEHA 3C2SA 1IGJB 5CHNB 5GS1B 4PRPE 4L8BA 3PL6B 5JZ7D 1Z5LA 3FFCA 2XTJB 3GBNL 1D6VH 3FKUS 4GG8A 1U8KA 4PTUB 1DBBL 4PV9A 5DWUL 3T2QA 2DMCA 4GMSH 5DRXA 3HPLA 1JK8A 3EJJX 2H32H 4PJ8B 9CGTA 1HHIB 1ZKAA 3RWGA 3BKJL 4GRLC 4XP9H 5EUOE 4PS4L 1YQ2A 5JO5B 2VLKD 3C60C 2OP4L 5JXAH 4NKOB 3PABA 4DVRL 4AEHL 5IB5A 3FOLA 1F3JA 4Z0BH 3L3KB 4J4PD 3S36X 4NJ9H 3HNVL 3EDDA 5FYJH 2FB4H 3ARGA 4F7EA 4M3JA 4MAYD 3DVGB 1IGYB 3DGGB 4NNYA 4Y0GA 2CMRH 5KSUA 4I3SL 3FZUD 4JO1H 1MVFA 5I0ZA 4JY5H 4NQDE 1KENL 5JIKA 5ALBH 3T3ME 2ATKB 3FT2B 2CK2A 4PJGF 4OLXH 5LCVL 4PGDB 1BP3B 3DYPA 3RAJL 1EGJH 2PYEA 4P5TA 4HG4J 4HWBL 3ULUF 3T3PF 2ZSWA 5CILH 4WHYG 4BA8A 1S7RA 4U31A 1QG3A 1WZMA 5D7IE 5I1KL 4L4VB 4NSKB 1G9NL 5H37H 5KVFH 3LPGA 1G9EA 4B0MM 4U1IB 5C0JB 1C8PA 4GUPB 2ADIA 3QNYB 4EN3C 4ONFH 1MI5A 3SPVA 3TZVB 1FORH 1RZKL 4NDMB 2D31A 2DDQL 3EFDH 1C5BL 3GSNL 4KK6C 3PQYB 4Q9BA 1KCVH 5EBMB 5CSZB 3LKSA 5C0BA 4TUOA 4MA1B 2QHLA 4KROD 4XHJD 3VD3A 3MUZ1 4TNWK 2IF7A 5ITFB 1B9ZA 3RDTA 3VFOB 3C8DA 3CVIH 4FOMA 4LLDA 3GB7A 2VR9A 3O9WD 4MNHA 3FB7B 4I3RL 3IU3B 5B3JE 1EO8L 4ODHL 1MQKH 4N8PA 1IGFL 2VB5A 3QQ4A 4PRHD 5DRZA 2FECL 4U6HA 4WEBH 2VISB 1S9KC 2B1HL 4QY8A 3RY6C 1AHWA 5T3ZD 4TVPH 3LMJL 2CXKA 1TZIA 2YPKA 2CIKA 3BSZH 5E2TL 1BJMA 1KCKA 3MV11 3UJIH 4HW6A 3B9KA 4XP6L 5F88B 1FJ1A 2OTWB 4JRXE 3BMWA 3D25B 3K8KA 3B9EA 3C5ZC 2IGFL 4PG9B 1G7HB 2GJ6A 2DM3A 1IFHH 2VIRA 5C3LD 1UWEL 1XF5A 3SY0A 5BVPH 1VA9A 2P5EE 1JBJA 4X98A 3VFNB 3B9KD 4ONFL 3ZHDA 5JPMA 5DQ9B 2ADFL 5HHQA 1F8TL 5I1IH 3UYOD 3VD5A 2PN5A 4HIIA 2BZDA 4X7FC 3LQAH 5C0BE 4I0PC 3PWPA 2XN9B 3NN8A 4X0KB 3BISA 4FABL 1AJ7H 4L8SA 1A8JH 1T7XA 4QRUB 3EO0A 2ZNXA 3HNTL 2BVYA 3WUWB 2KUTA 5FXCH 5JIIA 1G0DA 1DQQA 1ETZA 3H3BC 4UDUA 1MCQA 4L8DA 3MLRH 5FYJE 4XI5D 4JFQB 4FG6C 2JK5A 4ZUVB 3IDMB 4YNYB 2Q76A 4RBPH 3MLUL 1QA9B 1UZ8A 3GMLA 3H0TA 1LNUB 3MRBA 5GGUA 5T33H 3L3IA 3RVVD 3S35L 3O3DA 1HNGA 5J9PB 2A6KA 1I1FB 1BZQK 3M45A 1ONQB 4M7JL 4EXKA 1UENA 2Z8RA 4H0HB 4JM2F 5I1JL 4JGMA 3BKML 3MUGA 4NO0B 5FHAL 2Y23A 1L9NA 1U3HA 3V4UL 4JRYA 1SY6H 5C0RL 4C56A 3CAFA 1I4FB 5GISL 3HMXL 1I9JL 1R5VA 2NY0C 3EDJA 3O45B 5C2BL 2YSSA 3EFFB 1YPZA 5KSBB 2R1WB 2FD6L 1N5YL 2DJ4A 5C0DA 3BD4A 1S9YB 5EUOA 1JYVA 1SBSL 1G7LB 4WI3A 4L4TA 3OJVC 5J4MA 5DUBA 2XN9E 1T6WA 3MUY1 5KBNC 3L95B 2MHAB 2NY0B 1VPOL 3NH7H 4HSQA 4LPWA 3RBSA 3MOQA 4FQJL 2QADB 1Q0YH 1HEZA 2W0PA 2ADGB 3V5KA 5D1QA 1OD9A 2X1QA 5J1TC 3MCLH 4FQHB 4U1LA 4PYHA 4NKQB 4JQXC 3FN3A 2ITCA 3DI3B 5IB3B 3NIFE 4UV4L 3VD7A 2QEJA 3QDMA 1EO7A 1K8IB 1L4IA 1UCBL 3EO1B 3VXMB 1KTLA 1YA5A 3MFFA 4HKXB 2QKIA 3KNBB 1BQSA 2XY2A 1KULA 4KUCF 2CMRL 2NY6D 4MJIB 4Z7WE 1L0QA 4PJEE 5DMKB 5F7KC 2YD7A 4NQTA 4XVJH 2NY4B 3B43A 1AI1L 4CJ0A 1FNGB 2XNAA 1UJ3C 4E9LA 1XF4A 4KHTH 4TNVF 2DWDA 4M6OH 2OL3L 1RUML 3Q6GL 3QEUA 1KIQA 4P5TB 2F19L 4NWTL 12E8L 4ZAKC 1F2XK 4MCYA 1JHTA 1IRAY 3FRPG 1J5OL 1QFWI 1AY1L 3QQNA 5C0AD 4XC3H 2IH1B 3KGRA 4DN3L 1P7KB 1WCBB 1FO0H 3ZDYE 4I3GA 4CN1A 2BNRB 2N56A 3L3GA 1PEWA 4HKZB 4RCAA 3RWCA 1HHGB 3W9DA 2GUOB 4LLQB 4YGVB 1IEAA 2Z91B 1N59A 3GSVA 1I8IB 2BNUB 3VRJB 1JL8A 3LKSB 1AKJB 3VH8A 3KLAB 4OTXH 4E41A 3LS5H 3O0RL 3Q1SL 3MOBL 4G6FD 1F90H 4LLDB 3GB7B 1MFBL 5DT1L 5DJDB 4ACPA 1BBJA 3U1SH 3ZT6A 5BQ7B 5FOJA 3AS0A 2NY3D 5C6PB 1MVUA 5T1DL 3IDIB 1CFVH 1DBJH 1P4BH 3DX9A 5CJ5A 4DVBA 1EXUB 3JTTB 5FM5M 5HDQH 3CFKA 4UQ2A 1FO0A 3UJTL 2H3NA 1YEIL 5FYJL 4XPGL 1CDHA 4NQUA 3BT2H 4BELD 1YEKL 3BEWA 3L5XH 3PP3H 4UNTA 2OP4H 3IS1X 4XGZB 5TE7H 3WFDL 1OB1B 3VXSE 1J05A 1BFVH 2X44D 4RFNB 4OLWH 1GZPA 4P2QB 2BVEA 3TESA 1S9VB 3MLSL 4NNPH 4JFED 3IKCA 4RGNE 5EOCL 5EUOF 5JOFB 5IHUH 3T0BA 1U8IA 1UVQA 3D48R 4JZOA 3MBXL 1OAUL 5T3XD 1NCUA 2BRQA 3GKZA 4HUKB 5H2BB 2CLVB 3ZKXC 1F42A 2G5BA 3SCMA 4PRHE 3BAEH 1HYSC 5T5FH 3VXTA 4DAGL 4WW1B 3PHSA 1ETZB 3U0PA 3MJGX 3MRGA 1X5IA 1IMHC 4WO4A 2HT2D 4BZ1L 4HFUH 2JK5B 4ZUVA 1Z6JT 4K8RL 1PSKL 1FL5B 2MKWA 2OJZH 1IGIH 4JQXA 4QXUL 1OP3H 4U1HB 3Q5TA 4HIXL 4K8RD 4ODVL 1VSCA 2A6JA 2Y5TB 3ALXA 5LQBL 3W9EB 1CGXA 4XXDB 1QSFA 3PDGA 2F9BT 1I8MA 2OJEA 1CU4H 4NO0A 4MA3B 3VW3L 1U3HB 2WQRA 4G7YH 4ORGA 4KQ3L 5E7BA 3O2VL 4PJ8C 3AY4A 1UKQA 3G5XB 5F1KC 3SJVE 1R24A 2ZUUA 5E2VH 3QPQD 2LE9A 3SDAA 3TNNA 2HRLA 3OF6A 3KPRB 5IVXF 1A6ZB 4Y16D 1CIUA 3IKKA 4OCSH 4G6AD 2C3HA 1FBIL 4U1MA 4YPJA 2AS5M 4OUOA 3G5VB 3G5ZB 4YC2C 2JIXB 3ZYJA 1UWGH 3P4OB 1S7VA 2BNRE 1MCOL 1CD1A 3HZYB 3TO2B 1RHHA 2IBGA 5TF0A 3IDYB 1QFWL 2BNQE 5JW4R 4TSCL 3FFDA 4FNLH 2YA1A 1Z3GL 4OZGF 2NY1D 4MXQD 1UYWH 2EYSB 1QLEH 4XBPB 5TQ2H 2IPKB 3UTQB 2JLLA 5EBWA 1YECH 1CDBA 4P5KB 2VDNH 3OB0H 4NJAH 1KB9J 5HGAA 2C3XA 2IQ9H 4ENEC 2DLEA 1CE6B 1RD6A 2XNAB 5DMJB 3RPIA 2B4CL 1B4JL 4CMHC 1YNLH 3GMMA 1JUFB 5D8JL 1CICA 5IBTL 3UTOA 5D71L 1H3PL 2BSSA 2BOBB 4CVWA 2NQCA 4P3DA 3PDDA 2LU3A 5DA0B 4LP5A 4KDTC 1MSPA 4RGND 3MRCA 2QL1A 4P2QE 5DEZA 1DBML 1URLA 2EDXA 2HKFH 3D39A 3RZCC 4P46A 5ITBH 1I7TA 4YDJA 1SEQL 3OR7B 2DQIH 3HRZB 3S36H 4OGXL 4KI5F 4M1CD 2FBJL 5E95B 4QRRA 4RMWA 1NBZA 4EOWH 4HJGA 1P4IL 3QFDB 2OSLA 1WK0A 2GEEA 4A6YH 4E41B 3JWOL 1BOGA 2EH8H 5DHYB 5IV2B 2LV4A 5DJAA 3NACH 5DJ8A 3ZKSD 1MLCA 1HKLH 1BM3H 1DFBH 2H8PA 3Q0HA 2EDRA 1RJLB 4NCDA 1CL7H 1MVUB 1RZJC 1H3WM 4JY4B 1YEIH 4XTRC 1D6EA 4WV1A 2QQKL 3NGBC 3RUGA 1MRDH 4OBSA 4QTHB 4Q74A 4HCRA 5L8JB 4F7PA 1MCKA 4IRZL 3FTGA 3SDDC 1JPGA 3G6JF 4CW1B 4UNVA 2EYRB 2HLFC 1XH3B 5E8NB 3JWDL 3DUHA 5EU3A 4XC1L 2XRAL 2YEZA 1MAMH 4ODSL 1OTUD 1F4YH 4IRJA 5T5FL 1S7QB 1SEQH 5E00A 4X83A 3ZO0A 5EWIH 1UKTA 3QQ9D 1ZT7A 1GZPB 4XWOD 4Z7VB 1XIWA 3QJFA 3UEZA 3ES6B 4F33A 3MBXH 3HHRB 2RCSH 5FUCC 1M6OA 4XP1H 1AGCA 5EA0H 1QBMH 5E5MA 1WLHA 2DI9A 2FYYB 5JHDE 3WNNA 2D03H 1T83C 4KFZC 4OJFH 1I3RB 1T2JA 1OF2B 4ZQKA 3P4LA 3LKNB 4AH2A 2FLBT 3BGFC 4DWHA 4GXVH 2DJUA 2XKUA 5ICZB 2ZJSH 3QQ3B 1IC5H 4JRXD 3QO1B 3I6LD 2R1YB 3AROA 3QWRD 4OZGA 3HZKB 4XAKE 3JV4B 1XGUA 3V7MA 4GH7B 5KSAD 1WSST 4R3SB 3ZMRA 1FL5A 2EXWC 4JGUA 4M4RA 2P5ED 4FQ1H 3FT4B 1YJDH 3H6JA 3W9EA 3B8YA 1CZ8L 1A6WL 2CKNA 2DQCH 5IEHB 1AE6L 3P3YA 4NQSB 3UTTB 2XIDA 1I8MB 1KELL 3FQUA 3HLAA 5FB8B 1OP5K 1QNZH 5F7LB 2AJSH 3SE9L 5ICYB 4QRPD 1UWGL 3VFMA 1B0WA 4GKSB 1UQSA 4F57L 1NCNA 1JGUL 1E6OL 2ZP0T 3CFJB 1G0XA 4TSBL 5D2LB 3ZE2E 4Z7VE 4NO2B 2GY7B 3NA4A 5F1OB 1LD9A 1OQXA 1GHFL 4LF3B 1Q38A 1BOYA 4HKBA 3LDBB 5IGXH 3UTSA 1T5WB 5C0RH 5D2NE 2CK0H 3CLEH 1HSAA 3BZFB 4V1DD 4R4FL 2R23B 1CDIA 3EYFB 3VI3E 2LFGA 4NC2B 4FQCL 2CIIB 3IDYC 5E2WL 3TYGH 4YE4H 1NC4A 5I2IA 1O7SA 4I9WD 4L1HA 1RHHB 1A6VL 1IAII 3NVQA 5KS9A 5HYSG 1U3JA 1TJIL 1OP3K 3FFDB 4U1NA 5DD6A 2NY6C 2O5XL 1UG9A 1ACYH 4UILH 3K74B 4WI5A 5BW7C 1YEFL 4F37K 3PG2A 1R6VA 4OF5A 4KY1H 1MH5B 3UTQA 4JJHA 3ARDA 2VZVA 5DO2C 4PB0L 5GS0D 4IRSA 2HT4C 4QRRD 3SJVD 3TO4A 1QOKA 2VDLH 3FJTA 4S1SH 3WYRA 5HJ3A 4NZJA 1U93B 2CO6B 4QRSA 1WWCA 3BAEL 2AK4E 4P9HL 5MEPB 5D9SA 3WLBB 3N1PC 4XNMA 5HHME 1LMKA 2VLRD 3RHWF 2X4TA 4BSVA 4EDXB 5I1EL 1WIUA 1R3HA 3L9RA 4HWBA 1CFNA 3UTSE 3CXDH 2Z4QA 4P5MA 4JFEA 4KTDH 5BW7A 5ERWB 1I9IL 3LB6D 1CGUA 3HUJA 3VFRB 1S7XB 5D93B 3HI1B 5FYJU 1UM6H 3HNTH 1I7TB 4YDJB 1RUMH 3ARDC 1A7RH 4F3FA 1T04B 1JPFA 1GGTA 1KPUA 4JPVH 1NGXA 2WLZA 3OAUH 4ENED 3C5ZB 4PTTA 5JA8B 2ARWA 2NY7H 3SDCD 4MVBC 1S5IH 1R0AH 2R9HD 2DLFL 2Z35B 4GS7C 5C0GB 4XAWL 1KIRB 1RZ7L 2GJ6D 1LE5B 1X5LA 4ZS6D 3FQNA 3ILPB 2VXSL 1OGAD 2B1AH 4K3DH 1ZSDA 4IIQB 4PJXA 1XFPA 2X4PB 4LLYB 2LAAA 1F90L 5C1MB 3D69B 2VQ1B 3LEVL 2ERJB 3PQYE 2XRAH 5MENE 3DBXB 4GW4A 1S7WA 3TT1L 3G6AB 1JI2A 3IDUA 2WLYA 3NCFB 3NFSH 4RWYL 1U92B 2V2TB 5T1DH 3D2UA 4XMPL 1AGFA 3DXAA 4XMKH 3MV7B 3R0NA 1EHLH 2FX8H 4R0LB 2EDLA 3GUTA 2DQFB 2I5YH 2VLKE 4XP1L 5DHVA 4QGTA 3U6RA 1MHPL 3ME0A 5IMOB 1OLLA 3KPOB 1XIWB 4KJQD 1JNHA 3EYOB 4OLYL 3SGKC 2VDOH 5DDHB 4KJWC 1MFAL 1CYGA 3PIQB 1ZAGA 1NEZG 4LSTL 5F7MC 5IB4A 32C2A 5F93C 1V7NH 4PP2A 1IAIH 4NO3A 4XCNB 3SE8H 4IOFD 5J6HA 4XCEB 5H94B 3GBNH 4RRPG 2ZCHL 2EDJA 4R9HA 3REWA 4POZC 3W82A 1EIBA 4L8SC 1EHAA 4F9PC 1G7IA 1BD2D 2R0KH 4XXCC 5DD1H 5I1CH 3RP1A 1ND0B 4LEXL 1RUQH 1BLNB 1INEL 2XA3A 3RVUC 3VXSD 3QG7L 4A6YL 4KJPC 4IMLA 4JM2B 1KELH 3VXPA 4TUKL 1G6RB 2DMBA 3EDEA 1BZ7B 2KZWA 3S88H 4EI5A 4O2FB 3NPSB 5C7XL 1BGXL 1RFDH 3F65A 1NFIA 5DD0L 5GJTH 2AK4B 3IJHB 5DVNA 2DM2A 5MERB 1GRWA 4IRSC 1MCDA 5HHMB 4KRLB 2VDOL 3WXWL 2FCBA 3PHQA 1HNFA 5BV7C 2M8XA 2R4SH 4K55A 1INQA 1CFSB 4WFEE 2VJXA 1NANH 4KZDH 3G6DH 3A6BL 3K4ZA 2X09A 5D7JC 4IRZH 4OLUL 3MJ9H 3OMZA 1QKZH 2BCKB 5I8CB 1BEYH 3RDTC 5GRXG 5C2UB 4UQ3A 4OFKA 5DEFB 5BV7B 2GTZA 5F1NA 4M8QA 3QUXD 2QHRH 4F15B 2GQHA 3QFJA 4KKBC 5JW3L 3DX7A 4KRPC 3CSYA 3RY6A 3CDFA 3NA9H 5D1QC 4KTEH 3Q6FA 4KH2A 2BFVH 2Z93B 3BP5B 3QHFL 3T3PE 1RIUL 5DJYA 2NZ9C 5D7SL 1KLUA 3W81A 1F11B 3CDGB 2Q8AH 2VL4A 5ANME 1HWGB 3GSQB 1RJZB 1FNEB 5HGGS 1S7TB 4KJYB 4L4VA 5MEND 1QHPA 1EZVX 4HUNB 2C4FT 1NCBH 3ZSTA 2FJGA 4JR9H 3F5WA 3QNYA 2IALA 3WLBA 1EO5A 4Q6YA 4FMFA 2OYPA 5EBMA 4JDZA 2P8PB 4QHKI 1JWSA 1QKZL 3EYQC 4EI6A 3IAPA 4L3CA 4ZFOL 5J1AB 2BP3A 3S5LA 4MNQD 1MHHA 3RDTB 4OD2A 2BDNH 3DV6B 4WUUD 4MNHB 1K5NA 1IKNA 5BVPL 4JDTH 1S7XA 3MRHA 1DLHB 5TJWK 3DI2B 4HIJA 2BSED 3N85L 3OAUL 4ODUA 3FB8B 3UBXG 5DEGA 4XPHH 4M43H 4PIRF 4JFXB 4KTEL 3BPCA 1T3FA 2A83B 2AJSL 2WZPD 2F53E 1ULVA 3HE6C 2CIKB 3K8MA 1DBMH 1H8NA 3I02A 3AFLA 1RMFH 5ETUA 2VXUL 5HD8D 4NQCB 1AXTH 3SQOH 1IGIL 2XKSA 3QG6A 4XMKL 3A67H 1DN0B 4ZUSB 4G8EA 3GBML 3S3PA 2COQA 5B8CC 1W0VB 1VDGA 1U8MB 1LE5A 1N5AB 3FO1A 5E8DH 4PD4K 5DD3L 3MV7D 2OS7A 3V4PL 3VDCA 5FO7B 1KJVA 4PS4H 1G84A 2OZ4H 1C08A 5CZKA 3BDYH 4HIIB 4U3XA 1JNJA 4GW4B 2XN9D 5J1SC 4PB0H 4MQXC 1PKOA 2V2TA 3QNXB 1R3LB 5L6YH 1E6JL 2QQKH 4X9GA 1HXMB 4FQPA 4YQXL 5KAQF 1F4AA 1P69B 3KPLA 4OLYH 1F6AB 4Y5VB 3GNMH 2MQ3A 4ZUWB 4JFDE 3BQUC 4JFQA 1FL3A 4PGJA 4JY5L 1JIBA 3F7VA 5ACMA 1LEKA 4YNYA 2V2XB 5D2LF 1N3NA 3U7YL 3S34H 1LHZA 3MGTA 3S4SG 4TSCH 4JO2L 5D1XC 5IB1B 2EDEA 3CXHK 4MXVF 4AY0A 5H94A 1BMGA 5TE4L 3CGTA 3REWB 4WGWB 3QRGH 1I8KB 1CVSC 3NIFF 2P43B 1TETL 4LLMA 3LQAC 2CQVA 3RWHB 3BDYL 5DJZB 5T1KA 3TJHD 1A1OA 2YSSB 4UOJA 3LZFL 5KSBA 1U0QA 1UJ3A 1T03H 1YNLL 3D5OF 2P7TA 1A0QL 3IDNA 4MWFB 5C0AE 5IBTH 2XQYK 1JWUB 1KJ2B 2KQNA 4AEIL 5GIRA 3D0LB 3O3BB 4D9QD 2DYPB 2WWMC 5EUKB 1HINL 5LXGH 3SE4C 1S5IL 4Q9CA 2YD5A 3O4LA 4G9FE 3DUSB 5D1QB 3KS0H 4FQLL 1F3RB 1HILA 1D6VL 2FH6A 3VD4A 1M71A 3AM8A 4KK9C 4NQEE 4NN7B 4DEPB 5GGVY 2OL3H 1BEYL 4DKAA 1FFPA 1NBVH 4F37F 1TENA 1OY3B 3QFJD 1AXSA 2ITDA 1UA6L 1RZ8B 3FAXA 5C0FA 1AI1H 3TVMC 3OHXA 5ID1B 2EDHA 2XPGA 3MA7A 4HK3J 2AKRA 2VXTL 5HYQB 4XNZC 3JTSA 3SE4A 1DQLL 2E6JA 3FO0H 5DURD 5ALCH 2I25N 2P5WE 2BVQB 1XF4B 3HPJB 1KG0B 12E8H 1I8LA 2Z93A 3WXVL 3GDBA 3THMH 3MXWH 4M7LL 4N5EC 3FOMA 1AH1A 3I9GL 3T0XA 2MQ0A 3BDXA 5HYEA 4DN4H 1EFXA 4DK3A 1HQRA 1D5BB 3JWDH 4M7ZB 1ZANL 1SJHB 1FQ9C 1M7IA 4J3VA 3ARED 2VL5A 4Z77B 4HC1A 4KQ4H 1E4WL 3BIAX 4G7YL 5MP6L 4G8GA 5DVMA 3L3GB 3GJFB 3A6CL 3RQ3A 4CNIA 3UPAA 2WINB 3KYKL 5BJTB 5BCAA 1MCSA 2P8PA 1JWSB 2E7BA 3IFPA 1VEOA 4L3CB 1VEMA 3RL2A 2APBA 2Z8WC 1G7JB 1QD0A 5ESAB 4LBEA 1A2YA 3DX8A 1MCEA 3GSUB 4XNYH 5JW5B 5EOTA 3VRLE 5I18L 3CFCL 3CVHL 4JZNA 5E8EB 4X5LA 4PUBH 3ULVL 1G1YA 5DJCB 3VG9B 1FNAA 4RA3A 4S2SB 4Q58C 1OL0A 4EEEA 1J12A 3CFKB 4M7LH 1A5FL 4YIQB 4HC1H 5DK0A 1OAUH 3QIBC 1K4CA 4X8JA 4YDIL 5DSCB 4Q6IC 3UAJD 4PRIE 5E8DL 5TQ2L 2R1XB 3DJ9A 1N5AA 1J05B 5K9JL 4AYFA 3R1GL 1MJ7L 4NZUH 1E4XI 1FCCA 3B9DA 3FB5B 1T0NA 4A2MA 4BQ8A 2VNCA 2XZQH 5FYLD 3LH2H 4Z5RA 5F97E 2W65A 1DUYB 1TDQA 3RY5A 2QQNH 5EO9B 3AY4C 3FCTB 1BX2B 4C56D 2F74B 1CF8H 3MNZB 4N0FB 4Q2ZA 4QXTA 4Y5YC 3QNXA 4WUUE 4RFEB 2V5RA 1NANI 3L7EB 4MQ7B 3O8XB 3KPPA 4HPOH 2G5BB 3SCMB 2BMKB 2JCCE 3ULVH 2CK0L 1DQTA 3GMPA 3HE6D 1KV3A 3UX9B 5JZ7C 2Z31B 3VFPA 3MSPA 3HZMA 1MNUH 3QEHB 3M1BA 4HQQL 2AJXH 3LPFA 1WBYA 1YEDB 3VE0A 3LRHA 1MFNA 4NQDD 1NGPL 4XBGB 2YXFA 5T1MA 3OKEB 3MGTB 4P48A 3OKMA 1L7IL 4JG0L 3QUXA 4L1DA 5J56B 4ZUTB 2NNAB 5GRJL 5KVGL 3TN0D 2NR6D 3E6FA 4PJHA 1G6RH 4MA3A 4LNRB 2WUCL 4DN3H 1WITA 4F80A 2X6MA 4Z95H 2VUOA 3TVMA 4N1HB 2CKBL 4WNQB 1CXFA 4P2OA 2YUXA 3GI9H 3NGBB 4PB9H 1Z0MA 2ED7A 4YDVA 2J8UA 4PGCA 1S5HA 1UB5B 4ZOBA 4OTXL 2F8VA 1QRKA 3EOBB 4BFIA 4Y5XA 1A6TB 3DO7A 3GJEB 5KVEL 3CU1A 3OAYK 2V2WB 1OD7A 5AUMA 3D0LA 4NHCH 1IQDB 4JFOA 4NYLB 3UYRH 1IM3B 3QCTH 3ABZA 4CAGA 5AD0B 1KXQE 3N9GL 3HG1A 3SO5A 2MFNA 4HIHB 2K9UA 1JZ7A 1QR1A 2JCCB 1D7FA 2CH8A 1CGTA 3SKMA 1XR9A 5C09B 4POYA 3MV9D 5EO1A 3CFEB 2D4FA 2RCSL 1AO7A 3ILQD 5FCUL 4YAQA 4GBXC 4KK5D 3MLWL 3CK0L 3OZ9H 3UP1A 4OLVH 4XCCH 3MNVB 1NGWB 3TNMB 2FECI 1KYOJ 3K2MC 4LPYA 3FO9B 4Z95L 5IHLB 3E8UL 4HUVB 3C09B 2YD2A 4FXKA 4J1UB 3TC9A 1LO4L 2NX5E 4CL7A 4CRPA 5F89B 2X89A 4BYHA 5FUOH 4DN4L 3BN9C 2OMBA 1U3HC 5J12B 3QJHB 4K9EC 5FYKL 1OGAB 5B8CB 1AXIB 3CZFA 3E1F1 4PJFB 3RVXD 4DTGL 1WAAF 3PHOA 4ZOEA 1D5BA 4F2MA 3EJYC 3PWLA 4WFED 1BJ1J 1G0YR 4IRJC 5F9WB 4D0DA 5GRYA 1KIPA 3AXLB 3WJLC 4GAJL 2AP2A 1GIGH 1SJEA 3HRZA 2PO6B 3HE7A 1N6VA 5JNYA 1X5HA 2K3TA 3S7GA 1T1ZB 2HVKA 3ILQC 5FDYA 3WSQH 4JO3L 4U7KA 1J5OH 1DP0A 3RBGA 5KTEH 5F8QC 2R8SL 3ZE0F 1XF2A 5HHNA 4JR9L 4YX2L 1QVOB 4HS6B 1LE9B 4Z7WF 1A21A 4ZTPH 4N5ED 4ZO7A 5JHLH 1VGEH 2H8PB 1C7SA 5D7IA 4JY4A 5D2NA 1H5BB 1TVBB 5I6XB 2H2PC 3U7WH 4L4JA 3SGDI 3MGOB 4LEXH 2APTA 5DVLA 4H26B 2X9YA 1MJ8H 1XH3A 1B0RA 5LVEA 1P7QB 4XMLH 4TUJB 1UT9A 5LCVH 3D2UD 1IC1A 4IJ3B 4KXZI 4S1DC 4IS6B 3UTZA 5CZXC 5JDJA 4PREB 3WNPA 4OM0L 1P6AB 5ID0A 2ZKHL 4KDVA 3BPOB 3GMLB 3GIVB 4MJ4A 3A67L 5CEZE 5F1SA 1ZLVK 5HHOE 5D2NC 3BIKA 2ADJA 3QEGH 1T1YB 4YO0B 4GRMA 3LQZA 4WW2A 4RFEA 3O4LD 5CD5D 3EKCA 4NBYB 4IHOA 5CP7A 3TBTA 2D7TL 2H6PB 1LO2H 3P0VL 4JRYB 1EX0A 3EHBC 1O0VA 1DBAH 3CX2A 4PJ7F 1SMAA 1PG7H 3KDMB 3C8KB 3QNZA 4W4OA 5CFHA 5F96L 3O41B 1RJYA 1SYSB 2R1WA 4ZFGH 3V6FA 1A1MB 2A9NH 2L7JA 5EUOB 4YHIB 2ZUYA 4X4ZA 1K2DA 1U8OA 5DUBB 3MV7E 3NA9L 3QUXB 4U6TA 4BZ2L 1D5ZA 1FPTL 4OF7A 4LLAA 3UDWA 5KG9B 1SHMA 4NN5C 1U8KB 4PTUA 1RZ7H 1BQLL 4UT9H 4NKDB 2F5BL 3K3QA 2WWKT 5DFVC 2CUMA 4I48A 1JF5A 2FSEB 2MCPH 3WS6C 4LIQE 3RWGB 1K8IA 4NZRL 2GW5A 3EOAB 1H0DB 3HG1E 5I1AB 3HZVB 4PGCB 1MCWM 1ZS8B 1UC6A 4LCWB 5D5MB 2VLJD 1A6TA 2X4UA 4XVSL 3DO7B 2OQJB 5I1LB 1T21A 4YE4L 1GJIA 2PKDA 3MYZA 2FL5B 2XKNB 3MV9A 5F1IA 1ADQL 4XP5L 2ORBL 4GKZB 4ODXA 3DVGA 5KOMC 4HH8A 2QQLH 4WU7B 1F13A 2AQ2A 8FABA 4L8CA 2IBBA 2ZOKA 4ZS7L 1UXWA 1MRDL 1XIWC 5DGQA 1JYWA 4PRPD 3HE7C 4YAQB 2J2ZA 5EU4B 2J12B 4HUXB 5EFIA 5DD6B 1AY1H 2H41A 5ISZB 5CCKL 4YHYC 2YXMA 4PGDA 4G7VH 3TIEA 1I1AD 2X7LB 1MH5A 5ALBL 2FZ3A 3OKOB 1T66C 4UINL 3U4EB 4HUVA 1EEUA 4JPWH 4JLRA 1S7RB 3PQYD 3SGJA 4OIAA 5C6WH 4L29B 4NWUL 1AR2A 2W1NA 5I1EH 5CD5C 2HTKD 4ZXBC 3HRPA 2ZCLH 4XNMB 1G9NH 1RPQA 3O9WB 5KVFL 3KPTA 1QHOA 4Z7UA 5CBEA 2AABL 5DJ0A 4QOKE 4NFBA 5E2UH 1IC7L 3M17B 5SX4I 4Y1AB 3T0EB 3WCYA 5A3IC 3MX0A 4YX2H 4P5MB 4DVBB 4NN6C 2EXWD 4W6WB 2LTQB 5DRZB 3P4NB 4F3FB 1CFTB 1CGYA 1T6VN 1JZ5A 2VN4A 4OCWL 4P23A 1QLFA 4PJ9A 3CSGA 3IFLH 2NY7L 1IT9L 2GSIA 1TZIB 4WEBL 5LG1A 3CDCA 1NAML 5IF0B 4MDJB 1GL4B 2W9LA 5B3NA 1VGKB 2VSCA 1RU9L 1WBXA 1FJ1B 2OTWA 1CFQB 3SDXF 3C6SB 4NT6A 4JB9L 4WW2C 4Q6IB 4M6MH 4UINH 2VLLA 2VXSH 1G7HA 2GJ6B 3SDDB 2AJZB 5FGCE 1S9VA 3ZDZE 3UYPA 4MAUH 2EO1A 3MLWH 1U8IB 1UVQB 5JPMB 1H5BA 2X1PA 1RIHL 4LSDA 2AGJH 4R4BA 4LLYA 1DQDH 3WLWD 1OAQL 3ZSSA 4ODWA 1H15B 3LEXA 1J1OL 4MJIE 4I18C 1WWWX 1KCLA 3KPSA 1QFOA 2R4RH 3HCVB 3O6FB 3FRUB 4JFDB 4PJEB 3X3FH 2Q1EA 3D2UB 3MMEA 5FEBA 4JKPH 1KTKE 1OAXL 4EN3D 2BXYA 1IKFH 1OQOA 4WY7L 3NCMA 4OLVL 1GAFL 3PWNA 3WNOA 4R6UA 4P4KC 4GOSA 2IAMD 1N2RB 2V5TA 4L8DB 5IMOA 1ES0A 1MREL 5ESQA 5GGRY 3AS2A 3O6FC 4FHBD 4PJIB 1JNHB 1BD2A 1VB9A 2HN7B 4KUZH 3QCUH 1T1XB 1ZLSH 1T1YA 1QA9A 1UZ8B 3DHMA 3H0TB 1LNUA 3MRBB 3PIQA 1CR9H 4RMRA 1EBAA 1MJ7H 2IG2L 4NZUL 32C2B 1NH6A 4TTDD 3ETBF 3O2VH 4J6RH 1V5JA 3T0WA 4NO3B 5EC2A 4WU5A 5JQHC 3ZKMC 5F7EL 4O00A 1CS6A 4ZNEE 2QR0A 2NYYC 1CN4A 3MLPA 4OLZH 4QRQB 5GJTL 4V1DA 4I0PB 5BZWA 4ELKA 3KG5A 4PRID 4EN3B 3VWJA 3LV3B 4CADA 3ARFA 5FV2A 1MFDL 2Q7YA 1FG9C 1DUZB 2EEBA 4WJ5A 4JM2A 4Y89A 1CTNA 3L1OH 3F12B 3RU8L 3MBEB 2GYSA 1RULL 2GK0B 3MRJB 1IM9B 1YN7A 4YHPA 3C9NB 3WKMH 1FFOA 4B5EA 4PY7B 3F6LA 2J7LA 4RMTA 3V0WL 1A7NH 1G1CA 5K9QG 2ZOLB 4MB5A 1II4E 5C0NC 2GY5A 1ZLSL 1F6LL 4LCCC 4GT7A 3MLSH 1DDHA 2J8UF 1CR9L 4KKCD 3C5JB 1UM5H 3WN5C 4I4WA 1UWXK 2JELH 5E56A 2F54B 1R0AL 4YHZH 1U8NB 1Q94B 1RIUH 2SEBA 3DMMD 4E5XB 3OKNA 3ZE1E 2FLRT 4TOYL 2J4WH 5F7FA 4I18B 1UCBH 1W0WB 4GSDL 4HZAA 3IJSA 1GCFA 3CH1B 4U2YA 4AENA 1T83A 1IKNC 1CE6A 4L8CB 3Q48A 3N1MC 1MUJA 2V6HA 3LIZL 3EYQD 1JFQH 1FGNL 2O5ZL 2DAVA 5GRWA 4NZTL 3W2DL 5I1IL 1A1NA 2ZCLL 1PZ5A 3CSYB 2NLJB 4PR5B 3JWNC 4TQEH 2IANA 1MF2H 5C0AB 1MWAH 1KLUB 3D39B 4JPWL 5C0CE 4L5FH 2ICWI 2C3VA 1JPTH 2FZ3B 3OKOA 4N1CA 2I5YL 4X6DE 4JLRB 4JFYB 1QLRA 4N5UA 4G9FA 1D9KD 4Y2DC 1TETH 4LKXA 4DW2H 3F5WB 4HCRH 1NGZA 3TBVB 4PJAB 3TBWA 3QFDA 1IT9H 4A2LA 3MLUH 3W9DB 1FLRL 1PG7L 2CDGB 4KPHH 3GMQB 1CQKA 1CXIA 1TJGH 1M7DA 2PTTA 3OXRB 3QUZD 3LZFH 4EI6B 3T0EA 4M5YL 3QDGB 4LLUB 4X6FA 4XBEH 4J3SA 4PJBF 1Q0XH 1P7HL 3VXRE 4X6DA 4YR6A 3BP4B 3FL7A 3WV0A 2LU7A 2IFFL 1QLFB 3RVWC 3VXQB 2YMXH 4RGNB 4M3KB 5D96C 1FO0B 1PLGL 3EOTL 2PW1B 3UPCA 4R7NB 1R3KA 4XP5H 2P42B 1A4JA 4F9LA 3HC4L 1I7UB 3SDXE 1YNKL 1NC2B 1A22B 3MR9A 2YPVL 4FFWC 2PR4L 2QADC 1AGCB 2AW2A 2VUYA 1Q9LB 4Z7NF 1CLZL 5GGQH 1DQLH 3DXAE 2PF6A 1CTOA 5DTFA 3ARFC 3STBA 2VXQH 3BW9B 4R8WL 4DFHA 1T22B 1VGEL 4LSQL 2HFFA 1I7ZB 3FRUA 4LSPH 4PJCF 4YQXH 1DL7H 1R3LA 3BEVB 3OB0K 4LHUD 4O51A 1PD6A 4H1LA 3VXTB 3JV4A 43C9A 5GGRB 1OW0A 3R0MA 4EI5D 2HKFL 1S78D 3VGBA 4DFIA 4TVPL 3DOSA 4K94C 4PP1D 5IEKB 1E4WH 3O2DA 1MWAA 3P9MA 5MP6H 1FNSH 3FQWB 4PJ5B 3FT4A 2WUBH 3F7VB 1J8KA 1LEKB 4NM4L 4LCCA 4M1GH 5IT2H 1LEIA 4OZIB 3PV6A 3MRMB 5IB1A 2R0LL 1I3GL 4E0RA 4XZUA 1ZT1A 1JGUH 4XXDA 2XT1B 1QSFB 5HYJD 4M00A 1WFNA 2OR8A 4WI7A 4DVRH 2PXYB 3JXAA 2AEIT 5BZWB 1G6VK 2DQUL 5SWSD 3QI9D 5JO5A 3MRPA 4KKLD 3CLEL 1UACL 2D7TH 4CADB 1MRFH 4PP1C 1LO4H 3FOLB 3QXAA 4W70A 2VO5A 3G04A 4U33A 4QNPE 4YZFF 5GS2D 4YHZL 2ICWB 2C5DC 4Y16B 5KJRL 3KYMA 2P8MA 5C09E 1NBVL 3D6GA 1A6VH 2J8HA 4WTWA 5IJKC 2CRZA 1AGEB 3SKNB 5F3HB 4CU6A 4OGAC 1EFQA 4YHKH 2MJWA 5D6CB 4I8DA 1Z2KA 3V6ZB 4LCYB 3DHJA 2HTKC 1VESA 1ZHKB 25C8L 3PGFL 1HHJB 3NZ8A 3QDME 1VFAA 2LQRA 1ERNA 4N9GA 2WBJA 2LVEA 2HFEB 2ATKA 3FT2A 1T0PB 3V95A 4NN7C 1EJ6A 4U1GC 1Q94A 3DVNB 3WIHL 5E1AB 1QRNE 4IRSB 4XBPA 1YY9C 2YK1H 1MREH 3ARBC 1PFCA 3IXAB 1TQBC 3OKDA 3CH1A 5B38B 5D9SB 3NIGE 3W2DH 2ZG3A 4LVHC 3V6OA 3SPVB 2Q87A 1NFDA 4HFWA 1QSFE 4NDMA 1CDJA 1G7QB 2X4SA 5HYIA 5DUPH 3V0VB 1OAXH 1MFCH 3RNQA 3R8BB 4OFYD 3V5DB 1D5XA 3OWEA 1CDUA 4HJ0D 4U05A 4RBPK 4OFPA 4Z7OE 2AXFB 3GMNA 4RNRA 4FQ1L 3OG4B 2B4CH 4F15C 3MROA 1HQRB 5E9DE 1NCCL 2H1PL 1SEBA 1CT8A 2EEDA 2OR9H 4F7TA 4UMGA 1Q9WA 4G9FB 4MLIA 4Y19B 1ZXQA 2I9LB 4ZPTA 1NDGB 3DETC 1HXYB 5I75B 3GKWL 5I71C 1HN1A 4BH7B 1RVFL 4K3HA 2JJTA 3D9AH 2WINA 3GI9L 3PF2A 1UWXH 5BJTA 3P11H 3ULSA 5AWNL 4HJGB 5KZCD 2VIRB 1SQ2N 3LAFA 4LIQL 1BFOB 1TIUA 1HZHL 3TT3L 4OF3A 2ADFH 4YFEA 3ZE1F 2G9HA 5GZNC 1P4LA 5ACZA 3CCHA 2GIYA 2ZZUT 5IK3A 4QTIL 2CLRB 3MREA 3VMNA 2NY5H 4D9RD 1E4XL 1JTOA 2FEDC 1MAJA 3H9HA 4R4NC 4GJTB 3UC0H 1FVEB 2FX8L 1LGVA 3PWPB 4PJIF 4LFHG 4TOYH 3HC4H 5A16B 1ODAA 2BJML 4ZFGL 1UM4H 3R06A 2IMMA 4HT1H 5I16B 3RTQC 3QAZC 2IPUK 3QP3A 5JIPA 2N1KA 5MHSE 1IGTB 3OKKB 1JFQL 1FGNH 2X05A 1FLTX 1LVEA 4OGYL 5GGQL 1UXSA 4LSTH 3U0TB 2CRMA 3IDMA 3B4NA 3T8XA 3ARUA 3TCLB 3L3IB 1BX2A 3UZVB 1VADA 1L6ZA 2FEDD 3H9SD 3TLRA 2XWTB 5TE6L 3OKYA 1I85C 2D9QB 3MUGB 3CFBB 4ZQKB 2XICA 4GRWB 4HGKC 3PWJB 1KCRL 4DW2L 1OAQH 4H1LB 3MV9E 2KBGA 3K46A 3L7FA 2GT9B 3PL6D 2GTWB 4HJJH 1RUPL 4OZGB 1QRND 3M1BB 1XGUB 3IJYB 3DWTA 3FQWA 2Q86A 3BVNB 4JCLA 1A3RL 3ET9F 4LARH 4OAWB 4JG0H 4PJ5A 3T0AA 1GZQB 4PBVC 4ZOAA 4APQC 5DMIH 5SWZE 4L4TB 2VYRE 3ZYZA 5GGSA 5L9DL 4L8BB 4KI5C 1MPAL 2UZYB 3G5YB 1QSFD 1G6RL 1FLRH 5MERA 3QPXH 3QQ9C 1TZHB 3P40A 5DQDL 1CIDA 5DRXB 1L0YA 5ICYA 2JIXD 2CKBB 4YLQT 3S34L 3MC0A 3L6FA 3MRPB 4AEFA 5IVXB 1T2QH 5CLTA 1HHIA 4NCC2 3KS0J 5FYJD 5HHOB 4RQQB 3MCG1 5EZOH 3BWUC 3QXAB 4JFHD 3U7WL 2QJDA 1UB5A 3PXJA 4Y16A 5J0BA 3KXFA 4NQXB 5E9DB 2IH3B 1ZVSB 3LKPA 4KKAC 3GJEA 2HFTA 4DKDC 1S3KL 5CJXC 1A7OL 2RR3A 4MZ3A 5DVOA 4FRWA 2NY5C 2YBRA 2VXQL 4HV8B 3BKCH 5BVJB 1F45A 4L3EE 3MRQA 1BF8A 2O93L 3SKMB 4YHLH 3VFGL 5LWYH 1QO3A 1IC4L 1PJ9A 4YXKH 3WS6A 5D7KD 2Q20A 3B9VA 4LLVB 5A40E 5HI5D 1Q72L 4Y4KD 4N90E 3WO4C 1S7TA 1PVHA 5ADPH 2R15A 4P9HC 5B39B 5K9JH 3KLHD 5GSRB 3C6LA 3TP4A 1EGJL 3FN9A 3RWCB 3H7BB 4QKXB 3PJSB 4PJDB 1ZLWK 2R0KL 1DJSA 5IQ9A 4PRDA 4ETQA 3KLAA 4K3JL 4X7TB 4Q97A 4XCFH 2P24B 4JO3H 2DQJL 3L9RB 4TUOB 3RIFK 1CXLA 1HDMA 1WC7B 5BRZD 4KK9D 2IADA 4HK3N 1F02I 5IWLA 4L3AA 4RMSA 5C08E 4JFEB 2GK2A 4M1GL 1IAOA 5HHVH 1SEBB 5IUSA 1JGLL 1AD0B 4HPYH 3HUJB 1YYMH 5I17A 4ALAH 5EIIB 1EXUA 3JTTA 1T3FB 1OWRM 1U8HB 2H3NB 4ODBD 2DB8A 2VISA 4G6ML 4QY8B 3LKRA 2E3VA 1JPFB 2V5YA 4YXKL 2NXZD 1ZWIA 1A7RL 2BSRA 3C5ZA 3BEWB 2AERT 5IESH 5MENB 4MD4A 3ULVF 3EZ8A 3B9KB 1CI5A 1P1ZB 3X13B 1QVOA 1E4KC 5EOCH 1P4LB 4ZNCD 2RQ8A 4K7PY 5TF1L 5IMMB 4X4XB 5IW6B 4KTYA 2CLRA 5GZOD 1B88A 4FZ8L 2DF3A 5HGBB 1BJ8A 2A73A 2RJMA 4R2GD 3X11A 3ZKQD 4K7PH 2B1AL 1EEZA 2VQ1A 4DAGH 2V7HA 4QOKB 5DF0A 5H2BA 4YPGA 3I2CH 3U82B 3I75B 2EDOA 3GIZL 4RISL 3MRGB 3LEYL 5DUML 5FM4A 1YEEH 5LAXA 4WO4B 1RZJL 5DHVB 3TN0A 5C08B 4OI7A 3KPRD 4CBPA 3SCMC 5I1HL 1I7RA 5I8EA 1EMTH 4JKKA 4M5ZL 4K8RC 3SDAD 4UTAL 5HDOA 2XG5A 5EU5B 5ENWA 3H3KA 3I50H 3C5SA 2EH7L 3QIUB 4PP2B 3NPZB 4U1SB 2XZQL 5TF1H 3NOIA 1AFVL 3E8UH 5DQDH 5INCA 4NJ9L 3DTXB 4RAUA 1DQJA 3RI5K 5CJXA 5CP3H 3CIQA 1T03L 1ZMYA 4IJ3C 4HWZB 4P9HH 4NQVB 1I4FA 4OCYL 3B5HA 4MNGB 5HGDB 2DLTA 1R5VB 3Q1SH 4JREC 4MWFA 3G08A 4JG1L 1JWUA 5DD1L 5I1CL 1EEQA 4JO1L 3KJ4C 5EC1B 5GGSB 1MAML 3UROR 1NEZA 4U7MA 4XVSH 1ZE3C 4LGRB 3QULB 1RU9H 4P59L 3VFWA 5I6XC 5DS8B 1MLBB 4HQQH 1S7VB 3REVB 5I8OL 5L2JB 1CG9A 2VZSA 4U7SA 4JRXB 3PDOB 5HDQL 3U9PL 3D18B 3QRFM 3MCKB 4UT7L 1UH4A 1K9TA 2BJMH 3L6FB 3TV3H 4I5BB 1MIEH 3GSRB 4FQHA 1CQYA 4U1LB 1J88A 1FFPB 3UTPD 1BJ1H 2HJFA 5LBSH 2IPTL 2OZ4L 1A7PL 1IGML 1YNTB 2CRYA 1OTSC 1GGCL 2ITDB 4NQXA 5E9DA 2EDBA 3TFKC 2DQTL 4P5KA 2EIZB 1T21B 1XGQA 2L7UA 4GG6A 1PYWB 3BWAB 4GAFB 2P8LA 3QDJE 4MJIA 4FTVD 4GQ9L 1H3PH 1T0MB 4GKZA 2GTZB 2YBRB 4HV8A 2E5EA 5C0CB 1IC4H 1HI6B 1EO8H 1QSVA 1KG0A 3LRSB 2ED9A 4ZDHA 5IFJB 4G9DA 3RWEA 4X4MA 2AJYL 4WUKH 5CIPH 2WQ8A 4XPFL 3RWFB 2E6PA 5EU4A 4KRPB 3BESR 3RKDD 1Q9OB 3VXUD 4GKNA 4TNVK 2NY4C 4JVUA 4LLVA 4KQ4L 5DJYB 1R5IB 4EIGB 5D1QD 2VITB 2KL6A 1QPXA 3OR6A 5B21A 3K8LA 1JGLH 1UH3A 2XQBH 5GGVL 3BYYA 1NGQL 4ZAKD 1NJ9A 3QUXC 4BH8B 1LO3L 3QDGE 4WTXA 4XVUD 3V7AG 3PJSA 3C08L 4EUPG 2FJGB 4HMCA 4RSVA 1T89A 4GMTH 4OCWH 2DQJH 4MLSA 4AEEA 5HVGB 4ZNEA 4CMHB 4PLNC 4X7TA 4FXGB 4LLQA 4YGVA 4Z7UB 5IKCA 1DSFL 2F53B 4PJCE 5DJ0B 2BVUA 3P4MA 5IBUB 1ADQA 5DJ8B