4GAGH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 412-423)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
212
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
total genus 45
structure length 212
sequence length 218
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gagH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gagH02
3PHQA 1JGUH 2OI9B 4XXCA 4JFOA 3QIBA 1NBZA 2F53A 5JPNA 5D5MB 2RFXB 5KTEH 2M26A 4JFZH 4HWUA 5LXGH 4K2UL 4N5ED 3D9AH 1T5WA 5EUKA 4NNPL 2X1QA 3AMLA 5DRNB 1J1OH 1BFOB 4MAYB 5IVNA 1IC5H 4U1NA 3WO4B 2HT3C 2PYFA 1MCRA 4NO5B 1AHWC 1NC4B 2ICES 2P43B 1ZA3B 3CXHJ 3U48A 4D2NA 2HVKA 3VXPA 4OZGF 5EN2B 4OZ4B 3ZMRA 3HE6B 3D69B 4TNVK 3ULUE 3PP4H 2BSRB 1JVKA 3MO1A 2XG5A 5DA0B 3QXAA 1ZLVK 1C12A 5AUMB 4NFDA 4FFYH 1G9NH 4PJXB 5D5MF 5CBAA 3BGMB 1SM3L 4Y89A 1OAKL 1YNTA 4S11A 1XGQA 3LEVL 1N4XH 3ZDYE 1LNUA 3SKUD 2DQTL 2AGJH 1U95B 4XMLH 5ESAA 2V2WB 3ZL4L 3H6JA 3QEGL 4XVSH 1H9VA 4OLXH 2WWKO 1F97A 3IXAB 1F5WA 1D5XA 3RWJA 1YEDB 3PWPB 3H9SA 5J0BA 1YEKH 1CFNA 4YBLC 4GG6B 5E1AA 4I18A 1IEAB 1N5AA 4CVZB 4X6DA 1ODAA 2Y23A 2GT9A 2WUCL 3FZUC 4HIEB 4PY8I 4FZ8H 3MRMA 4DCQB 1CL7L 3FQXB 3RTQC 3LRHA 2CDFA 2G75A 1YZZA 4N0FB 2Z93B 4WVRA 2C4FU 2DLFH 4OZHA 5T3ZH 2RCSL 4LKCA 1KBGL 3KPOA 5DWUH 2J8UB 5J06A 3BDXA 2F58H 1V7MH 1K8DB 3QUYC 4O4YL 5HI3D 1NGQH 1Z5LA 2CJUL 3QDMA 3UO1H 4EI5B 5DEGB 2QSCH 5D1ZB 3E6FB 5FV1L 1A64A 3EW3B 1EAPA 1LP9F 1JMZA 1XF1A 3MCLH 4ZOCA 1YYLH 3CLFL 2P1YA 1ZAGA 3EO1B 1OQXA 1UM4H 4NZJA 2MOVA 4QCIA 3VFWA 3B2UD 5D6CA 4J4PC 4NRZA 2HRLA 1U3HB 1WITA 2R0ZH 4NQDD 2B7DT 1U8NB 4Z7VF 4IOFD 3EUUA 1P69B 5C08D 2Q8BL 1OF2B 5F88A 1ZA3A 2QTEA 4PBVC 4KZDH 3QNYA 4PJ8C 4TVSa 4HLJA 2BOBA 4ZOAA 4W6XB 3MRBB 1V3JA 3F7PC 1OAQL 3SJVD 5L9DL 2E7MA 4Y0GA 1F4YH 5JHLH 3WFZA 1KYOJ 3CFBA 4JHWL 5C0AA 3UBXI 1T0MB 3MO1B 1WV7T 5C0JB 5E2TH 3MRGA 2DQIL 4TUJA 1JZ5A 4KZEL 1S7RB 1GH7A 2XACC 1FZMB 1IILE 3VFTA 4M62L 4NJAH 2X4SA 1PDKA 4PLJD 5FYLL 1Y18A 5K9QI 1RU9H 5CJOL 4Y1AA 2WP3O 5E56A 5MP6L 2R2EA 3E8UH 5EZIL 4G7VH 3DX6B 2VR5A 2BNQE 5ENWB 3CCHA 2Z4QA 3GRWA 5FYKE 5AYUL 4BFIB 4L8SA 1V7NL 1A5FL 2VISB 3WHE1 2O61A 4U1JB 3VGHA 2C3VA 3SHSA 3HUJA 4MJID 5EO9B 3MLVL 1B4JL 2RR3A 5SWSB 5DMGC 3HCVB 4CU6A 1S9WB 3B4NA 2HJKA 4Y5XB 1AGEB 4DUWA 3MLPA 4H1LG 1EEQA 4PJBA 3MGTB 4HS6A 2ADIA 2BVQB 3RWFB 3K80A 3EDJA 3TZVB 4FZ8L 3S8WA 2E6PA 5C2BL 4J3TA 3V4UL 3IU4L 3L3HA 3UJJL 2MPAH 2BNUB 2PTTB 4XB7A 3DURB 3GZKA 1RJZA 2W65B 1BZ7B 5J89A 3S9DB 2XI9A 5GGSA 4GOSA 4L3EA 3HG1A 1KJ2B 4A6YB 3TBVB 1NCUA 4IIQB 1IGFL 3ARDA 4KKLD 4J12A 1ZWIB 5AZEH 2AJYL 5MEOA 2F54E 3I6GA 4XHQA 1G7LA 1A4JB 5DMIL 2OP4H 1JK8B 1IEHA 4QXUH 3BH8A 3GBNL 3MLTA 4PJCE 4ODTL 5C0CB 2VMFA 5E8EB 3B8YA 1MAJA 3CVIL 1OY3B 4HSQA 3O9WB 3QFJD 3GDBA 1D9KA 4ODSL 1QLEH 3VFRB 2F74A 4HUXB 3UDWC 3P0VL 3OF6A 3QISA 4PD4J 3QYCA 4KY1H 5MEQA 2GEEA 4JZJB 5KOMC 3OB8A 4LLUB 4XNQA 5D93B 4FN0A 2R4RH 2FJFB 2E8YA 1FZJA 2VXSH 3V52L 4XX1G 1MHPH 3HB3C 5D7SL 5EO1A 4M03A 4EOWL 2FHBA 2H6PA 2NW3B 2R0LL 2X4TB 4OV6F 1MY5A 4KRPC 4LVOB 2Q7YB 3HUJB 2DWEB 3NZHH 3S35X 1R3JA 2CKBH 1UYWL 1U8MA 2FJGB 3KNBB 3HMWH 4TOYL 1IAKA 1W0WA 4P5KB 4UV4L 2EE2A 1YPZF 3MRIB 3GHEL 4JGMA 2LVEA 3U4BL 4PJBB 1E4KC 3X17A 5CSZB 4AENA 3UTPE 1RULL 3ULSA 1D6EB 2QR0A 5F3HB 5L88L 2VR4A 4DTGH 1AD9B 1VCAA 4OM1H 1PLGH 4JFFA 5KSVA 3E1F1 2NY1B 1HSAA 2DBLL 4G9FB 1MH5B 4G8GD 3CFEA 2GKIA 4ZXBA 4O51B 1B4RA 1FZOA 5IB2A 3ARGD 2H9GA 3VMOA 5E0QA 4LSTL 4ZFGH 4C59B 4OF5A 1KJ2A 1Y6MR 3O4OB 3IFOB 2H8PB 1NLBL 3S5LA 5FA3B 5JR1L 3QP3A 4J23A 2FHFA 1IZKA 2F5BL 4WO4A 5C0AD 2VDMH 1E28A 2P8LB 4GLRH 1MCNA 2G60L 1MJ7L 1AJ7L 2AXGA 1SJVA 5F89B 1MWAB 4IRSA 1SBSL 4HT1H 1RJLA 2W0LA 4P2QE 3TVMD 5GS1A 4R26H 2BY0A 2Y5TB 3UYPA 3DYPA 5DMYA 5HHXH 3QEQE 4Q2ZA 4NNXB 4E0RA 2VR9A 1SJEB 3QQ3B 1YNLH 4HQQL 1KJVA 5KVFH 1NAMB 2NY3D 1JI2A 3L95B 5CIPA 5H8DA 4ODHL 1S9XB 1U3HC 1BBDH 3I75A 5GS3A 1UT9A 1UFUA 5JA8B 4I0KA 3TJHC 4XNZB 3T77B 4MJIA 1FBIH 1I4FB 1R3LA 1UJ3B 4JO1H 4LRIA 3MV8E 4M00A 4Z7QE 1TCRA 1B4JH 3VH8A 3BQUA 3IFNH 3VD3A 5M7QA 3MV9E 5HBBA 4TN9A 2E9JA 4I4WA 5ESVA 3QDAA 5C6TL 1JRHH 1BFVL 4XPHL 4CMHC 1U91B 4EI6B 1DUZA 4EJ1C 5JZ7D 4AQ1B 5IBLD 1AD0A 1FYTD 5DHVH 5DQDH 3GI8L 4NWUL 1Y0LB 2XFXA 4LNRA 2VXVH 4WFHD 2YMXL 3V0AC 4HPOL 2OJEB 3VD7A 4MJ6A 1EK3A 5TF1H 1RUAH 3ARZA 3IDIB 4OUUA 4KVCH 3ARDD 2LV4A 3BZ4B 1JUFA 1WT5C 3M1BA 1O7VA 4Y4HC 4HIXL 3RGVC 3L5IA 5DRZB 2R8SL 4Z7UE 3OKYA 5FA3A 3OXRB 5F9DC 2R15A 3QHFL 3BUYA 2R2BA 1XF5A 3U36A 1HI6B 2NMSA 1BZ9B 2P8LA 3HNSH 4BZ1L 1S7WA 4H1LB 4ODUA 5EOTB 4JRYB 5E5MB 3ROLB 3QIUD 2PN5A 4H8WL 4JFQB 4KK9D 1KCRL 3QCUH 1T6VN 1K3IA 4MZ3A 3H3KA 1EVTC 1EJOL 4ZSOE 1JWMB 3IDGB 5DD1H 1TJGL 4XP1H 4LLQB 4Q2ZB 3WFDH 3VJ6B 3PL6B 1XCQB 5GHWL 1AH1A 1XIWD 4J3VA 5TQ2H 3RWCA 2EDQA 1K8IB 2X1OA 1S5IH 5HGDA 4ELKB 2YPLA 5I1DA 3T77A 3RVTC 4WI9A 1ONQB 3FFCA 5HTSA 5KZCB 1JHLL 3DX8A 4Q0XH 1A9EB 3V0VB 3ZTJH 1X5HA 3Q1SH 4LHQB 5GQBA 5DEFA 4BQ9A 1FJ1A 1GSMA 4WNQA 2JELL 3MRDB 2FIKB 5KVGH 2PR4L 4HUVA 3RNKB 1OD9A 3OKDA 4LLWB 2IBGA 3V9FA 5EBGA 3S37L 3X11B 5KS9A 1OAZL 4RISL 4YDJA 4YR6B 1DQQA 5CP7A 3W9EB 4NUGL 1K9TA 4WHDA 4XC3H 1OGTB 5LBSL 1IGTB 4G8GA 3NAAL 2QSVA 3WO4C 1KGCD 2ARJQ 3ARGA 1OW0C 5E2UH 1SYVB 5I1AA 2CLRA 3G5YB 2ARJA 1AI1L 4XNXH 2JJWA 3W0WE 1QRNA 4Y16A 1I8KA 4PIRF 4EQ3A 1U2HA 2X4OA 1W8NA 3NPZB 4TUKL 4ZPVB 1UM5H 2DKMA 3OR6A 5DRNA 3G9AB 4MCZA 1JPFA 3BUYB 3VXOA 2FD6H 1TMCB 1AGBB 1GVIA 3CXDL 8FABB 3MV01 4IRSD 2D0GA 2HYMA 3QQ4A 4L8DB 1CDIA 2W92A 5JW3L 3FN3A 1A7QH 1JF6A 4PP2B 3STLA 4KGJA 3NGBB 4K9EC 2EEDA 3OJ2C 4UILL 4HEPG 5F7WC 1DEEB 1UZ8B 1N4XL 2VN7A 1D5IL 5EO9A 2A83A 3E8UL 3T2QA 3U46A 5DJXA 3PP3H 5IKCB 1RU9L 2P49B 9CGTA 5F97E 5CFHA 4D9RE 1BX2A 5EC1B 2I9TB 3RBSA 4PJ9A 5IVXE 2DM3A 3LEXA 4N90E 4PG9B 2P5ED 3MODH 1CT8B 2OL3A 1PQZB 2PUQT 1Z3GL 4Y5VB 4QNPE 1CLYH 5D7IB 1E6OL 1ZA6B 1IGYB 1YNKH 2FX9L 1IQWL 5JW4Q 4JQVA 4QYOB 5ICZB 1Q72H 3DURA 1S7VA 2VDNL 2JCCB 4OJFL 1I9RH 4A6YA 4ZOBA 2DQJH 2DS4A 2UVEA 5ELIA 2VLJD 3RU8L 5T1LB 4JO3H 1RQ5A 4U1MB 4GRLA 1EO5A 4ZFOL 1N2RB 4MDIB 5EWIH 5J6HB 1UKQA 1CXEA 1SQ2N 3SQBA 5DJ8A 3BESR 3DHJA 2DDQL 1F3DH 3TN0D 2OR9L 2ARJB 1TVDA 2XZAH 2X9WA 4E5XA 2NX5D 2IGFH 1PZ5B 5IR1B 1D9KB 5JHDD 2D7TL 3H9ZA 2RCSH 5D7LD 1F90H 3ULVE 1VFAA 1YJDH 1FVEA 4DKEL 4D8PB 4QF1B 1T0PB 5ALCH 1QNZL 2YPVH 3U7WH 2HTLD 3H7LA 3R1GL 4X5WB 4Z7OF 4UTBH 3MCG1 3MLUH 3VFOB 4G8FB 3UXFA 4HF5H 1XZ0A 2APWA 2KKQA 1INQA 2WBJB 3CUPB 1MCQA 3V0WL 1LK2B 3HE7A 4FQCL 3BRFA 2BJMH 1D3CA 3BPLB 5F7MC 1Q9LB 1LDPL 2NW3A 4U6YA 3T0XA 3DI3B 4GSDH 5E8OA 1XIWA 5E99H 2DWEA 1WTLA 2ZUYA 2VLKB 1N5YL 3SJVE 1OP9A 5CBEB 3OKNB 1FP5A 4H20L 1OLLA 4PV9B 4AY0A 2L4OA 3DMMA 3U0PB 4X7SL 5T3ZL 3FFCD 2WUBH 4WW1A 1EEZA 4R4FH 4OFYA 4D0DA 2C4FT 5CGYC 3BN9D 2AJZB 2W9DH 3RZCC 2DLTA 2FGWH 1S7VB 4G7YH 4WHCA 3KYOA 4WHTA 4CAGA 5ISZB 3EOBB 2C3VB 4KRLB 3CFDB 3QO0B 1D5BB 4N0UE 3KYMA 2EDLA 4R2GD 1N59B 1NANH 1S9WA 2X89D 1U8LA 1J1OL 3RA7H 1VFUA 5LGKA 3O2VH 4K2UH 4EXPX 1MLBA 5FO9B 4P2QD 3D9AL 2O26U 4PGEB 3EOAA 4OB5H 4I9WD 1EFQA 2H2PD 4WTZG 1T04B 5C0BB 1MCPH 3GSVA 4ZO8A 3ZKSD 3D0LB 2H2SD 2IQAA 4KDTC 4A2LA 2O5ZL 3GJEA 5FUOH 4WUKH 4NO2A 5CJ5A 4X5XA 2F8OA 4BSWB 5DRXB 5D93C 3DXAA 3MJ7A 3S7GA 3TFKD 3E6HA 1JV5B 4FZEL 4NIKB 3TBWA 3BZFA 2V5MA 3FOMB 5MEOB 3Q5YA 4NQTA 1WIPA 4UOW1 3LN9A 4KUCD 4FQXA 4ESKA 4PJCA 3OXSB 1DQLL 4OCYL 3QZWB 3DV4B 4LVEA 4XAWL 4GKSA 4XVSL 2UYLB 4CDHA 1B0WA 5MERA 3KLHD 5I1HH 1K4DA 3GMQA 5DA4A 2AGJL 5JIKA 2ZCKL 1OAXL 3OKNA 5EUOF 4I5BB 2ARWA 5I8KL 4JQIH 4JCLA 5I1GH 2H2SC 5DEZA 1MRCL 4KTEH 3DMMB 3U0PA 2ICWA 2V7HA 15C8L 3F7QA 4NOBA 4NQUA 4QRTA 2UZYB 3MJ9A 5IW1A 1ZGLM 1Y0LA 2XFXB 3CSYB 2CDGB 3MGOB 3LRSB 1AQDB 1A6TA 1MCHA 4JE4B 3QUXC 3C5SB 2A9ML 2HMIC 2IAMB 5TF1L 2H45A 3WN5A 4KMTL 5HHPA 2AJ3B 1BM3L 1NAKH 3LKPA 4XBPB 1P7HL 3QDJE 3UJTL 1EO7A 3UBXG 1P4IL 2X9YA 4OLYH 3MFFB 4XRCA 5D8JH 4N0UA 4S1DD 1ZOXA 2DI9A 2XQBL 3TN0A 1X5IA 5EOCL 4YDLB 3CX2A 1G6RB 3GHBH 3ARYA 2ZUVA 3FB8A 1I3UA 5F8QC 2QR0B 4K3DL 4LIQH 4KRNA 1KNOB 3RWHA 5EULV 1VB9A 5D9SB 1F3DJ 1KF9B 3OGCA 4LSUH 1M7DB 4K71C 4GMTL 3CH8A 2MQCA 3GJEB 1T2QL 3PQYD 5C0GB 1UWEL 2SEBB 4JFPA 2R0WH 4BSWA 2HT2C 4ETQA 2GFBB 3DUSA 3X3FL 3LKNA 4AM0A 3IF1A 4XPGL 3P2TA 1KB5H 2YA1A 1YEGH 2J12B 2NY1C 4NSKB 4OT1H 2YD7A 4HWNA 1TJGH 3DETD 5CLWA 4XAKE 4Z7WF 4ORGA 4CW1A 2EDHA 4KDTA 4FXLA 1S8DA 1MQ8A 5KS9E 3HA0A 2VDLH 3SE9H 3L3IB 4R96A 4V1DB 2ERJB 1U58A 1HWGB 2JJSC 2DIJA 5F7EH 5SX4H 4S1QL 4CDGC 2YR3A 3ZYJA 4FFWC 1BEYH 4JFYA 1DEDA 5DGQA 2DMCA 1IFHH 5HGAB 1DQQB 4OD3H 1I75A 2R56L 4HLZG 5D1XC 5HHOE 3V6ZB 4PLKD 4ALAL 3OB0H 1RUPH 5F71A 1X4XA 1JGLL 2EKSA 1TETL 5C0FA 5F7UA 1F8TH 2W0KA 3G6JB 5ID0B 5MENB 3DLQR 2EIDA 1HHHA 4N0YL 1A6UL 1ZSDA 4KTEL 4QT5A 3WFHB 3VH8B 1DVFD 1FO0L 4HC1L 2C9AA 5DJAB 5DUBA 3RY6A 3SGEH 5D2NE 4MCZB 5CZKA 3U7AA 5JLZB 4KTYA 1IEBA 5EBWA 4LSSL 4NGHH 3FO9A 1LILA 5INCB 1UXWB 3LQZB 3FT2B 4AJ0A 2N4IA 3AAZB 3MV7E 5D8JL 4F2MB 2ITDB 1TQCC 3ZKXB 3LPGA 4G3YL 1BQHG 1EHAA 1RUKL 5HJ3B 2HMID 1IAOA 1JPSL 2ZP0T 4UINH 3N85L 3VXRA 3OBAA 5CJQH 4LFHG 5KN5A 3O8XA 3MLWH 4MQXC 4R4FL 3GMLB 4XTRD 5DURD 4NC2B 3O41B 4M1CC 1JE6A 4HMCA 5E6ZA 5LVEA 4WUUA 4OQ1A 5DC0A 4KJPC 1DQJA 4H20H 3MACH 3WLBA 4M9PA 4WDIA 5EFIA 4KHXL 5ICZA 5E8NA 1J9CT 3C60D 2X4QA 3DUHA 4Z77A 1YNTB 4XXDA 2AJXL 4ZFFA 4ZUUB 4Z7WB 1AP2A 4U1IB 1EMTH 3P11L 1U95A 3OR7B 4OCRL 1KPUA 5F1KC 2W9EH 4PRPE 4X6CA 5K9JH 4KJYA 4G43B 5FYLE 3O2DL 1YMMD 2FJHA 1I3GH 1NGYA 1WZLA 4NQVA 4GRLC 2GIYA 3QSKB 5ETUB 1YECH 2UWEB 2MHAB 3J7HA 1A4KB 5DJZB 4WU5B 1DANT 3D1MC 1CU4H 1FDLH 4OD2B 4GH7B 3VFGL 1J1XH 5TPWH 1KTLA 1H3TA 3DTXA 5I1EL 1DBJH 1NDMB 2FH6A 4DVRL 1C16B 4J6RL 3RTQA 3L1OH 1FVEB 3UTZB 2FIKA 3HR6A 1MEXL 3ARWA 3BP7B 4GSDL 5JLZA 4KKAC 1F3RB 4LLWA 5L2KA 3GFUA 5T33H 1FLRH 5JOPD 5L9DH 5EN2A 4HF5L 3NCJH 1I1YB 4XPBH 4NCDA 3WXWH 3OWEA 3VW3L 2I5YL 2DL9A 4H26A 3K46A 1INEL 3MXWL 1FL3A 4N8PA 4UOJA 2AJYH 2NY0D 1N3NB 2B0SL 4G9FE 1ORSB 3TV3L 2XTJD 1DCLA 1R5IA 5GJTH 1C5BL 2VXQL 3PWVB 1KPRB 5T5NF 4LQFL 5FGCB 5FGCE 1XIWC 4OLWH 3GBLA 4LLYA 5KAQG 2AV7B 4JPIB 3AY4C 1BZQK 3QA3A 3SQOH 2NXYB 2NYYD 3HAEA 4U0RB 2Y4SA 3WLWD 3DRTA 3ZO0A 3WNMA 5DRWB 1IL1A 4D94A 3WS6A 3PWPA 3KHQA 3GO1H 2ATPB 5DD0L 5BRZA 1HEZA 3MFGB 3EOBA 4HWEH 2GT9B 4Y4HD 1IGCL 2ADGA 1T1WB 4MNHB 1T03L 2H1PL 3ALPA 3CMGA 3R8QA 2G75B 1GHFH 5B21A 2NTFB 1JHKL 4K7PY 4LSVH 3RY4A 4EIGB 6FABL 3QJFA 2NR6D 1IQWH 1F02I 1XGYH 1MLBB 3I6LD 5FO9A 4PJ9B 5I71C 4EDWL 1FGVL 1FL6A 2RHEA 5GGRB 3MV7D 4OI8A 1CGUA 3AU1A 3NA9H 2ED9A 4Q6IC 2ZWLT 5IFHH 1SY6H 1IGYA 4PJFE 1Q94A 3VU2A 3EO1A 2DM7A 3MV8B 4PS4L 2P24A 5HHOB 1UM6H 5CILL 3RWFA 1S9VB 1LP9A 5JNYA 1A9BB 5FKAB 2IADB 5IK3A 3LEYL 4ZSOA 5FGRA 5KSAD 1JPTL 5DQ9A 3CLEL 4OCWH 1QSFE 4APQA 2BCKA 5C70A 43CAB 5F93C 3C5ZA 4IDLA 2NX5E 3RI5K 1Q0YL 5C7XH 4GG6F 1DLFH 1CR9L 1RIUL 2A73A 1T0MA 4QKXB 2COQA 1MQKH 3ARFB 2IFGA 1JN6A 3VG0L 1H8SA 4MA1C 2JE8A 1S7RA 3M07A 1A1MB 1VPOL 3ESVF 3T3PE 1GGIL 4UTAL 1CBVL 5IJKA 2ICWB 2V7HB 1DANU 5C9JA 4FQIL 2HTKC 3TCLA 3V4VH 3VFMA 3MUZ1 4DQOH 3MJ9H 4U7SA 4QRPE 4E41A 1C7SA 1AFVL 2R2EB 4F9PC 1U93B 2VNCA 3G6DL 3CSGA 5I8OH 1X6NA 3MRQA 4P9HC 1JNNH 2XZCH 5DR5L 4BH8A 1T1XB 1JZ7A 1J0HA 1JYNA 4NT6B 5C09A 4HKZB 1RPQA 3HZYA 4PBWD 2BX5A 2GJZB 4JZJC 4NP4L 1ZANL 5GGUB 5E2VL 1YMHB 5B38A 1EHNA 1JTTA 4NKDA 4OBRA 2DQJL 4WHYG 3AMKA 3JWOL 3MV7B 3QI9B 3MYJA 4KZDL 2HLAB 2IG2H 4UQ3B 5E4EB 3NBNA 4V1DD 3IJSB 4FNLL 1EUTA 1NMBL 1P9MC 4OZGA 1QBAA 1W8OA 1JCKA 3GKZA 5A2LH 4DK6A 4OQTA 2UVFA 3FQUA 3SGDH 2BY3A 1ROWA 3KPTA 4KKBD 4QRQB 5F3BB 5KTEL 3EDKA 5TQ2L 3CH1A 5IHUL 1JGUL 3KYKH 2R69H 1SM3H 5DFTA 3H9YA 1AI1H 1OHQA 4L3EB 2E9IA 4WI7A 5C0EA 3VGBA 1YMMB 4J8RA 1DVFC 1EXUB 4OIBA 5K9KB 1QFWH 4KMLB 5DQ9B 5L2JB 3EJZC 3KYMB 2Q3AA 1RD6A 1QOKA 3CDCA 1EBPA 2W60B 4G9FA 4M8QB 4QXTB 2CLZB 4OZHE 3ZKMC 3UTTE 4TPRH 3DECA 4AEIH 2GYSA 4OFDA 1ETZA 2R2HA 4EN3C 2F15A 3IFOA 4MNQE 2H32A 5I0DA 1NUGA 4N1HB 4G8EA 1KXTB 3CPLB 3SKMB 4KUZH 2G5BA 3D85D 3ZL4H 1FNSH 2IH1A 2FECL 3O45A 2D03H 5C0CE 2PKDA 3PGCA 4DKAA 1DQDL 1PY9A 4NQEB 4X9HA 5DJCA 5DD0H 1F45A 4HJJH 1EDQA 2FNBA 4P5TB 1L6XA 5J1TC 2CXGA 3AS2A 1CE1H 2FBJH 1J1XL 2Y5TA 2AVGA 2E27L 4WY7H 4UT7L 1P6AB 5C08A 4LSPH 1DSFH 2XQYG 4PGDA 5CHNB 4DUVA 3R0NA 3HZYB 3KPQB 2ICWJ 4ZUVA 3OSKA 4F57L 1BFVH 1UCBL 3RKPA 4G6KL 1SVCP 3QUMH 1B3JA 4O00A 1IMHC 8CGTA 2B0SH 3DETC 1WTGT 3QI9D 5IQ7L 3MV7A 2DQDH 4CUCA 4JFED 4I5BA 1MFNA 4HWZA 4Q9BA 3I02A 3MR9A 3LMJL 4HGWA 3WE6B 1DBKH 3I84A 3BYYA 1PZUB 1PSKL 3TYGL 4S1RH 1JHLH 5C0DA 3L5JA 3L5XL 1TVHB 5IFAH 4K55A 4QHKJ 1KCVH 4QRQA 2P5WA 5I18L 2J4WH 4CMMA 1ORQB 1I9EA 3SOBL 4S0SD 2YSSA 1J11A 6CGTA 1A6WL 4HAGA 5KSAA 3N1QC 4OZFA 3GMMB 4POZC 1QLFA 1UH2A 2E7CA 4UZGA 4JKLA 3VXMB 3MBXL 4N0CD 4CN6A 4J7RA 4N0YH 4ZUTB 2ZOLB 5F7FA 4EUPB 2PW2A 4LSRL 4I48B 4Z0XB 1GCFA 4IOIB 3B3IA 4MSWA 5CEXA 1FNGB 2AAVA 2AP2A 2MSPA 1U2CA 4P48A 1UXSA 4UIMB 3VWKD 4M5ZH 3ROOB 3FB8B 5F9OH 1XAUA 3AUVA 3MRFB 1UVQB 4JM2D 5H94B 1I1FB 2EH8L 2BSSA 2E8ZA 2R2BB 4PJEE 4YHIA 4C56A 1CFVL 4YK4C 3VWKB 5SWZD 1S7XB 4CVXB 3UTQA 3TIEA 1KSRA 4I2XE 4X7EC 5FKPA 4FQHB 4JDTH 5F6HI 1P84K 5C09D 3RL1B 1CD0A 5DJDA 3HG1D 5GSRB 4LP5A 1Q9WB 1QLEL 4N8CL 3T0EC 5F9JA 2DQGL 4IMLA 1HKFA 4PJ7E 1ED3B 1WVZA 4ORGB 5DMKB 3IDMB 3G5VA 2PXYD 4KV5E 2JK5A 2DRUA 3T4AB 3L5XH 1JF5A 1TZIA 3B2UC 4V1DA 5DHVA 5CINL 2NW2A 1QO3A 1NBZB 5DK3A 4LCWA 1JRHL 5L7XL 3N1GC 4XGZA 3HZMA 4QXUL 5I1KL 1VEMA 1TZHA 1JYXA 5JA9A 1WUNT 2C1OB 5E2WH 2XRAL 1IGJA 1JWUA 1VSCA 3K81A 5GISL 1A6AB 3UZEA 3MOAL 5CS7A 4YHLH 4YDIH 1HWHB 2HLFD 3RWEB 1Z6JT 5HD8D 1FC1A 5KSAC 3CVHA 4LCUA 5F9AC 4ELMA 3P0VH 1MRDL 4N0CC 3L3OB 3FZUD 5GPRA 3QULB 5DRZA 2XTJB 2PXYB 3TNNB 5IB3A 4HK3N 4LLYB 2ED8A 4R2GC 3BW9B 4LAQL 3QA3B 1FNLA 1TETH 3G04B 3LPWA 2L0DA 3LSOB 1BQHB 4NNYB 1RAMA 4ZTOL 4NZUH 2P5EE 5ANMB 1U42A 1NFDE 3DBXA 4QWWD 3WJJA 3VXTA 1I1FA 3LPFA 4D9QE 1GC1C 3U0WL 1F4XH 2Z8WC 2KQMA 4NN7C 4P3CH 3FO2A 2P7TA 3SO3C 3VJ6A 4UQ2A 4EDXB 3ZYZA 4JQVC 4OCYH 4NN5B 1A14L 2CH8A 2OR8A 4OGAD 4MD5A 4DN3H 5FM5O 5ITBH 5D1QC 2DBLH 1KCLA 3RIAF 1OVZA 3MRMB 3O3BB 2AEQH 5IVXF 3BYTA 5LKNA 3JTSA 2D0FA 3BN3B 3JVGA 3TO4B 1P7KB 5D72H 4BH7A 4MDJB 1MLCB 3JVGC 3QWOB 1XR9B 5JPMA 4WO4D 4JFEA 5I66A 1QFWI 3M8OH 2H32H 1LP9E 4G6MH 2IBZY 2IPTL 4FQLH 3VGEA 1N7MH 5DDHB 4DVBA 5IBUG 3IFPA 5AYUH 5E9DA 2HTLC 4S0TD 3TA3C 5LWYL 4NRZB 2X4RB 1N5YH 3KLAB 4OTXH 1FNEB 2VC2H 4NM4H 5D96B 1QEWA 1ES0A 5LG1A 4M62H 1LDPH 3EJZD 1BF8A 3TEUA 4XC1L 3ZLQC 3DTXB 1IKFH 4X8XA 2D2OA 2W0PA 4KTDH 1IQDB 1FL5A 4RGMB 3S34H 3VGDA 1XGRB 5GZOD 2CKNA 4PJHF 4Z18A 4RGMC 5KZCD 4DKEH 2FX8L 1EFXB 4Q9QH 3BH9A 4GT7A 1GOGA 3DO3A 4B0MM 3W39A 3MLVH 4KROB 5E00A 4J3XA 2FR4B 1BQSA 3FQWA 4GKOA 1CWVA 3NOIA 5DMIH 3KAAA 1B0RA 4M3KB 5EOCH 4Q9CA 2RIKA 3H9SE 1WLHA 1YN6A 4WV1A 4KUCF 2X42A 4P2QB 1SJXA 3RPIA 4WI3A 3V8CA 4TUOA 1RK1A 1NUDA 4ENEC 3S35H 4NYLB 1DQLH 2MPAL 1I1AA 3PV7A 5BRZE 3O3EA 1FV1A 3BXNA 4RGOH 2BVYA 1URLA 5DWUL 2BVOA 3QUZA 2NY2C 4MJ4A 3RWGA 1AGEA 3TJEH 3WHE0 2HG5B 4AEFA 5T1DL 1MCSA 5TFSL 4IRZH 2YWYA 4LF3B 2VUOA 5IT2L 2BVQA 3U1SL 5B4MD 3QHZH 1CL7H 2QV2A 3NIDF 1U3YA 5D2LE 3OG6B 4E42A 2A9NL 4LCIL 1GPOH 3I2CH 3VD9A 4LGPB 5DDHA 1QR1A 3MLXH 3OKOB 1M1SA 3QG7H 1RHHB 3VI4E 2OJZH 4MDIA 3DSFL 4EQ2A 2HTKD 4NZDA 3KYOB 4NN5C 1P1ZA 2VZSA 4GG6A 4NN6C 4UV7L 4XVJH 1ETZB 4ZFZA 5FOBA 2Z0BA 3RU8H 1T7VA 4JHAL 2FO1A 1T66D 1LEIA 2Q7NA 4JJ5A 4ZODA 3CSPA 4N0FA 3LKOA 4F7EB 5CZXC 1Z0NA 5LWYH 1KG0B 5FYKL 3MLZH 2YPLD 3RHWF 5K9OB 3IKCA 4R0LC 1A1NB 3TVMB 4KK6C 3MSPA 5JNYB 2CJUH 1CTOA 2X1XR 4K7PH 2J8OA 1FGNH 4PJ7B 4MA7L 3E0GA 3L6FA 1G1YA 1YNKL 3AM8C 4KXZI 2B4CC 1WK0A 2OI9C 4TNWK 3EYOA 4G8IA 1V8HA 3MGAA 3K8MA 2XZAL 2P44B 4AMKH 4HV8B 5DFWH 4GRWB 3KS0J 3L3KA 3QXDA 5GGVL 1C5CH 4JZJA 1DBBL 3FO0H 2EDNA 2VDQH 4P23B 4YHOH 5CD5C 4DKFL 4Y2DA 4C4KO 3C6LC 4FQJH 4R7DA 4PRBB 3ZSSA 1QYGH 4HMEA 4TSBL 5IJVB 4JFZL 4HGWB 3FOLA 3WE6A 4ZMAT 3VE0B 4JR9H 5C0DB 3QG7L 1MAML 4HCRH 4ONOA 2AABH 4U1KB 5C0JA 5JMOC 3DYOA 4RMUA 2IWGA 5DF0A 4B53A 3FRUA 3QUZB 1OQOA 1XH3A 4G6ML 3F7YA 4YX2H 3DX7B 3G6AA 3MZTA 4FP8H 4Q0XL 4Z7UF 5KSAB 2VLRE 3PHOB 2YPVL 3SCMC 1N0LA 2X70B 3WKML 2P8MB 1IZJA 4O2FA 1E6JH 2CKBA 4WI6A 3WFEL 2AEQL 1AQDA 5GGSY 1J8HA 4IOIA 5GS2H 3MNWB 5HI5C 2IAMA 4D9QD 1BBJB 3GBMH 4K3JL 4LIQE 1N0XL 2IMNA 4X4ME 2FATL 4XBPA 1EBAA 1AR2A 2ESVA 2IFFL 3RAJL 3D3VB 4Q7DA 2DLEA 4N5EC 3WV0A 4N0UB 4PJ9D 5H94A 1U0QA 3D0LA 2Y7QB 3DROA 3FQTB 3FT4B 4JO3L 1F4AA 2DYPA 3VXSD 1I7UB 1CGSH 1I9IH 3I3BA 1T1ZA 1JFQL 1QQDB 3WXVL 4FQ1H 5I1KH 1FORL 2YD3A 4PP1D 4QHUB 2VH5H 3EO0B 4QRUB 1CIUA 5JZ7C 2PO6D 5C07E 4HBCL 5C0AE 5J3HD 3EO9H 5IBUB 2IGFL 4LEXH 3D25A 4I9WE 1BAFH 4ZUSA 3QQ3A 4L4VA 4YBQC 1T20B 1NCDL 3LIZL 4LCCB 1KPVB 4K7PL 3H0TB 5IROA 4GRLD 4OLWL 2DQUH 1X5LA 2UZXB 3KPSE 4X6FB 4XC1H 2OR7A 4YHLL 3P3YA 2G5BB 4Y7MA 2YHGA 5FHBH 4DZ8B 3MLTB 1ULVA 4O02L 5C0CA 1EAJA 1D5IH 5IQ9A 4NGHL 2APTA 4Y19B 2WANA 1WEJH 5EORH 4WCYH 5EUOA 2BVTA 1S8DB 2A6KA 1I9RL 3EJJX 3LS5L 5D7LA 2ZZUT 2JKXA 5GZNC 5FHAH 3L3JA 3WJLA 4KJPD 4HXAL 1CQYA 3VDCA 2E5EA 4BZ2L 4JFYB 5DUPL 3CZFB 3G6AB 1F00I 2A77H 4OLVH 2YPLE 5EU4A 1AO7A 4HG4K 5KG9B 4N8CH 4P57B 5KOVC 3FN0L 4YC2C 2WBKA 2P47B 5E8DH 3DGCR 3WSQL 5GZND 4D3CH 1SYSB 4L9LA 4F15C 2VZVA 3FONA 4ZG1A 1SHMA 3H2WA 5JW4N 3QH3A 1Q1JL 3DIFA 5TJWK 1I7RA 3PIQB 3PWJA 4XPFH 2QQLL 1A7RH 4U1NB 4OZIF 3EZJB 3B5TA 4G8GE 2CLVB 3S37H 4ETYA 4O2EA 1JZ8A 5DS8A 4X4MA 3UYRL 4NZTL 5H35B 3KXFB 5CP3A 4AENB 3DRQA 4FFVC 4MJIE 1FPTL 4UT6H 2Z31D 5B39A 4W70A 4MD4A 2VXTH 5EIVA 3HS0B 3B9VA 3M8OL 3MV9A 4Z76A 3IF1B 2DJSA 4NQCA 4X7TB 1YPZB 4NDMB 3RVXD 5FA4B 2F53D 3JTSB 2VB5A 1FFNA 4PJIB 2JJUA 4LSTH 3QCVH 3R06B 4PJIE 4UAOB 1R5WA 5BW7C 1HYSC 4PJAB 4TTDC 4WFFD 4Y2DD 3U2SA 3HUJF 4EI5C 3BZDA 4RQQB 2Q76A 2H3NB 2Y06L 3WNNA 1ZHNB 5GXBB 2JCCE 2WMPA 2X4UB 1CTNA 4G42A 1FE8H 1NGXB 3PDOA 1SY6A 3FRPA 1OP5K 1BD2A 1J7VR 1CD1B 4P49A 3F58L 4ZPTB 3VXQA 4GAJH 1R0AH 3IDXL 5FO8B 4Z77B 2NR6C 4J3UA 4C83A 5LGJB 5BOZG 5AEAA 1ERNA 4PJ8B 2EH8H 4RCAA 3T1FA 3QRGL 3ELAT 2DM2A 5MENA 5GSRA 1ZVSA 3VI3F 4RX4A 2FL5A 3QWRA 2YRZA 1R3HB 1XGTA 1J8HD 3PG2A 5E94B 5ACMA 4EBQL 4JFHD 3T8XA 4DZBB 3WNOA 3O6ML 2IAMD 2RB8A 4P57A 4NZRH 2J6EA 2B4CH 3GSOA 2VXSL 3I75B 4PJ7F 5J1SC 2DOCA 4PB9H 3NFNA 4KU1A 1SYSA 1P4LB 1DLHA 3ILQC 3BZEB 1FO0H 4HC1H 2F54B 3KPRE 4KQ3L 1UXWA 1FAIH 3LN5A 3MNZB 3CJJA 4EI5D 4KKCD 1AGFA 2PW1B 1GZPA 5MEPA 1OSPL 4HCRA 3H9SD 4F7PB 1HXYA 4PGCA 3C09B 3QXWA 5IMLA 5I8CA 2CLVA 4M43H 1A0QH 4FFZH 2HWZH 3CVIH 3P4LA 5H35A 4Y5YA 3ZE2F 4JREB 4QLRA 2N1KA 5JDSA 5BO1L 1RZJH 1A2YB 3AS0A 5FCSH 1A3LH 4MNGB 2K7QA 4CADA 3X13B 3E3QE 3BD5A 1XGPB 1UB5A 5B8CA 3QDMD 3TT1L 4RWYH 3IJHA 2WWMD 3ARED 1E4XI 3QIWA 1A8JH 4HK3J 1WZ1L 1FZMA 1N8ZB 4PYHA 1B0GB 1Q0XL 5EA0L 5FM4A 2NQCA 3SDDA 4R7NA 3LEXB 2ZOKA 5C0CD 1IT9H 1BAFL 4L4JA 1U92B 4Y5VA 5EH1A 1KPUB 2HJFB 1F4YL 4YZFE 5JHLL 1QR1B 3HMWL 4JRYA 2IPUK 3ZTNL 3IDNB 3OB0K 1TENA 2I24N 4D0BB 2VISA 2V5YA 1CXKA 2VLME 5CP3H 1MJ7H 1LO2L 5DJZA 1Q8MA 5IIEA 1CF8L 3LMJH 4F37K 4ZFOA 1RIUH 1OM3L 5IQ7H 5EORL 5EC2A 1I7ZA 2XZQL 4HLZH 1R3HA 1XGTB 2IEPA 3PNWB 4XBGB 1W72L 2NY4B 4IOFC 2CR6A 3DX9B 4CL7A 4HULB 2NY5C 2ERJC 4WENB 1C5DA 3WIHA 5C0IB 2AI0H 3P4NB 4JFOB 1P4LA 3P9WB 2CRYA 3IU4H 1BM3H 3NABL 5LCVH 1RJCA 2VKXA 3JWDL 3L3HB 1WBZA 2VO5A 2H2PC 4L8BA 2NY6B 1RJZB 4JQXA 4F37F 4Y16C 5IHUH 4PRID 3C08H 5T1KA 4ZS7H 2VH5L 3R4DA 4JDVB 4IIQA 4NFCA 5HDOA 4I13B 3QPXL 2BNQD 4RZCB 2D0HA 4IRJB 4UV4H 4BFEA 5IOPA 2F9BT 2A77L 4OLVL 4Y5YC 1QVOA 3V6OA 4X4XA 1N3NA 4O58H 5DK2B 3WEXA 4CMHB 43CAA 3THML 1NLBH 4MAYD 4YXLL 2IG2L 4JPWH 4QHMB 3S36H 3EHBD 3AREC 4AIZA 4HZAA 4AH2B 5C0BD 2BNRE 1XFPA 5EU7C 3RP1A 1FHGA 1TXKA 5GZOC 3EYUH 2DI7A 1GGTA 3FRUB 2V2XA 3HAEB 4WTZA 5K9QG 4O9HH 3CDYA 3GSNH 4U3HA 3ARBA 2IBZX 2DJ4A 2R69L 3GEWB 2FWOB 4WFGD 1PKQA 1UB6A 4FZEH 3PV6B 2GSGA 4ODXB 1BWWA 1YY8A 1J8HB 4AQOA 5M95B 1D5XB 4BH8B 4HIIA 3SY0B 2IAMC 4ODWB 5JXAH 1ADQA 3GSXB 3RPIB 5KSBA 1CFNB 1JZ3A 5ISZA 1G7MB 4QTIH 4I2XB 3BP5A 5T3ZD 2NYYC 5DJ6A 4XMPL 4U1LB 1RIVL 2M1KA 2WSKA 3BKCL 4BJLA 3FFDA 3RVVD 5GSVB 3MYJB 2R0ZL 1JNLH 1FNFA 1D9KD 5JHDB 3BWUC 4R0LB 4ZNEE 1E6OH 3H7BA 3LVEA 1RZKL 2AKRB 1G9MC 2RBLA 5CJOH 2WP3T 1CLOL 2EDTA 5FIEA 4GLRI 4Z9KB 4GRMB 1FCGA 5FV2A 4EI5A 3T0EB 2DQUL 3P4OB 2FATH 5A3IC 3K2MC 3G5XB 5FCUH 5I17A 3DO7A 1MVUA 1GAFH 3C9NB 4N1CA 4YHKL 1MCDA 4P4RA 3WS3A 1C8PA 1VADB 2ILLA 2JCCA 5DVOA 1F58H 1CICB 1E6JL 3ZKMD 1YMMA 3OTTA 5HHVL 4RZCA 3ARFA 1K4CB 3KPRB 2CD0A 3S5LG 1JI1A 3LRGA 1MQKL 1GYAA 3RIFK 4LP4A 1CR9H 3RPKA 2JB6B 5JDJA 3D2UA 2F5AL 4QHMA 1Q0YH 3UPRA 1TLKA 2KPNA 5EUOE 1E4WL 3NCYP 3WBDA 3V6OE 4E41B 4Y4FB 4P3DB 3L6FB 1T66C 2DQTH 4JFFD 1LEKA 2IANB 5E9DE 3S4SG 4ZDHA 5ICYB 1ZT7B 2EDWA 3F6IA 1DBJL 3TH2T 3QBTB 3ULUD 2BERA 3TBSA 4NT6A 5FK9B 4KRMB 5DJCB 1NAMA 1FNHA 2GJZA 1C08A 1YEEH 4DGIL 3NAAH 1Q38A 5BVJA 3HRZA 2EYRA 4IJ3B 2BP3A 2XXMB 5F1OB 2EC9T 2WBJA 3CUPA 5HGHA 3MLSH 5DD6B 4L9LB 3PP4L 4HKXB 1RZKH 4F7TA 1AQKH 1F6LL 1NEZB 1WWAX 5E4EC 1EH9A 2ED7A 4K23H 4M7LH 4LMQE 1KIQA 3VW3H 3C6LB 3C8DA 1N6QL 3O6FD 3KLHC 1U91A 1NH6A 4TSBH 4OTXL 2D9QB 3B9DA 4QGYA 4EVNB 3LV3A 5CSBA 3KVQA 3P9LB 4X7TA 1ZT1B 3BD3A 5D2NC 5DR5H 3MYZA 4YO0B 4P4RB 4P2CG 2W59A 1NGQL 1UGNA 4UDTA 4OZFB 4HS3A 1S9YB 1UZ6F 2R1XB 2ESVB 1W72H 1YMME 2YKLH 3TBYA 3QO0A 2EDXA 1YEHH 1RJYA 2X4PB 5KW9L 2C3GA 3VG9B 4XP6L 2PO6C 2FEEI 1LO0L 2OM5A 5AG9A 1P4BH 4NQXB 2B39A 5EBLB 1PJ9A 4PP1C 4AEHH 1X5FA 3VXSB 1HHKA 3K2UL 1R3KA 3FRPG 5JOFA 4BKLA 2ATKB 4PV8A 3GSVB 2EYTB 2K9UA 3ARBD 3HZKA 1EO8H 1PEZA 3NZ8B 3CVHL 3OG4B 3RVTD 4YHIB 4ZTPH 3VA6A 1T6WA 2V9QA 1WBYA 1MF2L 3IJYB 1YYMH 4JPKL 5HYJB 4R90L 3TZVD 1E4JA 3V5HA 3DXAB 4IRJD 5DURB 4LU5H 3P0GB 2Z8RA 3TA3A 4UDUB 3V79C 5CMAB 2D7PA 4LRIC 1GC1H 1QBML 4Y19A 1PEWA 3BHBA 3S88H 2Q7YA 5EUKB 5BO1H 1MY7A 4HUWA 1GZPB 5MEPB 1FLTX 3K7UA 4AK1A 2R23A 3QI9C 1NDGA 5I8CB 2P5WB 5HYQB 1D6VL 5TH2B 5JORB 3WMSA 3FO9B 2HVKB 5DVNA 1U8PA 4RISH 4UIKL 4Y5YB 4XMLL 1XR8A 2GTZA 4JY6A 3U9UA 2C1OA 3MUY1 5GISH 2VDOH 4GQ9H 4HJGB 3T4YA 2ITDA 2A6IB 2YUXA 3KYNB 5KSVB 4XNYH 3TLRA 4DFIA 2X5PA 2YD1A 3W9DA 2GAZB 3NGBC 3UBXB 3C2AL 5I1LA 3QXAB 3VFGH 5HHMD 2B4CL 4KMTH 3IJHB 5IVXA 3Q6FA 3TZVC 2EIZA 3O6MH 2BRQA 3RGVD 4PTUB 1WZ1H 3F12A 4FQLL 5I8EB 5SV4A 3VXUA 2IAND 3TT3H 5IFJA 2WNGA 1BQLL 5HPOA 5F7YC 1KCSL 3LSOA 3O0RH 3SDXE 3FHAA 1K6QL 4OZHF 2X4QB 5C0ND 3P4MB 2J5LB 3HZVB 2VC2L 3DARA 3SDYL 2DI8A 4N0RA 5CZVH 5J57B 4ZO7A 2UY6A 1A14H 1YEJH 4M7KH 5I2IB 4DCQA 5I1CH 2NY3B 1OT1A 1HINL 5FA4A 2XA8H 2RAMA 4G43A 4QY8B 4Y16D 1H8OA 4DGVH 4LMQI 3ZKND 4G9FD 5E6IB 2C1PA 2ZUXA 4YK4B 2WBJD 1N7ML 2AK4E 1ZS8A 3VRLF 2P46B 3C5JB 1B2WH 1T7WA 4RIRA 4YHNA 3DVGA 3TVMC 1EAPB 1EV2E 1M6OB 4ALAH 4OAWB 1UJTA 4ZS6C 2IJ0C 2MFNA 4QHNB 2DF3A 2BC4A 1RZIA 3O6FC 1J88A 1SJHA 1A21A 1A6AA 5HVWA 1JHTB 1OAXH 4WEMB 1CICC 3RFZC 1M7XA 3LS4H 5T1LA 3PJSB 3QAZB 1EIBA 3HMXA 3GI9L 4RRPG 4YHZL 1CQKA 2XV6B 1KIUA 1OSPH 4L1HA 4M6ML 1N64H 2P5EA 1RZFL 1OGAA 1WCBA 3BPNB 1S7UB 3KG5A 1FL3B 1ES0B 2XWBB 3UTTA 4G9DB 3T2NH 5HHMB 5HHME 2CSPA 3GSUA 1F2QA 3BEVB 2R0WL 5EBMA 1D5ZA 4BUHA 1I3RB 4D0CB 3FCTB 3KHOA 3ZDZE 4NO0A 1T2JA 5EBWB 5HHNA 2DWDA 4MLIA 2AS5M 2E27H 2VLMD 1YEIL 4OB5L 5AWNH 2P5WD 3QHTC 1CXFA 1A2YA 1M05A 4Z7VB 1ADQH 3ZT6A 5I0ZA 5FHBL 3GB7B 3X13A 3MX0A 2AQ3A 1VFOA 2Z31B 3WFBH 3BPCA 2MCG1 1LDSA 4U6VL 3X12B 1U8IB 3U0TA 2NX5A 5JPMB 1KB5L 5JHDA 4OLYL 3L5WA 1B0GA 1X9QA 4HHAB 3TA3D 5JXEC 2ADIB 1IGML 3LS4L 3CK0L 4M6NH 1NAKL 1JPST 3CDGA 4QTHA 4LPYA 3KPMA 4G6KH 3F5WB 1AE6H 3O3EB 1DDHB 1FVCA 1HHJA 3P4OA 4YH6A 3LQAH 3REVA 4DVBB 4KAQH 2HJFA 3BRGC 3V6BR 1EJ6A 2B1HL 1MFDH 3RWJB 1MI5E 1XF4A 4MCYB 4WO4C 5DEFB 3EIFA 4YPGA 4MA3B 4YZFF 3GMOB 4AL8H 5FGSA 2R56H 4LU5L 1U8HB 4H0IA 3WYRA 1KUMA 4K7FA 3SDAB 1A5FH 5I8KH 2VDOL 2I07B 4Z95H 2W1NA 2X7LA 4PRAA 3OKEB 3TWCL 5F7EL 5ACZB 2IPKA 3BWAA 3O6FB 1F13A 3CFKB 1KCVL 2ZUWA 4KWUA 1Q1JH 1U8KB 3DMMD 4KMQA 2NZ9C 3HR5B 5CEZE 2HT4D 3WHXB 3CMOH 5DTFA 4FA8A 1N6UA 1ZKAA 4S1SH 2GJ6E 3HC0B 2IANA 3ETBF 2HT2D 5D7SH 5B39G 3FFCE 2XTJC 43C9A 5AD0B 3D39E 1RURH 2YRLA 3MZGB 3IXTA 3DHMA 3AXLB 1QFWL 4GAYB 4OF3A 1OW0A 1UQSA 4NRYB 5BZWB 4HK0B 1LE5A 3OKMA 1GIGH 2KBGA 1VESA 5F1NA 5DJ0A 4X4XB 4JZNA 3KDMB 1MCOH 2X89A 5EO1B 3VXME 1RFDH 3QUXB 4JM2F 3K4ZA 1NAML 3U6RA 1CN4A 1UWXH 5INDB 5BJTA 1YC8A 5D6DC 1PG7X 1MFCL 1NCCH 3D0VB 3GMQB 1FNSL 3RAJH 2EICA 2X4NA 3ARBB 1CXIA 3IGAA 4R4NC 3PQYE 4QRTB 1MJ8L 1U6AL 3AREB 1Y18B 3LB6D 4FTVD 1SEQL 4X6EB 5FUCC 1CGYA 1QSED 4LVHC 1DL7L 5IMKB 4OGYH 2OK0L 1A6VH 2E6QA 1KENL 3P73A 3KLSA 5L2KE 3TF7C 1DBAH 4ODWA 3VXUE 4UBDC 1J1PL 4PBXA 5GS1C 3PHOA 1YEFH 1TZGH 4LRNL 4I0PD 5DYOA 4QRRE 1VACB 2VL4A 4M7JL 4HFWB 4MJ5A 4MS8C 4PJEF 3T0ED 4A6YH 3PABA 4CJ0A 2ADGB 5E2UL 2CIIB 4PJGA 2PYED 1P7QB 4JHAH 2NXYC 4PJDB 1KC5H 2LQRA 5EBLA 4Y5VC 4QRSA 4X6BB 3E2HC 3CDFA 1TJHH 1WF5A 4ONGL 3EGSA 5F89A 4D9LH 3QO1B 4C58B 3O8XC 5D96C 3RWHB 3MLUL 3NZ8A 3HC4H 4DKFH 1JWSA 3DNKA 4HUUB 4U3CA 2A9NH 3C9NA 4LCIH 3BKMH 4M48H 4PR5A 3OAYK 4MQXD 1MHEB 4N90D 1SJEA 5E5RB 4BQ6A 5GRJL 1LO0H 3EBAA 2YN5A 5I15L 3C8KB 5J11C 4RGNE 2OZ4L 5BZWA 4P23D 3VRIA 3I6KA 3Q3GB 1DFBH 4HZLB 2VOTA 4OM0L 3UX9B 1JBJA 1FZKB 3K8KA 1FGNL 3TP4A 2R1WA 4R4ND 4UMGA 4M6AA 2VUYA 3HE7B 3C5ZB 3BE1H 5IJVA 3QUXA 4F33A 5LGHL 2OBGA 1YQ2A 3G6DH 3NIGF 3NACH 2A6DB 2PTVA 3SEPA 1T7ZA 5JW4R 1WIUA 1HIMH 4FXGB 4XBEH 4YDVA 3UTSD 3QUMA 1JN6B 4FQIH 4KJQD 5EZJB 2YC1B 4GXUN 2Z92A 1NMBH 1ZXQA 5CJXA 35C8H 3BPNC 4HUMB 3K2UH 1FFQA 4HUXA 5HPMB 1KIRB 4MAUH 3S3JA 3PQYA 1QFHA 3TCLB 2HH0L 4NHUA 2Q8BH 4MMXC 3LKQA 4JM4H 1PX3A 2J6EH 4K3HA 3GO1L 4JRYE 4XNUL 3DVNA 1T1XA 5D1XD 1IRAY 4OGXH 5I19H 4YHKH 4BFGA 4NKMA 1A7BA 5GHWH 4JFXB 4NQCE 4X7DC 3FTGA 1OTSC 3VXNA 5B38B 5GJSL 1D5BA 4K8RD 5CSGA 2D3VA 2PYEB 4FMFA 5BV7B 4HKJB 1E27B 2UY7A 3NABH 4XPAH 4JN2A 5IMMB 1U8LB 3CNKA 1EZVY 1W0WB 4QRRD 3FB6B 1ZVYA 4MB4A 1IBGH 5EOTA 5J13B 2VWEC 3GSNB 4XPTH 4ZUWB 1UWGH 1WAAE 1T1YA 1UCTA 4Y4KA 2XNAB 3STZA 3L3GB 3O4LE 2XZQH 1VFBB 2IQAB 4O2EB 5B3JE 1OPGL 1HILB 4M43L 5TDPA 1P53A 2ZG3A 4CVXA 3EYSL 1PD6A 5JOEA 1UM5L 1NCBL 1JIBA 1DVFA 1G9ML 3KJ4C 2FYYB 3N50A 3VRIB 3LN4B 4KAQL 2X4PA 2GY5A 4TYUA 3SE3A 1YPZA 1KB5B 1NMAH 4Q6IB 5GS2D 3BIBX 1S5IL 4U2YA 3FFCB 4KK6D 1E28B 1KJ3H 5I74B 3T0BA 3NCCB 5EFIB 3VXMD 2ADJA 4N1EA 2QKIB 3W81A 1ZHLB 2VXUL 1I8IB 3D18A 2F8XC 5CZXD 2P48B 2CK2A 5IFHL 4YDVB 3GIVB 2ENYA 1WQVT 2B8OT 1FNAA 3TJHD 1ZHNA 1QO3B 4XNMA 2Z92B 3B9AA 4PJBE 2HJLB 3TCXA 4NO3B 3NFSL 4GAFB 3MRHB 1IARB 2G9HA 2IH1B 3O45B 3HC3H 4ZD3H 3AC0A 2CDFB 2JELH 1BOYA 1HHGB 4MQTB 5KVGL 1G7JB 2VLLB 1A3LL 3TIDA 4P5TD 1RIVH 5ETUA 1OP5H 1QA9B 2GJ6D 2JJVA 3KPOB 3LCYA 1D5MA 4PRHE 3T3ME 3ECBB 3Q2CA 1EEYB 2CDGA 3MGOA 4WTXA 5ILTH 4BQ8A 2BMKB 5L8LB 1JNJA 3I50H 3GM0A 4HJ0C 4IOSD 1MNUL 1Z9OA 2BNQB 4G9DA 2DBJA 5FAAA 1FLRL 5L0QC 1G7IB 3L3OA 3OZ9H 4HXBL 5D7IE 3TPUB 3PWPE 4HWBA 5AAMA 2AK4A 2NY6D 3RNQA 2Z9TA 1NDGB 3FB7B 5E6YA 4FG6D 2RFXA 2CGRH 3UZQA 2FSEA 8FABA 3NTCH 3TN0B 5L2KB 1ZEAL 4XP4H 4YC2B 1DUZB 4LGRB 3BP4B 4LSQL 1A7NH 3OQ3B 3EZ8A 3GSNA 4Z7NF 1I1AC 1F42A 1TVBB 2XPGB 4PGCB 4OBSA 4Z76B 2XKSA 1CDBA 3D85B 3VDAA 3ZE2E 1X5GA 3JV4B 4Z5RB 1RZJL 2CDEA 3F62A 3IDIA 4OUUB 4XH2A 1MCEA 1FFNB 3TFKC 4CRPA 1WAAA 4UQ2B 2FLBT 2SEBA 3GMNB 5ESQB 4NN7B 5JXEA 5MHSE 5T33L 4XCYA 4YDLC 4ZUTA 5GS0H 1A02N 3LN4A 3PGFH 2VLKE 3O3DA 1QSEE 2BXYA 1LD9A 5IBTL 3HI1B 5I1JL 4KVCL 1FVCB 1HHJB 4KKNA 5AUMA 4HPOH 1JGDB 4X80L 1NGWA 5C0RH 5DFVD 1ZTXL 5EU6B 5TDNA 3V95A 1PKQE 2Q8AL 2EYSB 3JZ7A 1MVFA 3O4OC 1MPAL 3CZJA 4X6DF 4ERSL 5DGRA 2X6MA 5LGJA 2J4WL 4FQ2H 1H15A 3HNVH 1U41A 4PY8J 5EZOL 5E70A 3INUH 3V6FB 4K7FB 4NQSB 4GBXD 3NFPB 1AGDA 2XWTB 3QXVA 3KXFD 2X41A 2KDGA 4YXLH 1G7JA 4X4YB 1XEDA 2P42B 4P9HH 5C71A 2PR4H 3MUJA 3NCFB 3TIEB 1CFTA 3K4DA 3MGTA 4MWFA 4N9GA 4R8WL 5E1AB 2Y5EA 4GQ9L 4F9LA 4BSJA 3IDXH 4LSQH 5F1IA 3MUHL 1MUJA 5BOPA 4YHNB 1BFTA 2OMBA 1JZ4A 4XP4L 1ONQA 4KPHL 5F9JB 5JQ6H 1EGJA 1X5ZA 4K94L 1J18A 1T83C 4KK9C 4OAWA 1CVRA 4OZHB 1D9KC 1FC2D 2AK1H 3VXSE 2VWEE 2BC4B 4XWGH 3WLWC 1GJIA 2Y6SC 3QNXB 5BRZD 3UTSE 1UQSB 4HS8L 4NRYA 2DQCL 1PLGL 1OTSD 5HHXL 4JZOA 1F6AA 2NXZD 1MNUH 3EO9L 1V5JA 5F72S 2BOCA 1G7LB 1INQB 5HVHC 2V17L 4YWGL 3QRGH 2VDML 5LAXA 1NC2D 3B9KC 5BQ7B 4W4OC 3SBWC 1ZE3C 2P5EB 2X2YA 1TFHA 5ANME 1WICA 5HVFB 1AXTL 1B0RB 3GHBL 2F5BH 1IGFH 2HT3D 4IBLT 3P77B 4ZAKC 3DOSA 1R24A 5KN5B 2EE9A 5FECB 3JSSA 1UCBH 3QEHA 4IEFB 3VFRA 3QDGD 1SBBA 3NIFE 1LHZA 5CINH 1SMAA 2HKFH 4WCYL 1RK1B 4FQPA 5SWZE 4Y8DC 3FQNA 3I6LE 2VDLL 4B41A 1OCWH 1NLDH 4OCSH 5A2IH 5KVFL 1AGBA 2APXA 1U93A 4IM8A 5DJYB 4PJEB 4D3CL 2AXJA 2HG5A 4L8DA 1UADC 4LHUG 4LCYA 4R90H 1I85C 1YEGL 2ZKHL 4GAGH 4PJIF 4HKZA 1WFUA 4OCNC 4W6WB 5DYOB 1H15B 4F58L 2BSTA 3JUYA 32C2B 4NQSA 3NFPA 2Z31A 1J87A 5EZLB 1CIDA 1FH5L 3F7VA 3IU3B 2Z4QB 4FNLH 3O4LB 4H25A 2Y07L 4PLJC 1SMOA 1JMXA 1A6PA 4HXAH 1P84J 3D48R 4S1QH 5GGTH 1Y6NR 4XZUB 4M5ZL 4RGNC 3O2VL 4P46B 4XAWH 1T3FA 2QQKL 3NFSH 4ZD3L 2AK4D 5HGGS 2CK0L 4NQED 5GSVA 4WU7B 3SE3C 2AJVL 3OKKA 4A2MA 5EO0B 1B6DA 2GUOB 1KEMH 3IVKB 2VIRB 3ULVH 1YQVH 3EDEA 3QNZB 1OLZA 3UO1L 5J56B 1XF2B 1I8MB 5H37G 3G5XA 4JY5H 3FN9A 3MLSL 1DFBL 4U1MA 4XCFH 4PRAB 2N7AA 1Q9KA 2AK1L 2NNAA 4I0CC 4KI5C 2OZ4H 5IVOA 5D7JB 2A9MH 2MMXA 4F33B 1HSBA 4RX4D 1KLUA 2NY2D 2YD6A 5I16B 4G80A 1Z9MA 4YBHA 1PG7L 2R2HB 5DI8A 2AERT 2EE6A 4FXGA 1BWMA 3QDGB 4YX2L 4GUPA 4PJCF 1OSZB 1KLGB 4G8EB 3P77A 2YC1A 2V2XB 1JK8A 3QFJA 3ET9F 4OF8A 1HZHH 5JHDE 3VFUB 4AEIL 5HPMA 4ONGH 4JG1H 4NBZB 1AC0A 3PWLA 4DW2L 4G6AC 4QF1A 2CGRL 5KSBE 3QUYA 2HA1A 4LLMA 3HNVL 5JIIA 1IAIM 4JG0L 2A74A 2GSIB 5JUEL 4MJIB 4K8RL 1WFOA 5D1XB 1LMKA 2FDBP 2WINB 4GW4A 4RDQF 2X70A 1CDCA 4JFXA 2VSDA 5IB4B 3QUKB 1WFTA 2CKBB 1FG2A 5JOPE 3WUZA 3ARUA 5HI4C 1G9MH 2FEEL 4GXVH 3ZDYF 3BJLA 3U9PL 4FQ1L 4Y5XA 4KI5E 4U6TA 5HYIA 3LQAC 3O4LA 1W72A 5LQBH 3WNPA 1OPGH 2X4NB 2H6PB 1AD0B 3ZHDA 1YJDC 3AREA 3QIWD 1BP3B 4PG2A 4ZTPL 1UWGL 1AY1H 2XNAA 1T3FB 3U30C 4FQCH 1KCKA 1M7DA 5F7KC 3VFPB 4S10A 5DHYB 3V5KB 1IBGL 1I8LC 3S6CA 3V4UH 1KJ3L 2VIRA 4DEPC 2ZG1A 1G9NL 4U49A 3ULSB 2H26B 2OJZL 4CU7A 3WSQH 3JWNC 2FYYA 2FECI 3GGWB 2NY1D 4PRDA 1KTKE 1A4JA 1N59A 4YQXL 4NSKA 1KENH 1Q9KB 2NNAB 2QL1A 3PWUB 1FN4B 4YHPB 4HH9A 2C7UB 3TBYB 4JFDD 3AS1A 3QDGA 5FDWB 5E7BA 3BKCH 5D1QD 1MRFL 3RY5A 2XXCB 4K8RH 1BGXL 2NY7H 1AGCA 2EO1A 1HHIB 1KG0A 3VGFA 1HYSD 4JCMA 4QHLA 1KN4L 4L1DA 4UILH 3DWTA 4IDJH 4EN3A 1QA9A 1K8IA 1HIML 4Q58C 3T65A 1JYWA 1FZJB 3FOMA 3MXVH 2EYRB 5GGVH 4LBEB 2FZ3B 3K8LA 1XCTA 4YFDB 1FH5H 2F58L 3VCLA 2BNQA 4PJXF 4ISVB 5C2UB 1CDYA 1R5VB 1CLZL 2IQ9L 2JLLA 2PTUA 3NCMA 4LLDA 4O4YH 1KBGH 4RMSA 1I7TB 3HKFA 1Z3GH 3BQUD 3IETA 4PGBB 4JANB 5GRYA 5IB4A 5ABDE 1NCTA 4PRPD 5IB5B 1K4DB 4MAYA 5DJAA 4S1DC 4JM2A 1EA9C 2ZKHH 5EZJA 4Y88A 3LKSA 2D31A 4JVWA 5SWZA 3MRLA 1OAYH 1NLDL 2DN7A 2AABL 4BSVA 1JHKH 5E03A 5FEBA 1JGEB 4U1KA 4U6VH 5F70A 3UZVB 4ZYKA 4HWEL 4OF0A 3V5KA 3FMGL 1N26A 4F7CB 2EDRA 3OJDA 1XR8B 2GTZB 2H9GB 4W81A 2R1XA 3MLXL 5EU5B 3T0AA 3T4YB 1QSZA 3IAPA 1RZ7H 1BGXH 2NY7L 3GMLA 2PXYA 1RJYB 3IT8D 4WJ5B 1KTRL 2VL5A 4FFYL 1S78D 1OD7A 3QUZC 2W60A 2DTML 1TTFA 3GIZH 4WO4B 3VXOB 1F90L 2DQIH 4KZEH 5HDLA 5HYJD 1R5WB 4H1LH 4OGXL 3AY4A 4PJGF 1MELA 3WL9A 4NFBA 3IXAA 3U4EA 5KJRH 4XNUH 3A6BH 5TQ0H 2VE6A 2ZG2A 3F12B 2Q76B 4RGOL 5FDWA 1INEH 3MXWH 1BVLA 1YQVL 4U1IA 1LVEA 5IFJB 4BUGA 3V6FA 1J0JA 1EMTL 1KN2L 1HI6A 1MCFA 5B8CC 5FYKH 5BS0B 4NNXA 4E0RB 1QQDA 4KJYB 3REWA 1N6VA 4X9BA 5B22A 5D2LF 3BO8A 2YS4A 1I9JL 3O3UN 3MRJA 4RNRA 4R8WH 3BGFC 1KJ2H 4L4TB 5DMJB 1PQZA 4PB0L 4P9HL 2FL5B 5DD3H 1I4FA 1R3LB 1UJ3A 2BSED 4HGKC 2KZWA 2OSLB 1X5XA 5E4IA 1J86A 4POZD 1NQBA 4GG6E 2YD9A 5EA0H 4C57C 3H0TA 3VGGA 4DZBA 5I66B 4HUWB 2OK0H 4BK5A 1KYOK 1EFXD 2BFVL 3V6OC 1U58B 1U8NA 4JKWA 4ELKA 5KS9F 5IT2H 1ZLVH 1FO0A 3CX5K 4HC1A 3EYQD 4RMTA 3QCTH 3MRNA 1AGFB 4NJ9H 5JUEH 4TNVF 5FM5M 2R9HD 2V9TA 5DO2D 3PP3K 2ITCA 1J10A 4KK8C 4RAUA 4MB5A 3RHWK 5BQ7A 4NUGH 3H9HA 1ORQA 3JTTA 1CYGA 1L6ZA 1HHHB 2XQYK 1QRND 3HNSL 4DW2H 1KFAH 1ORSA 4NC1E 3UP1A 2CPCA 3HE6A 1IKNC 4OF6A 1H3UA 2QHRL 2PW2B 4P9MH 4Y4FC 4U3XA 2X09A 3T2PA 5D2LA 1SYVA 3GMPB 5DD5L 3BKYH 1UWXK 3JV6A 1WISA 3BDYH 3TT3L 3P0YL 4JFDA 3V8OA 1A7PL 4RDQG 5BXFB 5D1QA 2DQEL 5E9DD 5CBAB 3MMEB 1R3IH 3EFFA 1G7PA 3HE6C 4PGZA 3C6SA 2Y36H 3MRPB 3DIFB 3MRFA 3W39B 1OWRM 4U1JA 2E7LA 3TH3T 3OGOE 1EHLH 2VLKA 2V2WA 1YDPA 2GITB 4GKZB 1O7SA 5KSUA 3F7VB 4PP2A 4P5MB 4Z7VA 2IANE 3BGMA 4YDKH 3GNML 3DVIA 3RX7A 5GGTA 5HGDB 3DV6B 4H8WH 1PG7W 4K07A 1CFQB 4MQ7B 2VDPH 2DQDL 4MHHG 4DGYL 5BV7H 1Q94B 1QFOA 2NX5B 1KXQE 2YZ8A 5K33A 5L8KB 3G5VB 4LF3A 1U8OA 4TULL 4LDEB 4WEBH 4E41E 3L7FB 4ZFGL 4NUJB 3VFNA 2B5IC 5FUCE 1AP2B 4OGZA 2I9LA 1IVLA 1JPGA 1BD2B 1RURL 1S7TB 1YNLL 5FYKU 3OKOA 2LFGA 4XI5C 1OGAE 4FXKA 4F7MB 4H5SB 3HMXH 1AO7E 5CP7B 1NMCC 4XP1L 5I76B 2WV3A 3K3QA 1A6WH 4WU5A 3BPOC 3BEWA 4Z8FH 4IRJA 1I1AD 5DVMA 1IC4L 1QRNB 2BHZA 2BRRH 4LASL 5B3NA 3CVHH 1IE5A 1CLCA 5KVMC 2CR3A 3FHQA 5F9WB 4K3EL 1MIEH 1AKJD 4H0GA 3UTZA 3VFMB 2EIEA 4X5XB 2WQ8A 4YAQB 1MOEA 4CBPA 5DRXA 3JBG7 1DN0B 1T4KA 1S5HA 4ONFL 4POUB 3BW9A 1CVSC 3QNYB 3X3FH 3I9GL 1CDJA 1CFSA 3D87B 1IKNA 1BVZA 3T2NL 3HE7D 3KXFE 4PRNB 2FWOA 4YJZL 1CICD 2X4TA 2DQHH 4JFDE 3EYVA 4LSPL 5GGUA 5FHAL 4WGVB 1UH4A 3WFCL 3B9EA 5T5FH 2VABB 2WBWB 4YFLI 5KBNC 1R5IB 3UEZA 4WEBL 3WJJC 3VE0A 2YEZB 5D7KE 3FQNB 4YFEA 3FQRA 4CVWA 3UC0L 5I73C 4JDZA 1UB5B 3O3BA 4QOKE 3RGVA 3D0VA 2XWJA 3REVB 3ZTJG 4MVBC 3MOBH 3FFDB 3KPNA 3WIIH 2EEAA 1T89A 3SDXA 1G9NC 3LIZH 4LVNC 3HPJA 4YHYC 5IESL 4YDKL 4L8CA 1EEZB 3GRWL 4GRMA 4DFHA 3K0WA 1PAMA 4MXVE 3X3GH 3B5HA 5B38G 3VRLE 2DQFB 2QQNH 3OKEA 3MC0A 4F7MA 4LNVA 5CUSL 1RSFA 5FYLD 1MRDH 4V2CB 1EHXA 3T2OA 1JFQH 4HS6B 4HH9B 5A3ID 1KELL 4K94C 1HNGA 3HE6D 4YXKH 5I75B 4P46C 1QSEB 4E5XB 2OS7A 3G6JE 1AJ7H 2LTQC 3M45A 2FIRT 3MV8A 1T1ZB 1BZ7A 3A6CH 1CD8A 3RVVC 3IVKA 1T83A 4EN3B 2NCMA 5DLMH 1KFAL 5D1ZA 4XPTL 3OMZA 2QSQA 1MCLA 3PGDB 4HH8A 2NY4D 4F9LC 4LOUC 1YN7A 4FQXC 1K85A 1FIGL 2WUBL 4JKPH 3VCLB 5D4QA 3DPBA 4WEUD 3VFVA 2YKLL 1WBXB 3MCKA 3RBGA 5JQHC 1JYVA 3BDYL 4U6YB 4LCCA 1OAUH 3C8KA 4I3RL 4JANA 1ZTXH 5J11B 1Z2KA 1OF2A 4QGTA 5F88B 5DXWA 3VI3E 3I6KB 5ESVB 3O9WA 4JO2L 3GSWB 2Y72A 3ZDZF 1NSNH 1IAMA 3GJFH 4DWHA 3V4VL 2NY0C 4Z7UB 1HINH 3V7MA 4PJDF 4HMDA 3O6KL 1EO8L 1MSPA 3ARTA 3JUZA 4LNRB 2D7MA 1MFEL 2AEWA 3D5OF 4C56E 4Y8AA 3B9KB 3RWGB 2XTJE 4CMMB 4ZXBC 2V9RA 3SDXB 2ZNWA 1QFUL 2VLRB 3KLDA 1S9KC 3GMMA 4HGMA 3SCMB 5CJBA 3GKWL 4Y1AB 4NP4H 1D6EA 5J6GB 1L7IH 1R3JB 2WQRA 2CIIA 4PJGB 1E4KA 2BVPB 4WI8A 1TJIH 1S3KL 1FFRA 3CU1A 4P5KA 3WNKA 1NANI 1J0IA 4BFIA 3B2VH 4YUEL 1C5BH 2C3WA 4DQOL 1B6UA 1P9MA 3FT2A 1AFVH 1T04A 3A6BL 3HAEG 5F6HJ 2DLFL 4F2MA 3BD4A 1NKOA 3I3EA 5AAWA 4NKIL 2G2RA 1AKJA 4UU9B 5ADPL 5IHLB 3VG0H 5DQJB 3BKML 4M48L 4F3FB 2A0LD 1NL0H 3O81A 3RDTD 1HH6A 1A6ZB 1NBYA 3QDJA 1MCKA 1IGIL 5C0EB 25C8H 4MD4B 1U6AH 1RJLB 3HC3L 3DUUB 1G7QA 1XT5A 3G5ZB 1E4XL 1M71B 4M1CD 2R1WB 1WC7B 3C60C 4KC3B 1UM4L 5TDPB 2QADD 4MD0B 4YIQA 3VFVB 1JNNL 5GGSB 4YHPA 1HCFX 4G7VL 3L3KB 4XT1C 3S97C 3EYFA 3D39A 5GGVY 3SE4C 1PYWA 1K4CA 3KPRA 4OM0H 4RRPA 4ZUUA 5A43C 4JRXA 2VAAA 1HNFA 4ENED 5HI3C 1K2DA 2JB6A 2KZ1B 1KTDB 5K59E 4X6CB 3WKMH 3BQUB 3FT3B 3FO1A 4NCC1 3U7YH 3S36X 5T3ZE 3QIBC 4Q6YA 1H3GA 5CEYA 1N6QH 3C5ZC 2Z35A 1OP3H 4JPWL 3S36L 4PJHE 2R23B 1XGYL 3LRSA 5IESH 3ARGB 1S9XA 5GIRB 4NQCD 4HDIA 5JORA 1RI8A 4I77L 1U8QB 2UV3A 4F80A 2X9XA 3KJ6L 2LE9A 3KPSA 3P11H 1LWRA 2BHUA 3E3QC 4ISVA 4NM8L 1OTUC 3KPQA 4ZUVB 2AJ3A 3LKPB 3S3PA 3T8XB 5L8JB 3RZCD 2CUHA 3B6SA 3T3PF 1T7XA 5ADPH 1V3LA 1PFCA 4JJHA 4Z6AT 4JY4A 5T5FL 1NEZG 3FB6A 5GS0D 4JFDB 1T80A 4F7TB 1G6RA 4Y4HB 3MMEA 3ULVL 5I1EH 3RNQB 3MV8D 4PD4K 4RWYL 5ALBL 3KPPB 2DLHA 4L9DA 2A83B 1JGVH 4KRPB 4H26B 5A1AA 2J6EL 1BZ9A 4ZO6A 3BX7C 4BQBA 5D7LE 4OSUL 2NLJB 2XN9B 4MAUL 3LV3B 3WS6C 1IC5L 3NCJL 4WJ5A 5IM7B 5I2IA 3A6CL 4YO0A 2ZUSA 5B8CB 5C09E 1J8HE 4LLQA 2VLRD 3D25B 3QEUB 1P7KA 4ZNCD 3QEGH 3QIWB 3O9WD 4ODUB 2HP4A 3RWCB 3WL9B 4P3CL 3VDBA 3SDCD 1KV3A 3SDDB 4JFQA 7CGTA 3N9GL 5I8OL 1MCOL 1LEGB 4U4BA 4DGIH 3C5JA 1KXVC 1DR9A 5ESAB 1YEIH 3OX8A 5EOQH 3IFPB 3ME0A 1VGKB 1XCQA 3REWB 4QHNA 2ENSA 4TSAL 3RUGE 1WSST 4PRHA 2IC2A 1D5MB 4XXDB 3MRDA 4XWOD 1JHTA 5DMGD 1NBVH 3B5GA 1P5UA 4M7ZC 3T0EE 4I3GA 2FCBA 2ZCLL 5BVPL 1AXTH 1TIUA 4P2OD 2MKLC 3EYQC 2OSLA 2O5YH 3FAXA 1QSFA 2FB4H 4M3JA 2FBOJ 4HIXH 4Z8FL 1FBIL 3L95A 3QPXH 3SDDD 3DJ9A 5DHVB 4X9FA 3QIBD 1XGRA 4D8PA 5HHVH 4YXKL 2OTUB 5I1AB 1L0XA 5TE4H 5A2FA 1RZGA 3IYLW 2C5DC 3SGEI 3QEQA 1ZHBA 1T22A 3KWWB 3FONB 1OAUL 4JRYD 4XWGL 4KVNH 5HD8C 4I4WB 3QQNA 1I3RA 4D0CA 3PDGA 3QCVL 2CIKA 3EYVB 2M2DA 2D9CA 3RDTA 3WNLA 5HHNB 1KB9J 1IAOB 3GRWH 1DJSA 1JPSH 1KCRH 2ORBH 2Q86B 3N85H 3GKWH 3WEXB 3U9UB 5ESQA 3UJIL 3GK8H 1RUKH 1QHOA 1I8LA 2VDKL 1RV6X 2DKSA 4XNYL 3QT2A 5C9JB 2ADFL 1TQCB 4J3SA 3ZKXC 2RQ8A 3FQRB 5IHZA 5L7XH 1FCCA 5F6IB 1I1AB 3QDHA 4DGVL 4K3EH 3F58H 1RY7B 3QFJE 5T1MB 2IPUG 1JUFB 4L3CB 1TCMA 5SWQB 2NXZB 1R24B 2AJSH 2QQKH 3WLBB 3KPRD 12E8H 1BF2A 3QQ4B 3G04A 4LVOC 1JF1A 4LLVA 4ORZC 5DUML 5SX5H 1P4IH 2HN7A 1G6RH 4PRIA 4Z95L 1WFNA 3ZHLA 4E42B 2X4UA 2GSGB 4HIEA 1GGCL 4KI5F 1NGPL 5AYQA 4R26L 5I9QC 4OT1L 5L88H 2FLRT 1SEBA 1ZA6A 4AIXA 1NFDF 3KPLA 5D6DA 4Y4KD 4OQTL 5TPWL 1KULA 3MA7B 3BSZL 4KQ4H 5IW6A 4OLZH 5A2KH 3BMVA 1FSKB 2EDEA 4K9EH 4MA3A 3IJSA 4NQDB 4MWFB 4N9GB 3KPSD 1WIOA 2LU3A 4OKVA 3W11C 1BIIA 1K5NA 1QZ1A 4I2XA 1K8DA 1UKSA 2BSTB 2XTLA 4NWTH 3RL2A 5C0BA 3RZCA 2DL2A 1RZFH 1NFIA 1G9EA 4JO4L 2OTPA 3VWKC 1W0VB 5F3BA 4W68A 3OJMB 4N9OB 3IFNL 5D6CB 4H0HB 4FFZL 4P2RB 2B2XH 5GGRA 5C07D 1A0QL 4PJHB 4JO1L 4CN4A 5CD3A 3VD4A 1DBML 3MJ7B 5DHXB 3RVUD 5D5MA 1MEXH 4WFFE 1AXSB 1KGCE 2BOCB 1ZHBB 3BGFB 4LDOB 2J7LA 4AEHL 4FRWA 2GJJA 5EPMB 2AEIT 5EO0A 4R4BA 4XP6H 1NCAH 1G1CA 3AXLA 2V17H 3BN9C 5D7IF 2OMNA 3KLAA 1ZT4B 3CGTA 4TOYH 5KJRL 4WUUE 1OB1B 3FB5A 4DUXA 2YA0A 1MCIA 3VFOA 4APQB 1IFHL 4PRBA 3PF2A 4EZMA 1KCUH 1BEYL 1FORH 4HD9A 3EJYC 3K4AA 3U6RB 3UPRB 1AC6A 1HOCA 4MQSB 3W5MA 4Z7NE 3G5YA 2JF1A 5I1GL 3SDCA 3VGAC 1YEJL 3CSYA 4E41D 5DJYA 5EOCJ 4CVUA 5CBEA 4OIIH 4UT9H 1NCWL 2I26N 1XH3B 2YUVA 5KSBF 3SN6N 1CFSB 4LCYB 1FYTE 5FUZL 2ZSVB 5IB1A 3ZDXE 2N7BA 2ZOKB 1Q9LA 1N0XH 4M7LL 4Y1AD 2VXUH 3SCMA 2FR4A 1ND0A 5ITFB 4LLUA 4HIHB 1BQLH 1U36A 1G7HB 1SEBB 3RX5A 3MRQB 4UNVA 3P73B 1YN6B 2HJKB 3WJLC 2XKUA 4U6HB 2EXYC 1B90A 5C3LD 2R4SL 1WAAF 1BHGA 4HKXA 2WINA 4GW4B 2YPKB 4TUOB 4OKVB 1IEAA 5EOQL 2CMRH 3PABB 1A3QA 4P46A 1MRCH 5JXED 1B2WL 5SV3A 5DVLA 3TN0C 2XWJB 3B8SA 1Q9OA 2DIAA 2IMMA 4JQIL 3X12A 3ULVD 5J4MA 1YYML 4JPKH 4KFZC 2HLAA 4UQ3A 3H42L 2EXWD 1A22B 5HSFA 1TITA 2ZNXA 5C6WH 2ZCHH 3HHRB 2IFFH 3P4NA 2HFTA 1A9BA 1CG9A 3IFLL 2GFBA 1CD9B 2B1AH 4GXUM 2J5LC 3T0WA 3EOTH 1JWSB 1TTGA 4MXQD 4RFNC 4PFEA 1ZT1A 5BVPH 3B3IB 2DQFA 3CH1B 4YPGB 4ZUSB 3O0RL 1U3HA 4L3ED 1X7QB 5ID1B 1QKZH 2XIDA 3IDUA 4JFEE 3D39B 4JGUA 4X0KB 5D1ZC 3Q3GA 2I60L 4JN1L 1LK3H 1XGUA 1L0QA 3MLRL 1N2RA 2F74B 3O6FA 4DZ8A 3VFUA 3GIZL 3DV4A 3HFMH 4AH2A 1NCNA 2BY2A 5EUOB 3RZWA 3SDAD 3UTQB 2EZ0D 2CRZA 3HE7C 1CGVA 1QYGL 1CXLA 5FM8A 1KN4H 3PGDA 3SKMA 5IR1A 1VPOH 3GNMH 2MJWA 4FQXB 4O02H 1NJ9A 2DLGA 4LKXB 3ARPA 2R4RL 3WIFA 2HRPL 4XMPH 5EU4B 1DBBH 1AO7B 1ND0B 5IW1B 4YFLF 4I77H 4TSCL 3NCEB 1QD0A 2O5YL 3X14B 1H0DB 1CZ8H 4F8TA 2AQ2A 4ZS6D 3QI9A 3VRJA 5AZ2L 2MCPL 5HDQH 1OTTD 1SVZA 4XGZB 3CFJA 1BJMA 5TQ0L 2Y36L 3S88L 1TCRB 3ULUF 4AG4L 4BZ2H 5E8OB 1YPZE 3ABZA 4LARH 1MCPL 3U82B 4X7SH 4M61B 2VSCA 3NMEA 5DS8B 1EZVX 3EAKA 3MLYH 4KRPD 1IAIL 3CD4A 4AZ8A 4BK4A 4XCCH 3TZVA 4ONHA 3FMGH 1O5DT 1YYLL 5DJ2A 1EERB 3MFFA 4XRCB 4NM8H 2PF6A 2OJEA 4PRPB 5F7NC 3SGKA 2JJTC 4ZXBD 3SJVB 4Z78B 4PREB 3M17B 3R06A 4GMSH 3OHXA 4UTBL 3HG1B 4HPYH 1P2CA 1LE9A 5ALCL 5CEZD 3BOVA 4PYGA 4Q9QL 2ICCA 3WDHA 2VL5B 5D70L 4Z7WA 3DYMA 3O11A 3BGAA 4PTTB 3IAGC 1QRNE 2YD2A 2P7TB 4C56D 1FGVH 4KJWC 5C0GA 4YQXH 3ZKQD 3O6LH 3Q5OA 1ZHLA 3D18B 2DDQH 4NQEA 5EIIB 4ETQB 2OR9H 4RAVA 3DUSB 2E6JA 1MWAH 1GHFL 3ARSA 3EJYD 4R96B 2UUDH 4JHZA 2VAJA 4HUUA 1Z9LA 5D71L 1NMCB 2AJVH 5ICYA 1WEJL 1NJ9B 4LKXA 3VA2C 4YIQB 5EZIH 1LQSR 2EC9U 5MP6H 3BKJH 5F96H 1ZGLA 3S4SA 1YY9D 3BO8B 4V2BA 4CW1B 4Y4FD 1NAMH 3ARDC 4XNQB 4FQHA 3EYFB 3ES6B 4LARL 4HZLA 2XKNA 1MREH 3U7WL 4NOFA 2OTUA 4JRXE 2F53B 4JRXB 4WW2F 5ERWB 4LCWD 4KV5F 3BFOA 3CFJB 4D9RD 4EI6A 2FGWL 1MHHA 1GPOL 3DX8B 3I2CL 5MI0B 1G7IA 4U7MA 4GW5A 3QHZL 5EDXA 5DO2C 3GUTB 3MUGA 2CIKB 4GW1A 2FJGA 3KNBA 5GRVL 4GMSL 3ALXA 3KPSB 1RZKC 5HGBA 3S96A 4X8JA 3BP4A 3MRNB 4IDJL 3M1BB 1H3VA 4RBPK 3B6SB 1CGWA 2C3XA 4MNGA 1HSAB 4NPYB 5TE7H 2CRMA 1WCBB 4AYFA 5C6PB 1IEBB 5FOJA 4PJ5E 1I8KB 3L1OL 4X7CC 1Q72L 4P4KB 4HS3B 1S7WB 4H1LA 3DRTB 3U4EB 1T0NA 5EU3A 5C3TA 1CF8H 5IMOA 1FFOB 1D5ZB 3K74B 4OCWL 3ULUL 1PG7H 4IHOB 3S5LB 4MA7H 1LD9B 5F7LB 5IMMA 2X1WL 2BSSB 4PTTA 5HJ3A 1DP0A 2IBBA 1NGWB 1U8JB 4GJTB 3PL6A 5FYJH 3JXAA 2NTFA 5FYKD 4HPYL 4XNXL 5E8NB 4BKLB 3STLB 1T1YB 4D0BA 3HC4L 5FCUL 3PDDA 4TSCH 5DC9B 4OCXL 3MBED 4NDMA 3AU1B 5H2BB 3FO2B 2CQVA 3RWDA 1OGAD 1AY1L 2GITA 1Q9WA 5ADOL 1I7ZB 1BREA 1DQJB 4ZQKA 3UTTD 1KJVB 3SKNB 4NQVB 5DSCA 2G5RA 4FG6C 1KC5L