4GAJH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 411-424)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
209
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDTSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
total genus 37
structure length 209
sequence length 217
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH02
3O4LD 5DURD 5K9QG 5E2TH 5BV7B 3G5VB 4XNZC 4LCWD 2V2TB 2X41A 4RMWA 1NBQA 2VTFA 4IRSD 1H3GA 3L3GA 5CILH 4N9OB 3GRWH 4X5WB 2HFGH 3OKOA 3D39A 2DTMH 1Q9LB 1VDGA 3WLWD 4GKNB 4G6AC 3T0BA 2ZUYA 3N1PC 1C5DA 5JNYA 2J8UE 4YHNB 1W72H 3EZ8A 1U8JA 1A14H 5FYKD 1U8QB 3LCYA 1QTYT 3QEGL 2HT4D 2I9TB 5GS1C 4OT1L 4U1HA 5DEZA 1KJ2A 2PW2A 4BZ1H 3OKNA 1DBKH 4NOFA 5HYJA 1V7MH 1FZMB 1X44A 3JWDH 2JLLA 3NGBB 5SX5K 3ZTNH 4QTIH 4M43H 1KENH 5JOEA 5T5FL 3NCYP 1KGCE 1ZA6B 5FGCE 5TF0A 1VKXB 4X6CA 2VE6A 3GJEB 5DSCA 3BUTA 1G7HA 3H3PH 1RJLA 3T04D 4QXUH 2CLVA 4JKPH 4PJGA 4WFFE 1PLGH 4I0CC 5E2JA 1KTLA 2W0FA 2NYYD 1FO0B 2H2SD 4OF5A 4LVHB 2P7TB 4Y5XA 3CPLA 3V6ZA 1NJ9A 4NYLA 4Z9KB 3QUYA 4I9WE 4R2GC 3PJSB 5HYSB 4AK1A 4X7FC 3NH7L 1T7VA 3SJVA 1MSPA 1PDKA 3HMWH 3QI9B 1KN2H 4JN2A 1QRNB 4R26L 5DRNA 2X4PA 4QRSA 3WCYA 2D03L 4GOSA 3Q5OA 1U42A 1RJZB 4F15C 5HYEA 3ILPB 4G9FB 3RA7H 3LS5H 4LNVA 3S35X 2DWDB 2YPLE 2Z8WC 2DD8H 4X7CC 4GXVL 5EOTA 3EHBC 3KPSB 2I24N 4HIXH 3H42H 5F6HI 1A1OB 4EUPG 2A6KB 5HHPA 1DEEB 1NC4D 3MNZB 3WUWB 1JHTA 4HS6B 3AREA 4QYOB 4XNQB 3VH8B 3EYVB 1YJDH 5JOFB 1NCAL 2IPUK 2UVFA 3QUZD 4F57L 4HJGB 2XIDA 5ISZB 1MCWM 2VZOA 4XAKE 2V2WB 4ZDHB 1ORSB 1EMTH 1OAKL 2K7QA 4G6JH 4LLQB 1ETZA 5H94A 3GSNL 3PJSA 2W59A 3O45A 3EHBD 3RWIB 3NMEA 5D8JL 3U1SL 1J0HA 2IBZY 2WIIA 1RURL 1A6VH 5CLTA 4QRRB 3IFNH 4AEFA 2UWEF 3FB7B 3QDGA 7FABL 4X80L 4NKOB 1IC5H 1BP3B 4HBCH 3C5ZC 3Q6FA 1KNOB 1LO3L 4L4VE 3WO4B 5I19L 2F8XC 2DMKA 3IYLW 2UWEA 3G6JF 5ICYA 5JW3L 4Y5VA 3VW3L 1HXMA 4OZFG 4G8EB 3LZFH 4NCC2 1TMCB 3M45A 1IEAA 1RZ8B 4OQTH 4EUPB 2DDQL 2G5BB 4ODTH 1MJ8H 1HHKB 3S96A 1MH5A 3MV7B 2H2SC 4NFCA 3D69B 1OAXH 2NY5C 2VITA 4JB9H 4QRPE 5C0EB 4XC1H 1XIWB 4YHNA 3T4AA 4P23C 5DJ8B 1OWWA 2OR8A 4JKKA 3U4EB 3TV3H 5C0BE 2NY3D 2XTLA 2DLIA 2DWEA 4RAHA 1FL6B 3L3GB 2GUOA 3KG5A 4GW1A 3U30B 3F7YB 4S2SA 1K8DA 1KJMB 2EIBA 5C09D 1W0VB 4MJIA 2SEBB 4YQXH 4P2QE 5EDXA 1XR8B 4G6AD 4PJCF 3OWEA 1AH1A 2MWCA 3GFUA 4R90L 5ICXA 1UVQB 4HS8H 2HT2C 1QD0A 3C8KA 3MLUH 3MV8D 5BV7L 5DC9B 1RZFH 2Y5TB 1IILE 5HVHC 1UZ8A 5JR1H 3O6FB 4BK5A 3P4NB 1TPXC 1DANU 2OX5A 1I3GH 4N5UA 5ETUB 4WTZG 4PTUA 5F7WC 3P2TA 4H88L 4QHKJ 3CDYA 1DQQA 5I2IB 1A7NL 4LPXA 5FOJA 2Y23A 4Z8FH 5C08B 2GSGB 3TP4A 2ARJA 3MTRA 2ZCHH 1UB5A 4YBQC 2ITCA 4JO3L 5EN2A 1A22B 4I77H 1IL1A 2A0LC 2OJZL 3KWWA 4UV7H 4HIHA 1AHWC 4KFZC 3QB7C 5I8KH 4M7JH 2AJUL 4HF5H 5I1HH 5EWIL 3DURB 2KL6A 4JFDA 4HK3J 5IHZA 4MX7B 4NQVA 1RJYA 4KKBC 4JRYB 3WFCH 1CLOL 1DCLA 1C5CL 4P59L 5HHXH 2IAMA 4LCUB 5I0ZA 3ZLQC 2ICWB 1A3QA 1KPVA 4Y8AA 4OZIA 5IVZB 4NBZB 5DQ9B 3WFHA 4ONGH 4RWYH 4XPBL 1D5IH 2Q8BH 2GW5A 3BUYB 5C8JA 3CLFH 2ATPA 2X4OA 4IHOB 4X7TA 3X11B 1Z9MA 3V4VH 4WWKA 3UZQA 5CJBA 2VDLL 4JZJB 4IIQB 2HFEB 1B6UA 3O11A 3OSKA 2EKSB 2XWJB 1UM5L 3MA7A 4L4TB 4XWOD 4FFYL 5E8OB 2F58L 4BH7B 5IBLC 1UA6L 3EYQD 1A0QL 4HUVB 5F21B 1LEKB 1PG7W 3X14A 3HNSL 4GKNA 1BIHA 1QLRA 2WV3A 1KV3A 3QHTC 5DEGA 1DQTA 1MUJA 1U8KB 2J3SA 1DQLL 3QUML 1EFQA 4KDTC 1NGXB 2YXFA 2ESVA 1OAKH 3H2WA 4G6JL 4GW5B 4L9LC 1NMAL 4FXKB 4ZD3L 4ACPA 3HE6C 3TBVB 4H8WC 5C0FA 5D96B 1T2XA 3BPCB 1DN0B 1SMOA 1DUZB 4G7YL 4K8RL 3EO9L 1D5BA 1FLTX 4I8DA 3MRGB 2IH1A 3GHEH 1NSNL 3H42L 2XQYK 5FO7B 1SJVA 3C6LB 1QNZL 2NMSA 2X1QA 1A9BB 2EZ0C 5CGYD 5DFVC 5C6TL 3WJJA 2BNQD 4CN6A 2HLFD 1HQ4B 1MCSA 4JPWL 1WC7A 2BVYA 2VH5L 5I1EL 3ARVA 4ETQB 3VXTA 1CFTB 1K3ZA 4AQOA 4MHHG 1IARB 2RCSL 3IDGA 4Z0XA 4DKEH 4ONGL 4RWYL 3FO0L 5KSVA 4JQIL 2YMXH 4RFNB 4LCCA 1MRFH 4NQTA 1B0RA 5JZ7C 1LEGA 2OBGA 3BN9D 3KXFE 3S7GA 2KZWA 2FX7L 5ANMA 3Q6GH 4RFNC 5HYSG 3B8SA 3S5LA 4PTTB 2MNUA 3L95B 3SKNB 1HDMB 4MXWH 5ACZB 4PREB 3FQTA 1DQDL 1WZ1H 1GCFA 4WFHD 3MLTA 3CC5A 3BMVA 4PYGA 1MRDH 3HUJA 3QIBC 3MJ9H 5C0AB 4ZPTB 2ZCKL 2NTFB 1TVBA 1A21A 1KJ2L 2VLRA 4KQ4L 2VDML 3LOWA 4XPBH 1Q94A 1IEBB 1FL5A 5JR1L 3MNWB 5FFLA 3NZHL 2OK0L 2IGFH 1OOAA 1U91B 2Y4SA 2B0SL 5FYLD 1I8MB 1CXHA 5T5NG 4X4YB 1J12A 4JREB 2NX5D 2W9LA 5L2JB 2OP4H 3QDJE 3DIFB 5HYIA 3DXAA 5TE4L 3NPZB 4NZRH 4OCXL 5C0FB 1FNSL 4QOKE 2WQRA 5DZLA 2OJZH 3WUZA 4YHMH 5A1AA 3EIFA 4O2CB 3FL7A 4LPVA 4S0SD 1S7XA 3DXAB 1TZIA 2VOTA 4Y16C 3VE0B 2DQTL 5DD1H 5J1TC 1CD1B 3GEWB 3KPTA 2XG5A 5IB1B 1IKFH 4CW1A 3CFEB 5DRZB 5E94B 3HE7A 4HK3N 5E4EB 3TV3L 1BZ9B 3DX6B 4Z77B 4HEPG 4GKOA 4NBYB 1I9RL 5EU3A 3QUMB 4M5ZL 3RGVD 1MRCL 1S5IL 2Z91A 1VACB 4BQ6A 1H3WM 4OLXH 4EOWL 2NXZD 2NZIA 3IU3B 4PJCB 1VFAA 5EUOF 4XBGA 5CJ8A 2BFVL 5IEHB 3LKOB 5DJDA 1PYWA 5E1AA 2XOTA 1DEDA 4LARL 2HRLA 5F1KC 4BFIB 2J6EH 1QR1A 1GXEA 3U46B 4PJCA 4F8QA 4GRWH 1QSFE 2DM7A 2RB8A 3EJYD 5GS2D 3N0PB 4LGRB 4L29A 4BSVB 5KSBA 1HHIA 1CLZL 1CICD 3MRNA 4GW5A 2VLME 2B2XH 4UQ2B 4RMVA 1U3JA 4BFGA 5JA9A 1BIIB 2YZ8A 5ADOH 5HYJD 3MODH 3PWVB 3SJVB 4Q6IA 3HS0A 5ID0B 3K8LA 2O5XH 3I9GL 3H7BA 2MQ3A 1Y18B 2VDKH 1MIEL 1NUGA 3GGWB 3LH2H 4K3GA 1T83A 1I3UA 3D0LB 1WCQA 4NN6C 5C0DA 5ILTL 3N1FC 4PJXA 4X9HA 5C0GB 3MXWH 2YPLA 3LEVH 2GSIA 4R4NC 3UO1L 1IEHA 3FQRA 4KJWD 2OSLB 1NMCC 1ED3A 1KIQB 4Q0XL 4XC3H 2FO4A 3S4SG 4LVNB 5KVDL 3RVTC 3AU1A 2XQYG 4MD0B 3QDJD 3W11D 1U95A 4NNXB 4LF3A 4D0BA 4NRZA 1NGPL 5FDYA 3PABB 4LCWE 1UJ3B 3BPOB 2HKHL 2VMFA 4O2FB 1BAFH 1YJDC 2FR4B 2P8MB 3ULUL 1CGYA 3PGCB 1CD8A 1R3HB 3QDMB 4FA8A 3V5HB 4OZIE 3K4ZA 4U1GB 1MAML 4JFFD 1P4BL 2W65A 1CDIA 5DEGB 3FO9B 5KTEH 1K5NB 4MMXC 4ZSOA 4X5WA 4N8VB 3QIUD 3ZE2F 2X4QA 4OM1H 4YX2L 2QADD 2K7PA 2QSCH 5IMMA 3WJJC 4Q9QH 2NY1D 1JZ3A 1MCFA 3QWQB 3UAJC 1HHJB 1LGVA 5IW3A 4XPAH 5F89B 1JWMB 4Z76A 2A1WL 2L7UA 5FUZH 5JO5A 3I3BA 5DRXA 4P5MB 4PGCB 1CLYL 15C8H 3WXVL 4NWTL 4QHNB 1WWCA 1ZT1B 2IPKA 5DJ6B 3RI5K 3TN0D 3ARPA 2Q86B 1MFNA 2OJEA 4OZHF 3BZEA 5GGRY 3DVGB 6CGTA 1CFSA 4NIKB 4J8RB 3Q5TA 4QRQB 4CDHA 5J1SC 2DWEB 4PP2B 4HWBA 4YHKH 2X4UA 4L8SC 1JRHL 4L5FH 4Y2DD 3FOLB 3TO4C 4B0MM 1LEIB 1R3IH 5EPMB 5CP3A 5C0EA 4D3CL 2AERT 1I8KB 3MRHB 1YZZA 4OB5H 2R56H 1N8ZA 3BVNA 5GGSB 5GGRA 3FQUB 4ETYA 1M05B 4M43L 2VR9A 1NFDF 4KTEH 3MRBA 1L6XA 1KJVA 1WWBX 4JM4L 4OLXL 2HTLD 4F15B 2BSED 4K3EL 1A7QL 1S5HA 3TO4A 1A14L 5EB9A 1U8JB 3HNTH 5E08H 4HV8B 3ILPA 3BKML 1HHGB 2DMCA 1IKFL 2CDEA 4TULL 1RUKH 2OI9B 4HZLA 4MJ5B 3KYNB 3HR6A 2L0DA 1JGUH 3GSUB 2VL5A 1KBGL 1G9NL 5EU3B 1CDUA 1EAJA 3A67H 4LHUD 5D7KD 2HKFL 4HGWB 4ZO9A 1U92A 4NN5C 3KYOA 2F19H 3G5ZA 1DDHB 1B6DA 4PV8A 2EDDA 1G6RB 2O61A 4PV9B 2YSSB 1JHKL 3GI8H 2LQRA 3KNBA 4QTHB 4Y0GA 1NBVL 4G7VL 4JY4B 5B39G 3O41A 3PHOA 3ZKXC 2CMRL 5C0JB 5ESAA 1FNHA 4K3DL 3F62A 4GS7C 4ISVB 4GRLC 4OF6A 1QSFA 3Q1SH 4S1QL 5IJVB 1WFUA 3LQZA 4Q58C 43CAA 5KW9H 4PB0L 1RV6X 1QPXA 3DHMA 3O4OC 1HXMB 4IJ3B 3MSPA 4PRHD 1HQRB 4HKXA 4MQ7A 4HJJL 1AGBA 5TQ0L 2CRMA 3F12A 1INQB 4C54A 3K81A 3HC0B 3ULSB 4M6OL 1JGEA 1FGVL 3HUJF 1MQ8A 4LMQI 2PO6D 4Z78A 4MNHB 2P7TA 4JHWH 4LSDA 2BSSA 5TE6L 3TVMA 1YY8A 4YHZH 1XGQA 5EFIB 3DBXB 2X05A 2G75B 2F74A 5FM8A 2NW2A 2VXVH 4N68A 4XXDA 4YHPA 1LO0L 3PWPB 2P46B 1ZT1A 2R69L 1F58H 2YRLA 4PRAB 3O6MH 5K59E 4X6CB 4ZPVA 3ECBB 3SE9L 4KZDH 4LRNL 2Q8AH 3VRLE 4V1DA 4HKBB 2OR7A 5L8KB 1N59B 5IM7B 4P2QA 2ICCA 2VC2H 3TNNB 1F4HA 5IVXA 3KPSA 3HRPA 4M7KH 2A6DA 2IANE 2XN9E 4DW2L 3P73A 4S10A 2A9NH 4HAFA 1CZ8H 5GGVH 5EC1A 3MLXH 3IKKA 4JFPA 3UDWC 3VXSA 5IVXB 4N8CL 3MV9A 2AGJH 1YMMD 3OAYH 1ZOXA 1NBZA 2FATL 4DVBB 1Z9LA 5LXGH 5HJ3A 1CGSL 1EZVX 3UPAA 3TC9A 2H6PB 4M61A 2IFFH 2H3NA 3IDJA 3GMLB 4OBRA 12E8H 1NC2D 4HPOH 1OTTC 1TQCC 5JHDB 5DMKA 1K3IA 1AGCB 5IR1A 4QNPF 1I8MA 3I85A 4YHKL 3TBVA 1I7RB 4NC1E 3VGFA 4M3KB 1U0QA 2IEPA 5DSCB 3FQRB 4PIRF 4MJ5A 2ZUQB 1L9MA 1OP3K 4KV5F 4WUUB 4GJTB 3VG0L 3SDYH 3BKYH 4OCXH 4GG8A 3B5HA 1HSBB 2GKIA 3B6SA 3D1MC 3CFDA 1WFNA 1NEZG 5HI5D 4FQIH 4Z7UB 2VITB 3QG7H 1FG9C 4Q6IB 1FGNL 3O0RL 3I3DA 5IVOA 3BH8B 1MFAL 4LASH 3FO9A 2ATPB 2X4OB 1CXLA 4IHOA 4ORZC 3DHJA 3L3HA 4AT6A 1L7IH 2XYCA 4NQDE 1YUHA 4OLYL 2MHAB 5BS0A 5DR5H 3BO8B 4KMQA 2J5LC 4U1JA 5DTFA 4WUKL 4P9HH 5J7CC 1TTGA 4W6YB 1ZHLA 3REWA 3GBML 2JCCE 3QULB 5CWSB 3CX2A 5ACLA 4PV8B 1PEWA 5DVMA 1R3LA 3DRQB 4Z7WE 2R8SH 1T6WA 3G9VA 5FA4B 5F9WC 2AJVL 2QL1A 1X5YA 1L0QA 5BRZD 4OCYH 3V8CA 3S4SB 1FAIH 1ZXQA 3LH2L 4QTIL 3DVGA 3SDDC 2R2BA 1T7XA 4MD5A 1NFIA 3O3EA 5ELIA 1UH2A 2IPKB 3CVIH 5BV7H 4AH2B 1ACZA 4LPCA 1WTGT 2AJ3B 4JLRB 4LLAA 3BX7C 3WIIH 3CD4A 1YEKH 4QO1A 3UTSA 4WU5A 5DVNA 1JGDB 3U36B 3GSOA 2W07A 4HDIB 4KDWA 5E5RB 5BJTA 3IT8D 1HYSC 1L7TH 4U1JB 2AVGA 3CNKA 5DTFB 5FKAA 4JEGB 3EFDH 3ARFD 3AGVA 2FBJH 4HWBL 2AI0L 1I8KA 3MRHA 3C9NB 4XVUC 1DVFB 3RY4A 3F7VA 5IBUB 2P45B 2Q3AA 2BNUB 2XY2A 3MRRA 5AZEH 5I1AB 1AJ7H 1TVHA 3VFOA 2OL3L 5I18L 2GFBB 5E9DD 4BQBA 3QEQA 2IFGA 3MRCB 5IROC 4LDEB 4JGJA 3C2SA 4X7TB 3SPVB 4LSRH 3LEYH 5FM5O 2EDXA 3OKDA 3AM8A 5C3LD 2BP3A 4ZPTA 5JZ7D 5GHWL 3QEQB 2GY5A 4KMTL 4NHCH 1LO3H 2LE9A 4UI2A 3QQ9C 2DOCA 3VXQA 4OKVA 5BS0D 2B1HL 5SX4I 3EDJA 4ONOA 2Y36L 4XVJL 1ZGLM 2UZXB 3OKKA 4WDIB 5GGRB 4I3RL 4U1HB 4DFHA 1WWAX 4O2CA 3CLFL 4GG6E 5J0BA 3FO2B 5D5MB 4OFKA 2VZ1A 3ZL4L 4KI5C 4YDLC 1FIEA 3E2HB 2NCMA 1QBLL 4QWWD 5FGBA 5J6GB 4YO0B 4WTXA 4PJGE 5I8EB 4DEPB 4RMUA 2N56A 1LDSA 1JPST 4HG4J 2QLVB 1D5MA 4FHBD 4XMPL 4AH2A 4U1LA 3TYFA 4ZUTB 3KVQA 4OCMC 4YHLH 1YNTA 2CKBA 2XXMB 1GZQB 4PJHF 2DM2A 2AJYL 4QHMB 3CVIL 1TZGL 4MB4A 4ZPVB 1U8HA 5IG7A 5IEHA 1RQ5A 1GYAA 1KCRH 4HHAA 4WHTB 2EYTB 4LLWA 4QY8B 3HMWL 2MKLC 1UFUA 5EUKB 5HD8D 5JA8B 4OGXH 2D4FA 3AMKA 3JTSB 4S2SB 3GM8A 2FEEI 2OTUB 1IC1A 4M1CD 1JPTL 3A6CH 2DQHL 3K8MA 4KVCL 3WE6A 1K4CB 4LSUL 4CVZA 5E7FA 3OJ2C 1BLNA 1LK2B 1G9ML 1R0AL 2VH5H 4P9HL 5IK3B 1N4XL 2WIMA 1GGYA 3VGAB 1IC7H 1VB9A 1W2KT 4UT7H 5JW5A 1IGMH 1UQSA 1ZGLB 25C8H 3EGSA 3SBWA 3SHSA 4YEFA 2FHCA 4HCRA 4XCCL 4MDIB 4OFYD 1IMHC 5EO0B 4TSBL 4UMGA 1IGFL 4FNLL 3KJ6H 4GG6F 2E7LC 4WCYH 4RGOH 2QSTA 4NGHL 1IGIH 1QBLH 4PLJD 1T03L 4UDTA 1DE4B 5DK2B 2DQCL 3V6BR 1R3KB 1HWGB 3CVHH 4KMLB 1F6AA 4FQHB 5JO5B 4LVOB 1EH9A 1I9EA 2KQNA 1SM3L 3MRQB 3IU3A 3PHQA 1D6VL 3WJLC 4P4RA 3WO4C 5GZOC 1VGEH 3OB0K 4K07A 3MRIA 1NCDL 3MPCA 1U8QA 1JGUL 3QP3A 5FGCB 3C5SA 3DMMB 4HJGA 4K23L 4B7IA 1U8NA 4CW1B 4LSQL 3FO1B 3TIEA 5J06A 3VE0A 4HBCL 3IDMB 4KV5E 4ZD3H 2PCPA 2R23A 2UUDH 3C8HA 5KVGL 3R1GH 1URLA 4G8GA 2GY7B 3O11B 4HPYH 1BBJB 1G9EA 1J87A 2BNRD 4JZJA 3T4YB 4U1NA 3VWJA 3ESUF 1GC1L 5IG7B 3OAZH 2AI0H 4F57H 1F6AB 3HCVA 2DI8A 2I60H 4GRLD 4J3UA 4P23D 2E9BA 4NQEB 1MY7A 3MACL 4N0RA 1ROWA 3PWUA 4CRPA 2CIKA 2YPLB 1JZ8A 3QCTH 3B83A 3HI5H 4Y8DC 2X6MA 1M1SA 5ESQB 4XPTH 3CZFB 1ZVHA 3OBAA 3GSWA 4X98B 4HMCA 1HN1A 4JO2H 1XGRB 4LGPB 4XP9L 5DJ8A 3RA7L 1KPRB 1BD2E 1MFEH 1NCNA 1R5VA 3BH9A 3BE1L 2EDYA 3S5LB 1XIWA 5FOBA 1AGBB 4XI5D 3DX7A 3WS3B 5GZNC 2DLFL 2BOCB 1A6WL 4Y4FB 2PN5A 3X3GH 3DVFA 5IROA 5TQ0H 3VG0H 4TOYL 4YPJA 1ZHNB 2VLKD 4Y1AD 1A3RH 3HI6H 2VLKB 4M7LT 2GJ6A 4NO3B 2FO1A 1KJ2B 4RISL 5I74B 2I07B 5DWUH 3OXSA 3LKQB 1BZ7B 3QUYD 2X4QB 4M48L 4FS0A 3LHPH 1F5WA 4QXUL 2ADFH 4NWUH 3TEUA 3Q6GL 4UQ3A 5JDSA 1WF5A 4YBHA 1FNAA 1YY9C 3BWAA 1KG0A 4NKMB 2GFBA 2FATH 5L7XL 1IAKB 4X0KA 2ICWI 4QRPB 4JFZH 5C2BH 3ZDZE 4XNQA 3HHRB 3BZ4B 3QR2A 4Q0XH 4U6XA 5LVEA 4HIEA 3EBAA 5C0BB 3PUCA 2JTDA 1XGPA 1UJ3C 4IS6A 3TO2A 1UEYA 4ODVL 4TQEL 1LO5A 2GJ6B 2E3VA 4Q74A 1R5IB 2ZG3A 2ZJSH 5KSUA 4NKQB 5C71A 2V17L 1CU4L 2CDFA 4JJHA 2C3WA 2EXWD 1N8ZB 2B20A 4LKXA 3LKRB 4LLDB 4X4XA 1OTUD 1JWUB 3OKMA 3TCXA 2Q1EA 1FO0H 5IM7A 1CFQA 4ODTL 2IQ9L 4E42A 1NCAH 3U6RA 1ZLSL 1JYWA 3CUPA 2DIBA 2AXGB 3W5MA 1DQLH 5B21A 4J8RA 5C0CD 43C9A 5B39A 4AG4H 4FQQA 4JRWA 3TT3L 2VIRA 4PJ5A 3MLSL 4XVJH 4E9LA 5HVWA 2CLRA 5CZVH 3OQ3B 5EORH 5HHQA 5D7LB 1S3KH 4OKDA 1J8HA 2R2CA 3UYPA 4L3EB 4OZ4A 2AXJA 4MSWA 2YBRB 3V4VL 1HIMH 4HIHB 2E7LA 1U8KA 1N5AA 5SWQA 1CFNB 2P42B 2ORBL 5I74C 4NN6B 2ZUTA 4XMKH 2AK1L 2ATKB 3WKNA 3H7LA 1DFBH 4ZFOL 4BKLA 5DMGC 2DRUA 3D18A 4QHUA 4PYHA 1VESA 2PXYA 4YDVB 1KCVL 3GMPB 1HHKA 3NA9H 5KJRH 3UEZA 4GRMA 5FCSH 3BEVB 5GS0C 3W82A 2JELH 3IB4A 3QYCA 4ZOEA 2DIAA 4Q7DA 3MLZL 3DX8B 4FXLA 3IJYA 5B4MD 3VFGH 3RL2B 4D0BB 4Y4HD 1PD6A 4PRID 2R69H 5IR1B 4TNWK 4JDVA 4GMSH 3DV6A 1QFWI 1CDGA 1XGTA 4D8PB 4HWZA 3WIIL 5BS0E 1A7OH 3BKCL 1ZHLB 2HVJA 2DLHA 3EJYC 1CFNA 1F13A 1WIUA 1IL1B 1DFBL 2OSLA 3ZDZF 2EE9A 4G7VH 3JSSA 2X7LA 3VWJC 1RZJL 2BERA 3X3FL 3QXAA 4MVBC 1J05B 2P5WE 5GJSH 4U1SA 1VADA 4JG0H 5DYOB 3VXSD 4HWUA 2D31B 1DR9A 1WBYB 5C0AA 1FPTH 1PEZA 1S3KL 4X6DA 3P4NA 1NBYB 1U2CA 3TA3D 1XF3A 3B6SB 3BDYH 5LQBL 3RIAF 3LMJL 1HSBA 3ZTNL 4O4YH 5GRWA 2QEJA 4KDTA 3X11A 5JXAL 1YEDB 3BGFC 4WUUA 1KB9J 4R96B 2VLLA 1P4IH 3E3QC 1JP5A 3EDEA 1G84A 4NM4L 1FP5A 1LP9A 3GSQA 3I6KB 3NA9L 4NQCD 1LK3L 1QFWM 3CH1A 3N85H 1A7OL 4XCNA 2R39A 2RQ8A 4YUEL 4LSPL 4XHQA 5EFIA 3I75B 4WNQB 1A1NA 2EYTA 1Q72H 2YD9A 2WIIB 4LLWB 4MDJB 1AO7D 3CPLB 5IHUL 5EO1A 1J0YA 5IB2A 1E27B 1NCDH 2BSRA 4JDZA 3IDJB 3IVKA 1IGJB 5JW4Q 1ZLWK 2DN7A 3RZCD 4JM2B 3TYFB 4MCYB 1T1WA 3MNZA 4WV1A 2QKIB 4LDLB 5ECJE 1HI6B 5FO7A 4PRNB 5ADPL 3QXTA 5FHAH 5GS3A 4YO0A 4N0UE 3RTQD 1A1MA 2DJ4A 3FFDB 4OV5A 2CK2A 3OF6D 2X4TA 4MQTB 1PZUB 5IB4A 3DUUA 1X5AA 4G8GB 2I25N 4JFEE 4G6ML 2VJXA 4TSBH 1XH3A 3MO1A 2XACC 1GH7A 4F9PC 3SY0A 2CJUH 1ZGLP 1YJDL 4J23A 3CFCL 1EHLL 3CGTA 3RUGE 2ADFL 2ZJSL 5A2LH 2B4CH 3EOAA 3BISA 1QBAA 4HGWA 2NY2C 4P2CG 3RWIA 2F58H 2A9NL 3O45B 4I48A 5IT2L 4NO0A 3S36X 2K3TA 4HJ0D 4JRYD 5TDNB 3SOBL 2BNQE 3FT4A 1H3PH 2ARJQ 1QPPA 4JDTL 1A7RH 2HH0L 3G5YB 2EIDA 3ETBF 1CDCA 2I5YL 1UG9A 1BFVH 3QA3A 1T03H 3WIHL 1BAFL 1Z0NA 2D7OA 3R06B 2NY2D 4WY7H 2EH7H 2NZ9D 5EWIH 4AY0A 1BHGA 5M7QA 2VQ1A 1WTLA 5J57B 4ZXBC 4P46C 1NFKA 2XA8L 1BOGB 2WBJD 3GK8L 4JFDD 1SJXA 2EDQA 5DMYA 2X2YA 3LB6D 4Z7VA 1YNKL 4KJQD 1B88A 4JCMA 4P46B 1P7KA 3GSOB 5FECB 1P4BH 5E4EC 4Z0XB 4RX4A 3EDKA 4ODXB 4CMHB 4RZCA 2BFVH 3BT2L 1WWWX 4MYWB 5IBLD 5KZCB 1KB5H 3T0AA 1YMHB 2EKJA 2J8HA 5TDOB 8CGTA 2EDNA 2VZUA 5EBLA 2QR0B 5BZDB 2B1HH 4NO2B 4MVBD 1BX2A 2NY4B 3QHFL 4UNTA 2C7UA 3VWJD 3W81A 1GZQA 3CX5J 5DUBA 2DQDL 4LRIA 2Z8VC 1HE7A 1U9KA 3TCLB 4KRPC 4ZUTA 4BK4A 1R3LB 2YD6A 3ZKND 3SQOL 3TPUA 2HRPL 1NKOA 2Z9TA 1NAMH 3MRKA 1NDMB 2Z31D 1J7VR 5I30H 3WDIA 5E8PB 4F7CB 4ZO7A 4HZAA 3LN9A 2LTQB 1A6AA 1AO7A 3QZWA 4LKCB 1LK3H 3AAZA 2APTA 4GW4A 2ZOLA 3OGCA 4YBLB 3CLEL 5EH1A 3CFKB 4EJ1C 3TA3C 4PJHA 1ZSDB 2Z35B 4XX1G 4OD3H 1U93A 4NM8H 1E28A 4CJ0A 1ODAA 4U6TA 1EEYB 3UDWA 3P9LA 3CSYB 1NC4B 3P4MA 1CFSB 1BMGA 1A4JA 3LD8C 1ZGLA 1UB6B 3UYRL 1DVFC 5I8OH 3MX0A 3QDME 3GSXB 2X09A 1WT5A 1Z5LA 3JWOL 1KPVB 4GKSA 3RWFB 3TGXA 3UTTB 1I7ZB 3T65A 4NKOA 1RSFA 3KPQA 2CRZA 4OZGA 5JHLL 4X7EC 1RIHL 2F5BL 4PJXB 5HYJB 4BSJA 2CIIB 4JQXC 4QRUA 1INDH 5L0QC 1TVHB 3VD7A 1V3MA 3O9WA 4YJZL 4IOIB 5F1IB 5F88B 1D7FA 4TTDC 3T3ME 4Y5XC 1T66C 5D2LB 3P9MA 4XGZB 1AE6H 3BZFB 5ITBL 1NGWB 1ZANH 2LABA 3VGEA 3AREC 2RR3A 1AD9A 4WU7B 1IC7L 1EV2E 4HSQA 3BIKB 1XR9B 3TNMA 3ZKSD 1OGAD 1JI2A 5LWYH 5I6XC 5C6PB 3VFVB 4DTGL 3WHXA 4QHMA 2AJ3A 2X4PB 3LKOA 4QRSB 1IAOB 4WENB 5FYKE 1ED3B 4DGIL 4GRLB 2QJDA 3TYGH 1FFPA 1TJGL 4ZYKA 3NFNB 4NHUB 3S3SA 3D0LA 2R8SL 3B9DA 4A6YL 3GMNA 5IVXF 4JQVC 4H8WL 3SBWC 5DLML 1IM3B 4JHZA 1D5BB 3PV6A 2AJYH 2XQBL 3QFJD 3HC0A 4ZAKA 5CJXA 2APBA 2CH8A 4NKDA 2XFXA 5GQBA 3G5YA 3B2UD 3I6LE 5EZIL 4YFEA 1G7HB 3D3VA 1P7QD 2FX7H 4NC2B 3CMOL 4O58L 2O93L 4NZDA 1S7RB 1ZKAA 3G6AB 4DJMA 4WY7L 5GGUB 4R0LA 3MNVA 4QXTB 3CCHB 1L4IA 4BZ1L 3AY4C 4FTVD 4YXHL 1PAMA 3MXVL 1YC7A 3FAWA 3RWDA 1EEZA 3T0EA 2WZPD 1T1YA 4X4ZA 4JY4A 3LY6A 4LVEA 3RVVD 2ERJB 1AXSA 1MFCH 2Z4QB 3MLVH 5FKAB 4TVPD 4GKZA 4PJ8A 3G5ZB 4EUPH 2JF1A 3BFOA 2CR6A 1MFBH 2GTZA 2X9XA 4ZO8A 4I77L 4L8BB 4E41A 1MHCB 1QLEH 1IT9L 1F8TL 2L4OA 5HHNB 4M1GH 1TVDA 4WW2B 4WV1B 2X4NB 3MLYH 3WL9B 1GOFA 4QRTA 2NYYC 2QR0A 4WFED 5BZDA 3QUYC 3GMLA 4OZHE 3HG1A 3ZL4H 2ADIA 1FQ9C 1MCPL 5IMLB 4KC3B 1J1XH 2XTJE 5F9OH 4KGLA 4HFWA 1M6OB 5GGVL 2GSGA 1RK1A 5ADPH 4WIQA 1H0DB 5GS2H 5L0QB 4HH9B 5I0DA 2GYSA 3U0PA 4OZFH 1G7PA 5D7LD 1S7VA 3QULA 4XI5C 4DZBA 4M5YL 3WHE0 5DRNB 4JN2B 5F7KC 3UXFA 4X6CE 1MF2H 3TNNA 5IUSA 2CXGA 4K94C 5T5NF 4NQCA 2FD6H 3NA4A 4X5LA 2A73A 1LNUA 2VLJB 3MR9B 4MD5B 2YEZB 1DP0A 4OLYH 1X5KA 4RRPG 5C07D 4H88H 4PRAA 2WP3T 3QHFH 4FQLH 1C5CH 5KG9A 3IAPA 5IESL 2J1KA 3IXAA 3CFDB 3QA3B 3DTXB 1NCBH 4XCNB 4R97B 4WWKC 4CVXA 5IVXE 3CVHL 2JE8A 1RJLB 1EGJL 2WW8A 2VR5A 1DQJA 3T0ED 3DPBA 4FXGB 3QJFA 3LMJH 3TH2T 4U6YA 3L3HB 2EDJA 2IC2A 1Y6MR 1KB5A 1IBGH 1LEKA 3F65A 4IRZL 4EVNA 2H1PH 1E6OL 4CUCA 1FHGA 5AD0A 4J3SA 3HC3L 5E2VL 5GRXG 4X80H 5JUEH 2A6IA 5C6WH 1TLKA 1UH3A 3WV0A 1E4WH 1AIFB 1R5WB 1EEYA 3JV4B 4MJ4A 2A83A 4Y19B 1GRWA 1UKQA 1GGIL 5I1CL 4XMKL 3O9WC 5C0JA 2HTKD 3NCBB 5T1MA 5CINH 5CP3H 2E8YA 3K7UA 2LVEA 1JVKA 3NPSB 4LCUA 4NWTH 4KKLC 1GGTA 2A83B 2E6PA 5DJAB 3T8XA 5EC1B 2AV1B 3IS0X 3HB3C 1CDJA 4N8CH 3VXMB 3ULUF 1AR1D 3QRGL 1ZLVH 3ES6A 4M1CC 5BXFA 4LHJB 3UJTL 3O8XA 1WITA 1A2YB 3VD9A 3MLZH 3QXDB 3NIGE 3KPNB 2WLYA 5F7UA 4NQDB 3QCUL 4KKAD 4MS8D 4MAYC 4RQQB 1OAUL 2NW3B 4M93C 4QXGH 1RHFA 2OS7A 3QUKA 3X13B 2C1OB 1QLRB 2PUQT 4DZ8A 5JQ6L 4ODUB 2PW1A 4O02H 3W0WD 4AYFA 3DBXA 5I15L 1WT5C 3PNWA 3S3JA 1F4YL 3QJHB 4D9LH 4J3OC 4KKNA 1MOEA 3G08A 5IMOB 3DXAD 4PD4J 4MLIA 2FSEA 5F7MC 4JFYB 2YD7A 3N85L 2VISB 3LKPB 5GGVY 4ODVH 4TQEH 1X9QA 2EIZA 1FGVH 5DQ9A 3WNOA 2A74A 2YRPA 3QQ3A 3ZE1F 1YYLL 3QAZC 4NRXA 2FIKA 4HKJA 1IQDA 4XWGL 4OGAC 5C09A 1A9EB 1LEIA 1F97A 1QRKA 3VRJA 5DI8A 3TVMD 4P2RB 3QWOB 3RX5A 3QIWC 2QHRL 4YNYA 3TVMB 2DM3A 4IMLA 1PSKL 1NJ9B 4NYLB 3WIFB 4EZMA 3NZ8A 4DGVH 3SE9H 2FX8L 4JZNA 4JG0L 5CZXD 2PTVA 5EC2A 4B53A 3O2VH 3KWWB 1WICA 3QIWB 4M00A 1Q8MA 1GGBH 5L2KA 5IEKA 2W0LA 4YHZL 3KPMA 1B2WH 2UWEE 4JHWL 1G0DA 1C16B 4TN9A 3PP3H 1TTFA 1KC5H 2DQUH 3EAKA 5C1MB 5BRZA 3V9FA 1EJOH 2BC4A 3B9KD 4O9HH 5DUPL 2HG5A 2D9CA 2CDEB 5INCB 4OAWB 1U8OA 3REVA 3GSNB 3VGDA 5SWSE 1OAQL 35C8L 1JUFB 2R2HB 3QEQE 1G6RA 5I75B 4TULH 2BRRL 4OGZA 2FLBT 1O7SA 5SX4H 4HQQL 1MEXH 3LKSB 1NH6A 3HI1A 2YUWA 2R0LL 4MD4B 5DJXA 1LVEA 2E9JA 2NXYC 2UZIH 4HFUH 4NNYB 1IEBA 3OR6B 4M7ZC 3V0VA 4M9OA 3PQYB 3C08L 1XGYL 3L9RA 4I1NB 4OQTA 1K9TA 1JTOA 4LSSH 1FFNA 1AQDB 3LN5B 2BY3A 1NGZB 4IRZH 1FORL 4XVTH 2XI9A 4TUOB 5TFSL 3V6OA 5ENWA 5B39B 4PB9H 3JUYA 1FPTL 5CZVL 1EIBA 5IMKA 2APFA 2V6HA 1ES0A 4H25A 5EU5B 3VI3E 1SM3H 3ZMRA 2VDOL 1IEAB 1AGFA 1YEJL 2X70B 3L7FA 5IB5A 1XZ0A 2P24B 3D2UB 4UIMA 2W38A 1X3DA 2QADB 3RWGB 2H9GA 3V8OA 4JHBA 4LCCC 2HAZA 2IQ9H 3FJTA 4UIMB 1FO0L 5FB8A 3GO1H 3BGMB 5SV4A 5F96L 2C4FU 1W8NA 2ZUQC 1F4XH 3K4DA 3PP4L 2FSEB 4KK8C 5SWZE 1G7LB 3GSVA 4JFED 2HMID 3O3DA 4OD1L 1IVLA 5E5MA 3RZCB 3ARBC 4J3VA 1JFQL 3LIZH 3WDHA 1I3RA 2OTPA 1VFBA 1MFCL 3I6GB 1KLUA 5FXCH 3VH8G 2H2PC 3A6OA 4NZTL 5FO9B 4LCWA 1U6AL 1N6QH 2NX5B 4ZFFA 4F37F 3HPLB 4G8IB 2C26A 3TVMC 1PKQE 1FIGH 3P4OA 4WI6A 3MJ9A 3O3BB 3ES6B 3OAUH 4OGAD 5EZLA 4BH8B 3TYGL 3QUMA 7CGTA 3SGKC 5B3JF 1EMTL 5FO9A 1PKQA 1H3UA 1I7ZA 3CXHK 3T65B 4AIZA 4HUXB 4YDKH 4H5SA 4ZNEE 1T80A 4F7TB 1U2HA 3LRGA 4S1DD 1MAJA 2YOCA 3X14B 3KDMA 1I8LA 1OSZB 4U2YA 4S1RH 3U4BH 4LSTH 4UZGA 4ZS6D 3S36L 4NNPH 2DYPD 3BPLB 3PL6B 2JCCF 3GJFK 1U3HC 4OCSL 1FRGH 1NCUA 2PXYB 4JFDE 1KFAL 3FQXB 1UKTA 1P7KB 5FECA 1MJ7L 1MJUL 5L9DL 5DEFA 1GGBL 2Q7YB 4LNRB 5C86A 3VD4A 2EO1A 5IVZA 2HH0H 1F4WH 4ZAKB 2IAMB 3HC4H 1Q94B 3F5WB 4WCYL 5BQ7A 5I76B 1ZA6A 5KVEH 3NH7H 1KEGL 3IRZA 4LEOA 3G6JA 2ERJC 4G9FD 1OY3B 3HB3D 3QNZA 1WBZB 4FFZH 3QDHA 1JNLH 4NDMA 1VCAA 4XC3L 3EOYG 3ZTJH 3QUXB 4PRBB 3MLPA 1R0AH 5JNYB 1QEWB 2EC9U 3ET9F 4M62H 3QNYA 4F9LA 1U8MB 4LPUA 4RFOH 2YD2A 4W6XB 5ERWA 3GMOB 3OV6A 1VENA 3RPIA 3VMPA 2KDGA 1C08B 3PL6A 4LCYB 5KS9B 2E9IA 4KI5F 2NQCA 5KN5A 4DKEL 1FZJB 2ENSA 4Y4KC 3QIUB 2FX9H 4ZTPH 2DMBA 4GUPB 2N7BA 3F7RA 1K6QH 1SMAA 1BQSA 3T09A 1LO2H 1X5LA 3T0EC 4PJ5E 4IS6B 2FH8A 1MPAH 1PYWB 4XZUB 3O2DL 4UILL 1UKSA 1HKLL 1YQVL 5D4QA 1KPUA 4N0YH 5DDHB 4NDMB 1W0WB 3SQOH 4L8SB 1NCCL 2X89A 3QPQC 4W6WB 4YK4B 1C1EL 3C60D 2PO6C 1VPOL 3PGDB 1TENA 2XXCB 1II4E 4YUEH 5I71B 1AC6A 5F7DA 3RWFA 1AJ7L 5TE6H 3CFJB 1KLUB 4HUNB 4K9EL 4L8SA 4KVNL 1R3KA 5CJQL 3EDFA 4OF7A 2OYPA 4Z7QE 5MHSE 2R0ZH 1DLHA 4EI5A 1LWRA 3LRSB 1X4ZA 2C4XA 2XKUA 3CK0H 3SPVA 3TFKC 5I16A 3HZYB 3RHWK 4MLSA 2W0KA 4G9DB 3MV8A 3B3IA 5I1AA 5D7JD 1P5VA 1T3FA 5CBAA 4PREA 3VXQB 4E0RB 4G9DA 2ZNWA 4AQ1B 1MI5B 4LSVL 4LQ1A 4PJBE 1SY6H 5F7LB 3EOBB 1FBIL 1KJ3L 4PJ7F 5BJTB 1BJ1J 1GZPB 1MFAH 4LASL 1E6JL 5J12C 3BKCH 5F9JA 3BP5A 5LGJA 2FX9L 1ZLUH 1QR4A 3OHXB 5JW4N 3O3UN 3T2OA 4Y2DC 3RBSA 3CFJA 2AK4B 5F7DB 2FHBA 4W4OA 1FFNB 3ZHLA 5HYQA 4ODUA 2FDBP 4I18B 1YPZE 2PTTB 1KACB 1Z0MA 2FEDD 2WWMD 2YUXA 3PQYA 4LLUA 3RVVC 1N7ML 3ILQD 4QOKA 1I3RB 4PJ8C 2VKXA 3FB5A 2CSPA 3VMNA 1W72B 5TDOA 2G9HA 1CTNA 1ONQA 4YHIA 3FB6B 4NZRL 2BVQB 4PJFF 1BZQK 3U4BL 4PUBH 4HWZB 5HGGS 4UDUB 3TT1H 4EN3A 4K3EH 4WU7A 1RZKL 5FIEA 5E8DL 3VXMA 4IOFC 4LEXH 3V0WL 1VA9A 4H1LA 4YHIB 5CSZA 1V7NH 3UAJD 2NY1C 3B2UC 1J1XL 4FXKA 5F9OL 2ITDB 3TO4D 3A6CL 5JPMB 1F3JA 4HKZB 2D0FA 5DA4A 3L3JA 4OB5L 5T1DH 4AT6B 3HAEB 3JV0A 4N1HB 1ADQL 4HXBH 2ZCKH 3FHQA 3SDXB 1KCRL 4KPHL 2OCFD 1KSRA 3ME0A 3QXWA 2DLGA 4XWGH 3TN0C 1NGYA 3U79A 4FMFA 4G8IA 4GG8B 4H1LH 3BP6B 1QSEB 1JCKA 4MA1B 3W11C 3NACH 3WJLA 2FGWH 2VDLH 5JW4R 3NN8B 2R4SL 4OIBA 4K7PH 4TUJA 3W0WB 4R2GB 3IGAA 4YLQT 4QF1A 1NSNH 4HWNA 1Z5LB 4E0RA 1E4XL 3GO1L 3O8XB 5HHMD 3DRTB 2CLRB 4ZUUB 4OGXL 4D8PA 1WZKA 3E1F1 1AGCA 2YK1L 1PGRB 2J6EA 4GAYB 4XPAL 2FL5B 4JJ5B 2M1KA 1KELL 4U4BA 4Q9QL 4I3SL 3EO1A 1NMBH 1JN6A 4JPWH 5I1EH 3NFPA 4TTDD 4N0FB 1X5JA 4JO1L 3P11L 3MQIA 1CK0L 4GW4B 3UZEA 5CLWA 3RTQB 1ZEAH 4JRXA 4FFYH 3L5WA 4WEUD 3FTGB 5IHUH 5F72S 3GMPA 3PP4H 1HI6A 4CBPA 1LO0H 5F96H 5C08D 3SEPA 2VXVL 5EU4B 3K3QA 3SGKA 4OFPA 3DROB 4MWFA 3X3FH 5DRWB 4UBDC 5DS8B 1LP9E 1ONQB 1P9MA 2NX5A 4ZFFB 4N1EA 3EW3B 4HIEB 4R4ND 3C8KB 2DICA 2GK2A 1RZFL 3NCFB 3LQAH 1MCNA 3GB7B 2HFGL 3QFDA 5JORA 4I5BB 2VXSH 2NXZB 2R29L 1P4LA 1U58B 1FNGA 3JWDC 2MPAH 3FFCB 1L7TL 1WSST 3HI1B 1T4KB 1MIEH 3CVHB 3BOVA 2YRZA 1DBKL 2HP4A 4DEPC 3QCVH 4HG4K 1AP2B 1W8OA 5D7SH 1BFOA 1U8IB 3BKMH 1YEKL 4GRWE 4Y16D 1DTUA 1OTSD 2J8UF 3N9GH 4L4TD 1CICC 4X6DB 1NDGA 3PGFH 4D9RD 5IW1A 2V2XA 4JGUA 5E2UH 4PGJA 4JM4H 1ZV5A 4F9PA 1JPGB 5LJYH 2HKFH 2WLZA 1RZGB 1ZTXL 1J10A 1FL3B 5GSRA 3V7MA 2E6QA 3SDDA 1J18A 1AD0A 4MHHI 5FO8A 2AJVH 3AB0C 3UTSE 2GJZA 5MEPA 5T5FH 5BXFB 3QIWA 4GO6B 5GSVA 1AD0B 4NJAH 2XG4A 3KR3H 4P2YA 4HGKC 5CUSL 1CGWA 4V2CB 3NZ8B 3U2SA 1TIUA 4XB7A 3RHWF 2GCYB 1FSKB 3L1OL 1U93B 4P48A 3MLWH 3GKWH 4L8BA 1D3CA 3OXRB 2Q20A 1OP5K 3LEXB 3IJHB 4IRJA 4KAQL 3ROLA 1RU9L 1MCEA 3C9NA 4K9EH 1KCKA 3H8NA 4P46D 4D9LL 3EOTH 4HV8A 3BJ91 4DAGL 1W0YT 3D39B 3OKOB 4ZFGL 1FNSH 3IJHA 4IRJB 5TE7L 1NPUA 2NXYD 4L3AA 5F3BB 1T5WA 1M6OA 3KPPA 2D7QA 1G1YA 4U2ZA 2OTWA 3SDAA 1OF2B 2VAAB 4JM2F 2UVEA 3PE9A 2ZOKA 3T77B 5LAXB 1DANT 1A5FL 5HDBE 2BHZA 4LLUB 4MCZA 3LV3A 3LN4A 1ZWIB 4FG6C 1RURH 1MFDH 5IOPA 5A40E 3O3DB 5CGYC 3MRDB 3SJVD 4JZNB 3N1GC 5I15H 4HH8A 3PHQB 2R56L 4NHUA 3BZEB 3TF7C 3BJLA 1IGML 4U1IB 1RUMH 1YNKH 1I9IH 3QNXA 3U7WL 1J8HE 2Q7YA 1OWRM 4I9WD 4U1IA 4AEHH 1FN4B 2DQHH 4XNXL 4HFUL 4NZJA 4RRPA 5HYSA 5DZOA 3VWJB 3BEWA 1H0DA 1HOCA 3CVHA 1UXWB 5FK9B 1YMMA 3ARFA 3QIWD 4JGMA 5D1QB 1J1OH 4YXLL 2X10A 3FQWB 3MYJB 3U0TB 3UJJL 1BVLA 5DFVD 3SKJH 3NIDF 2XNAA 1BF2A 3QFDB 5ESVB 5JORB 4I0KA 1NCBL 4M6NH 4QGYA 2GK0B 5JIPA 4DQOH 1J05A 3KPRE 2YA0A 3O8XC 1CF8H 3CIQA 1WZLA 1BQUA 3TESA 2AEIT 1F42A 4TRPH 2FR4A 3QEUB 4V1DD 1T1ZA 4MAYA 1ZVSB 3PABA 1Q0YL 3LEVL 2VDQL 2X9YA 3KYNA 2VQTA 2QQKL 5HVFB 4OBSA 2ID5A 1XMWA 2G60H 1S7QA 2C7UB 1T0MB 2R2HA 1REIA 3NIFE 4ZSOB 4EQ2A 2XT1B 3K1DA 4LLVA 1JZ4A 4MAYD 3VWKB 3L3OB 2VABA 3EYQC 5EU6B 2XTJC 5CEZL 3PWLA 4YBQD 5IV2A 5FYLE 4PJXE 5D1QA 3KYAA 1JGLL 1R6VA 1SBSL 1U8LA 4S0TD 3GMOA 5C9KA 5GSVB 5F6IB 4KKLD 1LDPH 4JY5H 3ZE0F 5HI3D 4UIKH 5CD5D 4TVPL 5F8QC 1FYTE 5HDOA 4Z7WF 1XF4B 1LMKA 4NT6B 5EORL 3CDGA 4PP2A 4DK6A 3GSWB 3JTTB 1MWAH 5LGHH 2DAVA 4K7FA 1QSZA 3ZTJG 2DLEA 4HK0B 3CK0L 1RVFH 2YPLD 3CXHJ 1EAPB 3TIDA 2C4FT 2CQVA 1CXKA 4PLKD 1FZOA 1QFOA 5D70H 4WW2C 3FT3B 4QGTA 1NUFA 1IQWL 3GHBL 1P7QB 2A2QT 2YA1A 4ELME 4FZEL 3EO1B 4GXUM 3KR3L 2Z31B 1CLZH 3FN9A 4F7EB 4WWKD 2VAAA 5IHLB 4L4JA 2N4IA 4PJ7B 4KRNA 1MI5D 1T2QL 4NO0B 1H8OA 4PJEA 3O2DH 2C3XA 1H15B 1EERB 1GIGH 1QYGL 4WI5A 3QZWB 4PJEE 4NRYB 4PJIB 3WUWG 1S7UA 1U8OB 4LK4A 4IEFB 4A6YH 2CD0A 4RGNE 4Q6YA 3HG1B 2XFXB 1PG7H 3O3BA 2R0LH 5GIRB 4NNXA 3C5ZD 4F58L 4YQXL 1VACA 3WD5L 2VO5A 2HA1A 4XPFH 4X7DC 2ED8A 4BZ2H 1RUPL 4UOW0 3SDXA 4K23H 5BVJA 3CMOH 4O58H 5EZIH 3D85A 4PJFE 1P53A 4CNIA 3BP5B 1EHAA 1WFTA 1FH5L 5JDSB 2DQGH 1JNLL 1YNLL 4GQ9L 5I1IH 3BXNB 4Y5YA 4YIQB 4YHYB 1N6UA 1Q9KB 5ITBH 3D5OF 3V7AG 1EBPA 2V5TA 3PGFL 1S5HB 3TO4B 4ZFZB 3ULVD 1DL7L 1R3JB 2VDKL 1OW0C 3ARUA 3C6SB 1SJHB 3L95A 3SKNA 3B3IB 1S7WB 1JZ7A 3RVUD 4HX1B 4F8TA 5IK3A 3QUZB 4ELMF 3BPNB 1C08A 1MCQA 3HR5A 5CJXC 4OZHB 5ISZD 2OL3B 2ICEB 3DSFL 1PZ5B 5TDPB 5D2LA 3P40A 2FJGB 4MAUH 5EIQA 4XAWH 1FNFA 1GHFL 2DI9A 3F6IA 1U8PA 4JCLA 3BH8A 3TPUB 1A6UL 3UBXA 2PKDA 5KVDH 3WEXA 1D9KC 4PJEF 4R2GD 3LQAL 1P4LB 4KPHH 5F6IC 5GHWH 2D31A 3QUZC 1NL0L 5F9JB 3SKOB 1Q9WB 4JG1L 4N9GA 3IDNA 1UM4L 4MCZB 2IFFL 3U6RB 1T0NB 3MCLH 1JPTH 4Y4FD 3V0VB 1SYVB 2V5YA 4HCRL 1MREH 3MFGB 3RZCA 4U7MA 3LKRA 1NFIB 2XZQL 1I7RA 4IJ3C 3MOQA 1IGCL 2LU3A 5DD5H 4U1GC 1KOAA 3GNMH 1UC6A 4OTXH 3THMH 4J1UA 4OFIA 2MQ0A 1YECL 5GS1B 1T1XB 1VEPA 5A43C 5E6IB 3KLDA 1HINH 5CIPH 5AYQA 4AENA 3GRWL 2ESVD 3EFFB 3L3OA 3C60B 3UTPE 4Z7WA 3PIQA 1V3JA 1AO7B 2E8ZA 5BVJB 1RIVH 4OJFL 3T2NH 3NBNA 3DGGA 5I6XB 2IPUG 2EICA 4LARH 1KIRA 1NDMA 4WFEE 3DJ9A 3KXFA 3MCLL 4NQCE 1FL5B 1U95B 4HMDA 4PG2A 4R4FH 5ANME 1GZPA 1SEBA 5D9SB 3TJHC 3MLUL 1WIOA 1GOHA 4X83A 4BFBD 3IGAB 2E6JA 2GJ6D 1HKFA 2FB4L 4KQ4H 3H3PL 4XPHH 1BWWA 3BZDA 3RU8L 3S34L 4LNRA 3HC3H 5E2VH 2A9MH 1IZJA 3U9PH 2QBWA 1RJYB 1XEDA 4S11A 2HT4C 4G6FB 5DI8B 4Y88A 4QXTA 1I1YA 4DCQB 4MA8L 1WGOA 1I7UA 5ISZE 4KQ3H 4G80B 3MFFB 5IFHL 4PJ9C 2RJMA 4OT1H 5MEOB 4KK6C 5HGAB 2H6PA 3DX7B 4M61B 3WS3A 2FGZA 3BD4A 4F33A 3HRZB 4AL8H 1PG7X 1QEWA 1HNGA 4NQDD 3VXOA 1V8HA 4QRRE 4UNVA 5CD5C 5HI3C 3RWGA 5I75C 4F9LC 5GZOD 3OR7B 5CSZB 1RFDH 4PJXF 3PNWB 4K94H 4M7JL 4FQLL 1N3NB 3QUXC 1BFVL 3MRJA 3FMGL 1G9NH 1S9VB 2Z92A 3JWOC 5C3TA 5CIPA 1VADB 3HI5L 2C1OA 3M8OL 5HXMA 1XCTA 2AXHA 1JMZA 4JM2A 5GRUL 3O3EB 3OAZK 4PP1D 1WZMA 4XZUA 1W72A 3HUJE 3MV7E 4BSWB 4C56E 4PLJC 4POYA 3PWNA 1IC5L 1WZ1L 5DRWA 4HW6A 4XMPH 5GS0L 1NAMB 1A1NB 3QPXL 4YNYB 4NNYA 3PWJA 1XGQB 4Y89A 3VXRE 1JMXA 3ZKNC 2XPGB 3P30H 2GUOB 4XXCC 3PWLB 1ZLVK 1S7TB 1HIML 3Q5YA 2Q76A 5IWLC 3LPFA 1CN4A 4XPGL 2ED9A 1UVQA 2Z4QA 4OCRL 4UV4L 4E42B 1WJ3A 4C58B 3MV7D 5CCKL 4P4KC 2FL5A 4JJ5A 2OMNA 5I8OL 1B4JL 1IAII 2CKNA 1JTPA 3GBMH 2NPLX 4PJGF 3SO3C 5ID1B 1DQMH 4FZEH 1C5BL 2MJWA 3OXRA 1WBYA 1A1MB 1CGTA 4JO1H 4PRHA 4Z7UF 1OGTA 3JVGC 4OD3L 5F1NA 4NN7C 1ZHNA 3ARGA 5D96C 3QJFB 4ZTPL 1YMME 3DSFH 4KJQC 4L3EA 4OZ4B 2JIXD 1TFHA 4OSUH 3QDGD 3SGEH 5DJ0A 4K8RH 5C08E 5I18H 1IGYA 3SDDB 4ZXBD 3DV6B 4NUGH 1PX4A 4LP5A 2A77H 3MUY1 1NGQH 3ZT5A 4QWWC 5F7FA 2NZ9C 3GJFH 5H94B 4M7KL 1NL0H 3PIQB 4LLQA 3NACL 4G8EA 5JXAH 4P2RD 3F7VB 4OD2A 1A0QH 5D1ZC 1UEMA 1TITA 3KPLA 2PR4L 1ZVYA 3E6FA 2X89D 3H3KA 3QWRA 4JO3H 5CKAA 1HHGA 2JK5B 3WBDA 3FB7A 4APQA 4R26H 1OAZL 5DD5L 1V3KA 1KN2L 5EG6C 4HXAL 4EN3B 2X4RB 5D1XC 2F54E 3ZDXF 3HFMH 5D71H 1WEJH 5GGTA 1ZVSA 5CZKA 2NY0C 4XP1H 5EULV 4FRWA 1AQDA 2PCPB 3IJSB 4P3DB 3MLXL 2RAMA 3LV3B 2QQKH 4L4TE 2F53D 1DBJH 5IQ7L 2HFTA 4HULB 2BSTA 3SQBA 4ZFOA 3PL6D 1J11A 1WISA 4N9GB 3K0WA 2NW3A 3IF1B 5ABDE 3MYJA 3U0TA 4RBPK 3B9KB 5SWZB 3MC0A 3V95A 1FVEB 4IDJH 1A47A 1Y0LA 5I1KL 1RUPH 4XCEA 2EYRB 4U1KA 1RD6A 4NQXA 4U6HA 1VHPA 2JK5A 1B3JA 2Q86A 3M1BB 5AG8A 4M6MH 4Z95L 4HKJB 1F3RB 2HG5B 2DKSA 4XP9H 4K71B 5MEND 3MJ6A 1P2CB 1FVDB 5F1NB 2AK1H 3KLHD 3QG6A 1BQHA 4WTWA 2HT3D 1F11B 2Y5EA 4IM8A 1MWAL 1I7UB 2DQJH 1PLGL 5FYLL 1NCWL 5D2LF 4PRPB 3H9SD 4DAGH 4POUB 2GJZB 1L9NA 3AS1A 1N0LA 3H9SB 4PY8J 4KGJA 4QCIB 3KDMB 5GISL 4QF1B 4MNQA 3AROA 2X4SA 5DJYA 5FYKU 3BRGC 3PV6B 4GAFB 4QRRA 5K9JH 1V7ML 3SO3B 2GQHA 1FIGL 1KXQE 4I48B 4ERSH 1QLFA 4P3CL 3DURA 3BWAB 1NEZB 4JFDB 4JY6B 4HZLB 5EOCH 3GSRB 1JZ2A 3L5XL 2FIRT 2MCG1 1KEMH 4ORGB 1HSAA 4DKDC 3K2MC 4FQ2L 5I66A 3DX8A 3S37X 5I30L 1BGXH 2H32B 4HIIB 4XVTL 3TH3T 3MV9B 1PBYA 5CJ5A 1F4XL 1AQKL 1EVTC 4UIKL 1FNGB 5C0DB 1FG2A 1MLBA 3VXRA 1F3DH 1I7TB 3QEHA 4RFEB 3BVNB 5J89A 4PGDB 5C0BD 4MB5A 3RDTB 4I2XE 1EXUB 3S8WA 5TF1L 3VXOB 4G5ZL 3HRZA 3HPJA 2WQ8A 4NUJA 4NQDA 2R1YA 3DYMA 3QUXA 4F3FB 1CDBA 3O2VL 5HVHB 5HHOD 3JV5A 1RI8A 5L7XH 4XP6L 3BT2H 4QOKB 1XR8A 1A4KA 3I2CL 4V2BA 2MQCA 2ZWLT 3UTZA 1UH4A 1RHHA 2OZ4A 4RMSA 1DN2A 2AV1A 2R29H 3V5KB 4BQ8A 5MENE 5KSBF 1IAOA 4NSKA 5DHVH 5E1AB 4JZOA 4P9HC 2P44B 5EOQL 1TVBB 3TNMB 4CVUA 4U1NB 1GGCH 1AD9B 1I4FA 2PW2B 4KI5E 3EDDA 1S9XA 1T1YB 3UTPD 5IWLA 5DJXB 2O5XL 4JQXA 3SKJL 1N26A 5I1JH 4GBXB 4FOMA 3KJ4B 1YEEH 3VFGL 1QSFB 3S88H 4LKCA 5C07B 4H5SB 2VL4A 5I16B 5ICYB 1I3VA 3PDDA 1SEBB 5D9SA 3I6LD 1OGAB 2BC4B 5DWUL 2E7CA 3IKCA 3QCTL 4YK4C 1AXTL 2IPTL 3WL9A 4DN3L 1JL8A 3Q3GA 1IFHH 1Q1JH 1QFWL 3ARQA 4QRPA 3NABL 3V4UH 4M7LH 4BQ9A 2W60B 4NZUH 1JWSB 4M6NL 4CAGA 3QT2A 3MUZ1 1JYXA 5KOMC 1CE1L 4J2XA 1W0WA 5C0RH 1IE5A 2J4WL 5JPMA 2ZPKH 2FGWL 2VLRB 4JKWA 1QQDB 3DETC 3GIZH 4DZBB 1Q9WA 1G1CA 4JKMA 3AXLA 2FEDC 2WWMC 3QEGH 1G7LA 1UA6H 1DUYA 5GS0H 1W72L 1CK0H 4QRRD 3LKQA 5E6ID 1OAUH 4HEME 4QXGL 4WI9A 4DK3A 5IGXL 3BYYA 3SDCD 1N59A 5DMIH 1BFTA 5A2IH 1JJUA 5MI0B 5CILL 3M17A 4PJ7A 4YXKH 1R3IL 2FJGA 1N2RA 3P9MB 1DSFL 1PQZA 4LVOC 3RPIB 1BM3L 1JHLL 3TA3B 2AABH 1B0GB 4P5KB 3JXAA 4OZGE 4HUVA 3BPNC 1NFDE 4ODSH 2ZUUA 3DUHA 5ICZB 3W2DH 2WBWB 5ENWB 1PFCA 5EOCL 4XNMB 2UZYB 3QUYB 2H32H 3T2QA 3JZ7A 4Y5XB 3QHZL 4EI5D 4EEEA 3U7YH 3A0OA 2KQMA 3ULSA 3X13A 1LNUB 2VLJA 1WAAF 5D2NC 2HLAA 2VYRE 3GIVB 2P5ED 2N7AA 5FDWB 4MA7L 3ZYJA 1GPOL 4XAKD 1BGXL 2F5AL 2E5EA 2HTLC 4OUOA 3VXNB 2DQDH 4L3CB 1MHEA 4XPGH 5F7EH 1I8IA 2E7BA 4OM1L 4YX2H 5T1LD 4NP4L 4EXPX 5CINL 3CFBB 3RP1A 3B9EA 3QPQD 2B0SH 4R0LC 5DJAA 3T8XB 4KVCH 4XNZB 3ARZA 3ZYOA 4R4BA 4A6YB 4DVBA 2DQCH 3D85D 3F58L 3QQNA 2ICWJ 4XGZA 2EH8L 4P2OA 3P0VH 2IBBA 5DQJA 3IDYC 1K2DA 2VN7A 3MUJA 2DQTH 1DLFH 3C5ZA 1JK8A 2BVEA 2R0KL 4AMKH 2V2TA 5I71C 5IP4A 2FB4H 4TNVK 5DR5L 3MRQA 1KB5B 3QH3A 2BJML 4B7LA 4ZQKA 2CRIA 3MLVL 1OCWL 2UY6A 2IBZX 1WVZA 2QV2A 2Z93A 3WFHB 3C2AH 2VQUA 4RGMB 4ZXBA 3VFOB 1H5BC 1XF5A 1FNEA 4HWEH 2AQ2A 1F02I 2F8OA 3CCHA 1RHHB 2I5YH 4HCRH 3IETB 3R0NA 4OQTL 2VDMH 3P4MB 4NRXB 1LE9A 1LP9B 1KN4L 5EO0A 1T7WA 2XZAH 3QQ3B 1N64H 3TBYA 4MQXD 3SY0B 5B3JE 5IW6B 4LVHC 2P8LB 4JPIB 2VLLB 5AUMA 4O5LH 4CADB 5I19H 4YHOH 4FZ8H 3MJ8B 3FOLA 4BZYA 4PRBA 2IAMC 5D7KE 4IOIA 3HNVL 2P8LA 3QJHA 2IQAB 1H8NA 1U58A 5F70A 3IDGB 4E41E 4RFEA 3EYSL 1DJSA 3WSQH 3WN5C 3DO7B 1G7PB 43CAB 3UBXG 3GHEL 2E9WA 4K7PX 5KSUB 4GG6A 3LEYL 3AS0A 1YN6B 4XX1E 2A77L 4F7MA 5HHMB 2ESVE 3SE8H 5DC4B 4KJWC 4ZXBB 1IKNC 2HWZL 4ODHL 1T6VN 2Y1VA 3HPJB 4S1DC 32C2B 5FHAL 5JQHC 1OL0A 4DTGH 3DWTA 2K1MA 4FTVE 1JF5A 3S4SA 5EU4A 4X6DE 1JRHI 4U3CA 2BCKB 3GMRB 2AP2A 3MRCA 2EEDA 2LVCA 5JHDD 4NJ9H 3NTCH 2F8VA 4OI9A 4M02A 5TPWH 1CL7H 2HJFB 4MXQC 4QNPE 5B8CA 5KN5B 4XP4H 5EA0L 1FAKT 2J7LA 4DKFL 3I6KA 4K8RC 2C1PB 1MQKH 4QHKI 1MIMH 1BD2A 2VXQH 4ONHB 3NFPB 4HS6A 3MBXL 3GJFB 5F97E 4OCNC 1MJUH 5L9DH 3PWPE 1G7JA 2DS4A 4WI2A 4XCFH 2W9DH 4F7CA 5J9PA 4TPRH 5AD0B 4BKLB 5L2JA 3A6BH 3LQZB 1I9JH 2AJUH 2H8PB 1CCZA 2DWDA 4UB0H 4QLRA 3U2SB 1GGIH 3VXNA 4TUJB 2VWEE 2YUVA 2J12B 5E2WL 2ICWA 4DUVA 4LSVH 4I0PA 4GQPH 3CU7A 3V5KA 3GSXA 2X42A 4NKDB 5D5MF 4NCC1 1UB6A 3RRQA 1TNMA 2YN3A 3U9PL 3MXWL 2Y7QA 3RBGA 3T1FA 5GSRB 3OKYA 4M4PA 3RVXC 2RGSA 1AKJD 1RZGA 2V7NA 3JV6B 1X5FA 1LD9A 4TOYH 1OP3H 3QO1A 1BQHB 1M71B 2PF6A 3ARGC 4YC2B 3U0WH 3QHZH 3GMMB 5ID0A 2YC1A 2LV4A 4OLUH 1UM6L 3CFKA 1TXKA 1UB5B 1CLOH 2F53A 3O0RH 3LN4B 1BBDL 5EZOH 1TJIL 3DX9B 2LU7A 5JLZB 4GSDH 2F19L 2ZOKB 4JB9L 4MXVE 2O26U 4NQXB 2BVTA 4K3HA 5LKNA 4U7KA 2H8PA 5IJVA 3MRNB 3VDAA 4F37K 4EI6A 4BJLA 3FFCA 4ZAKD 2GIYA 5ESAB 3V5DA 3VWKD 4RWHA 4POZD 5MP6H 1NGZA 4JHAL 3VGBA 5AG9A 4LRIC 2CRYA 4EDWL 1ZT7A 4MCYA 1GC1H 1J8HB 2X4NA 2IADB 2HJKB 2EDWA 5HHQB 3B9KC 3IJSA 2P8MA 5I9QC 3QIBD 2DBJA 1JNJA 8FABB 3SDAB 3VFMB 1IGCH 3O9WB 3U9UA 1M71A 2V9QA 2XZQH 4XH2B 3FRUB 4HS8L 2PYEE 1KT2B 3RWEA 1JGEB 5FYJH 4HLZH 5E9DB 5DMKB 5CFHA 2JCCB 3DRQA 3KPQB 4P46A 3V4UL 1YEHH 1VFMA 4U3HA 3SCMB 4R7NB 4KJPC 5I1GH 3V79C 4M1DH 3V6FB 2HRPH 5KZCD 5DD3L 4N90D 5F1SA 2H26A 2I07A 3BI9X 3MJ7A 4OLZH 4KY1L 5EBGA 5CZXC 4MGXA 1FFQA 1SBSH 3L6FA 4R96A 5CJOL 3WLBB 3FCTA 4K2UL 1A4JB 5D2NE 4MJ2A 1TDQA 5AAWA 4HT1L 3GGWA 1S7RA 3G6AA 3T0DA 4Y4FA 2MCPL 4Z7UA 1FV1A 3VFWB 1OP9A 1AKJA 2HLFC 3L3DB 4O51B 1S9XB 4FQXD 1BVKB 1HCFX 4EVNB 4R97C 4WWKB 2EZ0D 4N8VA 5CSBA 3X17A 1S8DB 4YXHH 4XCYB 3NABH 1BM3H 1JHLH 3RY5A 3WFCL 5E8EA 2GT9A 2YBRA 5KAQF 1KT2A 1R24A 2XA3A 5EU7E 4RNRA 4CKVX 2B4CC 3RIAK 5E8PA 1ITBB 5I1IL 2VB5A 3VU2A 4YR6B 2F9BT 3OMZA 3MRRB 2CR3A 2VC2L 3PWUB 4KTYA 5KVFL 2OLDA 5JHDA 3RIFK 3CU1A 3O6LL 3MBEA 4D2NA 3BRDA 3HE7C 1AP2A 3WFBL 1FLRL 2DYPA 1TPXB 1LILA 1X5GA 4LBEB 1IGTA 2X5PA 4LAQH 4JM2C 1AXIB 4G6MH 3DUUB 1BPVA 2DL9A 5GJTL 3BSZL 4GBXD 2B1AL 3NCMA 4OZFA 4X4XB 1BBJA 4FQ1L 4PG9B 5BZWA 4MXVF 4MNQD 4G5ZH 2APVA 1JNNL 5DD6A 4I5BA 4RFOL 2BVUA 2BOCA 3FN3A 4GXUN 4PG9A 5FCUL 5BZWB 1WC7B 3TIEB 5KSAA 2IJ0C 5EPMA 4G6KL 4HIIA 4WV1C 3TWCH 1YN7B 4NNPL 3O4LA 2HTKC 1U3YA 4Y4KA 4F7PA 1IC4L 1MHPH 4KKBD 1JN6B 5EC2B 2HVJB 2I27N 2BSRB 1EFXA 4PJ7E 5E4IA 3O4LE 4QRUB 2HVKB 2SEBA 5D5ME 4FFVC 5DMJB 4PBWD 5FKPB 4JZJC 4XP5L 1VERA 3FN0L 1HILB 4L29B 4BSVA 4G7YH 3H9HA 3R06A 3NFSL 2GHWB 4NKMA 2VWEC 3FAXA 1UYWL 4PJIE 1MCHA 3OG6B 4Z78B 4HS3B 2VE6B 3GJEA 4BFEA 3MOBL 5DEFB 1AHWB 1U6AH 4XNXH 2JB6B 2EC9T 4RGNB 3RGVB 4MQXC 1RVFL 1VFAB 5KVMC 4DOHE 1Y6NR 4X6DF 5FF6A 1OQXA 4S1RL 1KLGA 1BJ1H 1MJ8L 4PRPA 4NFDA 4M93B 3H7BB 3RWDB 3T0EB 1OD9A 3FB8A 4KHXL 2QSVA 3NCJH 4EDXB 3L7EA 4YDKL 1NCWH 2O5YL 5T3XH 2HT2D 4NQUA 1EHNA 2EE2A 4R0LB 4FABL 1LDPL 5JPNB 3CX5K 3K74B 4ZO6A 2VXTH 5DK3A 4PJDB 3C09B 4ONHA 1A6TB 3GM0A 4P2OD 2M26A 1F3JB 1U3ZA 1OW0A 4WJ5A 5FUCC 5DO2C 3EJJX 2ZUSA 1KXVC 1X5HA 1IM3A 3NFSH 3AU1B 5DURB 1FJ1B 3GBLA 2J88L 5HGHB 1CE1H 1GJIA 3WNKA 4PGEB 4JHAH 5IQ9A 5GISH 2ZKHH 2YEZA 3FB6A 2G9HB 4NO2A 4UV7L 3CSBA 4D3CH 4ENEC 2IG2H 4OUUB 1FNLA 1F3DJ 3RNQB 4KK5C 1P1ZB 1MWAA 2Z91B 2NTFA 3EOTL 4ZUVA 4WI4A 2FBOJ 4HC1L 2W60A 2A6IB 5IGXH 4PTUB 4JFOB 4HH9A 4AL8L 1MCOL 3IFPA 1HHJA 3WNMA 3OF6A 4XP1L 3REWB 3HTLX 2Z8SA 2DKMA 3ALXA 3OKEB 1YEJH 1MEXL 1UWXK 4L9LA 1CLYH 1RUQL 4CVZB 3QQ4B 4MA8H 5JIKA 4O4YL 1G9NC 4DGVL 1Z9SA 3DIFA 1E6OH 4WDIA 3KPLB 1QRNA 4DWHA 3M17B 2O5YH 5T3XL 3ZZ1A 4M5YH 5E7BA 4ZS7H 5HDLA 4UT7L 1I1FB 1XGYH 3MV8B 5C9JA 5H2BB 3CDFA 3DV4A 2AXGA 1I9JL 2AXFB 2APXA 2Y7QB 1JPFA 1P1ZA 5DGQA 1YNTB 1INQA 1QFUH 5I76A 5IESH 3DV4B 2E27H 3C5JB 3I2CH 3MGOB 3IAGC 1PY9A 4U1LB 3ZKXB 1AO7E 3T0VA 2ADGA 3V6OC 4YDJB 4X5XB 3ARSA 5I1JL 3BD3A 3VI4E 3UX9B 3UTZB 1JWMA 4Z76B 4ZFZA 5I8CB 2D4DA 1ZA3A 5D7JA 5ANMB 1EFXB 3P11H 3QQ4A 2MPAL 1H3VA 3SCMC 3I02B 3LRSA 2BX5A 4XNYH 1OHQA 4PRIA 3CFBA 4OV5B 1S7SB 5CS7A 1ZLWH 2WUCL 2YWZA 1BD2B 5J11B 3LAFA 3UZVB 5FUOL 4EDXA 3EO9H 1X5ZA 2LFGA 1KTKE 4ZOAA 3T3PE 1LO4L 3I9GH 2VL5B 3L3IB 4KTEL 3ARED 4NRZB 4OCLC 2P8PA 5JW4M 3DVNA 5KANI 5L2KB 1KTDA 1YEFL 3QIUC 2VLKE 1JNHA 4Y16B 1JYVA 1T66D 1BFSA 4W81A 1NC2A 1MLCA 3CJJA 4H1LG 1BECA 4OLZL 4L4VA 4Q9RL 1UM5H 1P69B 5K9JL 2O5ZH 3CXDH 4MX7A 3I50L 3MRBB 3L3KB 1DVFA 4XVSH 4YHML 1A4KB 3TZVC 1N3NA 3ULUC 3D0VB 4ODWA 1NGXA 5D72L 4KZDL 2CXKA 4PRDB 5FYJL 1AC0A 3WLWC 3CFEA 3LKPA 3HR5B 3ALPA 4C56B 2CKBH 4N0UA 3BH9B 5IF0A 3DMMA 4YFDB 5E2UL 4UTBL 1D5XA 1RZKH 2XWJA 4L4TA 2EKSA 4WU5B 2ZP0T 5ACMA 3TT1L 5HBBA 4IIQA 3MV7A 1UZ6E 3VXRB 5LCVL 2FBJL 2CO6B 4K2UH 1TETL 5IIEB 3VXRD 4BQCA 3V4PL 4MJ6B 5D1ZB 5T3ZE 1B9ZA 1QACA 2GJ6E 5CUSH 4CNIB 3U46A 4U05A 3G04A 4EN3D 4HJJH 4M6AA 4Z8FL 4FQCL 1KNOA 5ICXB 1SJEA 3ARDA 5TFSH 1S9YB 1J1PL 5DRXB 3T2PA 1HHHB 3SE4A 3MMEA 3MBED 3WXWH 1XF1A 2KH2B 5IHBA 5DHXB 5CMAB 4UINL 1K8DB 4KAQH 1Z3GH 4Z7QF 3IKCB 1IAKA 5L8JB 3CC5B 1NGWA 1UACH 5BW7C 4G42A 1A7BA 3VFMA 1UQSB 5I1CH 5JHLH 4RAVA 4PJHB 3I84A 3MCG1 3EUUA 1T22A 2CK0H 2MHAA 1YEGL 4TPRL 2ARJB 1T21B 4XCFL 1CD1A 5B3NA 3VA2C 4HXAH 2BXYA 2F5AH 5HHPB 5D7LE 1OPGL 4RAVB 2NXZC 2FD6L 3PWPD 3FB8B 1TJHH 4JRXD 1LHZA 4L3EE 3RWCB 5IB4B 2RIKA 1RMFH 4LCCB 5E2WH 5KAQG 3DARA 2Z31A 3OKKB 3RKDD 3BD5A 5DHVA 3ZHDA 1ZMYA 2DBLH 3OPZH 3KJ4C 3QO0B 2J88H 3ECBA 4NUGL 1EK3A 5E5MB 2WBJC 1YMHA 4YPGB 5DGRA 1MREL 3INUL 4ZMAT 3EJZD 3F7PC 4H25B 2F54B 2HT3C 1QA9A 3AY4A 2AEPL 3KLHC 5BRZE 5DVOA 2BXZA 5H2BA 4D0CA 3W9EB 2AQ1A 1SEQH 2ZSVB 3AMLA 1T20B 3MRGA 4N8VG 3NCJL 3RVWD 5JOPE 5BVPL 4YPGA 4LPYA 4NBXB 1NCTA 3IF1A 4GMTH 5I17A 1D5ZA 5JTWA 4PGZA 3KXFD 5FHBH 2X1XR 2BNRE 4MNGE 1KCSL 1K6QL 3GUTA 1UADC 1PZ5A 5BS0B 1G7IB 3SDAD 2P24A 3D2UA 1VEOA 1GHFH 4UB0L 3VG9C 5T1KD 3QO0A 1MRCH 1S5IH 4ZNCD 3AM8C 3E6HA 3TBTA 1I9RH 3OKNB 4DGYL 5KSBB 1LO5B 2P5WB 3TO2B 3FFCD 1NBYA 2FJHB 1YPZA 2HYMA 5CD3B 5JOPD 1UM4H 3L9RB 2GITA 4L8DB 5IB3B 1CYGA 3DI2B 2CKBB 2CDGB 3PXHA 4MJIB 4HIJA 2OXGA 1VGEL 2R4SH 3C5SB 1MCDA 2OQJA 5FGBC 4HLZG 4Y19D 2DBLL 4O2EA 5K33A 1CBVH 5EA0H 4HBQA 1JK8B 5C0NC 3RTQC 3PWJB 1CF8L 2FLRT 1K2DB 1KUMA 2D03H 4KUZL 3HC4L 3BMWA 5B38G 2KKQA 4P49A 2YK1H 3DSNA 3H9SE 2Y25A 2FJFB 3WD5H 4FQHA 3REVB 4APQD 3P4LA 2XRAH 1HH6A 3BP4B 4IRJD 4S1SH 3HLAB 3WFDH 3RVWC 4NRYA 4PJIA 3K46A 4MJ6A 5D1ZA 2JJTA 1CDHA 4XCCH 2GCYA 1I8IB 4V1DE 1GAFH 4WEBL 3EJZC 3LS4H 1NANI 3MJ7B 3ULUE 3BAEL 3D3VB 1EEQA 1A6UH 1OT1A 4KQ3L 2A74B 3E8UH 4X6CF 5HDQH 4KUCF 4N0UB 5D1QD 5GRVK 2X4UB 2NY4C 3MV9E 3V6ZB 4G8GE 4JFEB 1DQJB 1TETH 4IMLB 3RX7A 5DJZB 1IQWH 1I1AD 1MJ7H 4XWOC 4GAJL 4XHJD 4ZDHA 1RULL 3RUGB 3EOAB 5KOVC 5A2FA 1S9KC 5HY9B 4RNRB 1T89C 2HVKA 4NQEA 2YZ1A 4NT6A 1T5XA 3R0MA 1OCWH 4P57B 2J8OA 3W5NA 4WRLA 1EVUA 3P3YA 1NAML 2WINB 2IG2L 2EEAA 4WVRA 3CXDL 3MBEC 4UILH 5I8EA 2NY0B 2I60L 1N5YL 5MENB 1RZ8A 4EUPA 3GUTB 2W65B 3L6FB 5B4MC 1ZHBB 5L6YL 2F53B 4EN3C 1S7XB 3EYOA 2C1PA 3ULVF 3WN5A 4LLVB 2R4RL 5HGAA 3C6LA 3ELAT 1T20A 3GSNH 4RAUA 1N6VA 4KTDH 4FQJH 3R1GL 3DYPA 2PXYD 4PV9A 4QTHA 4AIOA 4NJAL 1E4JA 4P4RB 2QQLL 5SWZD 1GIGL 1QYGH 4PB9L 5HY9A 4JFQB 5T3ZH 1JPSL 3KYOB 4UOJA 3MMEB 5CEZD 4Z18A 2Q6WB 3RWEB 1FORH 1QRNE 3TJEH 3MLYL 5E8NA 5DMGD 3AC0A 1X5IA 3DI3B 5HPMB 4G9FE 1OGAA 3S35L 3N1QC 4L5FL 3ZDYE 4QHNA 2GTZB 4EIZC 4G43A 1O0VA 4YAQB 1Q72L 3KPSE 3VGGA 4UQ3B 1H9VA 4UAOB 1TTUA 1OGAE 3WNLA 1TQCB 3WUWA 5D6DC 5DT1L 3V52L 1OARH 1AIFA 1R5WA 2R9HC 5D8JH 3U1SH 4KJYA 3DTXA 3T0XA 5CD3A 3S88L 1NDGB 4O51A 5IW1B 4WO4C 4XNUL 1HQRA 3IDXL 3ARTA 4OLUL 5ICZA 1F11A 1I1FA 1RZIA 4NO3A 4KJYB 3EYUL 1KB5L 5FF6B 5C0IA 5AZ2L 4NO0D 1DBML 2Y06L 4KK9D 4YDIL 4NGHH 5DUPH 4MA1C 3TJHD 2EDBA 2G5RA 2ZUVA 4FQCH 1CL7I 4P4KA 3PHOB 4TYUA 5D7LA 4X8JB 1A7NH 1OTUC 4PJ5D 3TLRA 1YYMH 1XIWC 2EXWC 1DDHA 4CU8A 1MELA 1FFOB 3O4OB 4L4VB 3CFCH 1EHLH 5DLMH 3P0YH 1FYHB 1FZKA 2F54A 4OIIL 3BXNA 3IJYB 4Y5YB 5HTSA 3BHBA 3V7AE 3DVIA 5DUML 5CP7B 5GJTH 1XT5A 2FX8H 2HJKA 4I0PB 2X9WA 1MCKA 5BOPA 3SGJA 1NFDB 3LQMA 1INEH 2AJSH 3T3MF 1NEUA 5DD6B 5HGBB 1Y18A 4KUZH 3WEXB 2EECA 2JB5H 3KPPB 3T4YA 3SGDH 5MI0C 1KC5L 4Z0BH 1U8PB 1YY9D 5HYJE 2AV7A 5IMLA 1N5AB 4I0PC 2QHLA 4C83A 4WI8A 3PHSA 1XCQB 3QRGH 4WWID 3D0VA 1ZA3B 5D7JB 2ILLA 3LDBB 1U8NB 5I8CA 5AZ2H 4QOKD 1W0VA 1RK0A 1OAXL 3P0GB 3X12B 2CKBL 4ODHH 5LBSL 2CGRL 2V7HA 3EO0B 1FNEB 3MODL 3VFNB 4PJ9B 4BFIA 1QR1B 5CMAA 3LQAC 1BEYH 1TQBB 5HHVL 4B5EA 1FRGL 1HNFA 3CUPB 1CD9B 5EOQH 4GS7B 2FH6A 4LLYB 2CLVB 1KCSH 2R2EB 4ELMA 1HXYB 1CVRA 4HMEA 4PS4L 1RUML 3VFRA 1F4AA 2AEQH 3QIBA 2YPVH 2YD3A 3C5ZB 2FHFA 1YN6A 1T3FB 1ULVA 4GLRH 3QI9D 1MNUL 5FKPA 4RIRB 5ALBL 3MUGB 3C60A 1D5IL 2Q8BL 1EDQA 1MAKA 1XIWD 3K2UH 4GRLA 4LGSB 3MLWL 4NUJB 1HH6B 3BP4A 4UAOC 3RZWA 3KS0H 5EN2B 2HN7A 1B0RB 1CGVA 4JRYE 5CEZH 4K7PY 2DI7A 1BLNB 4XRCB 3HZVB 2D7NA 4P5TD 2YUZA 3VD5A 4ODWB 1AQKH 2DF3A 1A3RL 5LGHL 5DO2D 4OZFB 1ORSA 3RNQA 2FRGP 3PXJA 4JVWA 3FB5B 1G7QB 4OF0A 4JFZL 4P2OC 5C2BL 1YC8A 4M03A 3FHAA 2Q87A 3ROOA 4K94L 3CFIC 4Y4HA 3VFVA 1AY1H 2YKLL 1M7XA 5ALCH 3RAJH 2Y6SD 1G7QA 3I75A 4WNQA 4IRSC 3DVNB 5F93C 1XCTB 3HMXL 1DN0A 5E0QA 1WBZA 3F7YA 1MCOH 5BOZG 2BSSB 1OB1B 3WFEL 5HHME 3DO7A 1QG3A 2ESVB 4UINH 4G9FA 5DJ2B 3BRFA 5L8LB 2XZZA 1PQZB 1HZHH 1N0XL 4D0DA 3L5WB 3HE7B 3OR7A 4WGVB 4JRXB 5IB1A 3MRFB 2WWKT 1EO8L 4GAGH 1YEIL 4LAJH 2YPVL 1TZIB 3F12B 1R5VB 4FTVB 5T33L 5T1LB 1OSPL 1XGRA 4MXWL 3JWDL 5E24E 1ZHKA 4GLRI 4S1QH 3EYUH 4HUWA 4K3JL 3IU4H 1CFTA 2XTJB 1I1YB 1FO0A 5KS9F 3DUSB 1G9MC 5INDA 1HQ4A 4J3TA 5E99H 1AHWA 2QQNL 2ZUXA 1WEJL 2ADGB 3N9GL 1A9BA 3G5XB 3MNWA 2P48B 4MQSB 4LVNC 1KYOK 2FJFA 2B39A 3UJJH 3QDGB 1SQ2N 5INDB 3RWHA 4XBGB 4DVRH 1A8JH 5IIEA 4DN4L 4OFYA 1QLEL 1H3TA 5TDNA 3KXFB 4YFLI 2D7TH 1BQHG 2IMNA 3VFTB 4Z0BL 5C9JB 2BDNH