4GAJH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 411-424)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
209
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDTSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 209
sequence length 217
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH02
4KROC 1ZWIA 4J3TA 2EH7L 4NO2A 5JW5A 3DMMA 5FGBA 5CKAA 1A9EA 3U9UB 5CGYD 4Z7WF 5DFVC 4MJ5B 4UU9B 3DUUA 5C07A 1ZT7A 3S98A 5J1TC 1JHKH 1REIA 3GJFA 3DRQA 2VWEC 2HTKC 4FZ8L 4QHUA 3BJ91 4OM0H 5KSUA 3GKWL 1PLGL 4W6XB 1JYVA 3P0VH 4QXTB 1ZEAH 2HFGL 1A22B 3MBXL 3EYQC 1Q9KA 2RFXB 3O6FC 4JO1L 4GRLB 2H32H 4R96A 1IQWL 4Z7VA 4JREB 4UBDC 1O7SA 5AZ2L 1M71A 5D7IA 2X40A 4NWUL 4P3WA 2RAMA 1YEEH 5JLZB 1CF8L 2B5IB 2BDNH 2H3NA 5D93C 2DI7A 3TIDA 4BJLA 5IB5B 2PCPA 1NFDE 5D6CB 4R97B 4P23D 1U8PB 2M26A 2XQBL 1U8MB 3WLWD 3OG4B 2AEWA 1W0WB 4Z7UF 2P42B 1QFWH 3AMKA 2DD8H 3TV3H 2O5XH 1FFNB 5EOCL 4HK3N 5IB4A 3QDJD 3C6LC 2NW3A 1NCNA 2PO6C 2AJ3A 1MCWM 2XWTA 1CT8A 1OGAD 3P0GB 4WO4B 4XP4L 3B9VA 3GMNA 1DQLH 4XRCA 4CN1A 3OTTA 1N3NB 3L3DA 3OL2A 5MEOB 3NA9L 3IKCA 3OMZA 4M8VA 2G60H 3GMQA 1CICC 4Y5VB 1JZ6A 1VEPA 4Y4FD 2VLME 2FEDC 2ADGA 3CXDL 2P5ED 5I8EB 4F7CA 3CMOL 3T0EE 3QULA 4CADA 1U8IB 3ZTNH 3CFJB 1O7VA 1L7IL 4MQXD 4WNQA 3R8BB 1CGSH 2HKHH 5HYSB 2VDOL 3VXNB 3V8CA 4EEEA 1RHFA 2CRZA 2OS7A 1A1NB 5A2FA 3FO0L 4NO5B 5E8OA 32C2A 4UV4L 5DK2B 4Z76B 1NEUA 3O6LH 4LF3A 4YK4B 5D4QA 1EFXD 1U3HD 2X9YA 2OTUA 3WXWL 4I18C 4HIHB 2BVTA 4LPWA 5DRWB 3AU1B 5EBGA 1X5GA 2FGZA 4L8SB 4RISH 3DV4B 3QUZD 1I3VA 2YK1L 5AYUH 1BQSA 1EMTL 4NNXA 2OQJB 1LP9E 4DVBA 3OAYH 3ALPA 4TULL 2UWEB 2FGWH 4G8IB 4HUMB 3W2DH 3TPUB 4TTGA 2X4NB 3MRCA 3X13B 3EOTL 2X09A 2CKBB 4DUXA 4OD3H 2X70A 4QTHA 5DJDB 1K4DA 5GISH 5C0BE 1BQUA 1DP0A 4RGNC 3SJVD 1JV5A 3NFPA 3SGKA 5DUML 3DETC 5GGVL 2C3VA 3LEVH 2NY4B 2APVA 5D8JH 5F7UA 4QHNB 2AK4D 1JHTA 1A7RL 4X8JB 2R2EB 3FHQA 4OLYL 4QXGL 3VXSD 3VXUA 4X0KB 1TTFA 4M48L 1GIGL 1CE1H 4R7NA 3ETBF 2NY3B 3UBXI 1DCLA 4RBPH 3S36H 1RHHA 5I17B 1N2RB 3C6LB 2DF3A 4MB5A 4XVTH 4E41B 3NBNA 2V7NB 3PDOB 1YUHA 3ARRA 5BXFB 5DVLA 1G0DA 2DLHA 3O0RH 5I19H 3WKNA 2B20A 4OCWL 2AXGB 2AVGA 4MSWB 1AD0B 4P5TD 5D72H 3SGDH 1AGFA 5DEFA 1T03H 2WBJA 5T3ZL 1DVFC 2MHAB 4YR6A 2JIXA 5A2IH 3QEQA 1I8MA 1UB5A 3TA3C 1BWWA 5ITFA 1IGYB 1NUDA 4NUJA 4PTTB 3TN0A 1Q9OB 5CJOL 4PJEA 5JR1H 2NY2D 3EZJB 3RPIA 2BNRB 3WHE1 4EQ2A 3DIFB 1D7FA 3CFDA 3Q5YA 1J8HA 4Q6IB 3WUZA 1IT9H 5HDLA 3HMXA 3VDBA 3WE6B 4X7SL 1ZGLP 3ARDA 4X99A 1ETZA 3DO3A 1SJHB 4I18B 5F9JB 5T3XD 4GRMA 4NQCB 2OZ4L 1N8ZA 1DANU 4J8RA 4BQ9A 2NXZB 5KSAB 3WMSA 1RZFH 4K9EL 4PJ8C 3QUMA 1EGJH 4Z8FL 1KGCD 3WFCL 4TNVK 2ZUSA 3QEHA 4EN3C 1MJJA 5DMIL 4PJ5E 1CD8A 3QXDB 4OM1H 2QTEA 1YEDB 1IKFH 5DURD 1QLFA 3KPLB 2Z91A 1H5BC 5I1IH 3VA6A 4OCLC 4LSVL 4JVWA 4XPTL 4LCWE 1MOEA 2GJ6B 3T2PA 3L3OB 3M1BB 1L0QA 2FX7H 1PDKA 3AREB 3PWPE 4EOWH 1E27B 4KJYB 5IESL 1Q9LB 5FOBB 1ZMYA 3IXTA 5C8JB 1V3MA 4JDTH 3WJJC 3NAAH 3BAEH 5M7QA 2HG5B 3L3HB 2YD4A 5C09E 1NPUA 3W0WE 5FK9A 2YSSA 5GS0H 4OD1L 2C7UB 1UJ3C 1MVUA 1JHLL 2Q3AA 3VMNA 4LDOB 4M8QB 4F58H 1BZ7A 3RL2A 4G8GE 5ID1A 2J2ZA 4KDWA 5IVZB 1BJMA 5HHMB 1HZHH 4L3EB 1HH6B 4U1NA 2DQGH 5IHZB 1MEXL 3FFCD 1F90L 1NFDA 3JWOL 1RURH 2FJFA 1Z9SA 2UY7A 2F8VA 4UT9L 5GJTL 5GHWH 3RFZC 2C3XA 1PEWA 2ID5A 6FABL 2IAMB 5DTFB 1JYXA 4NN5B 4KI5C 4QCIA 1BQHB 5DMGD 4G5ZL 3BKJH 3VMOA 4PJIF 4LRIC 3MJ7A 4HPOH 1CFBA 5FHBL 5TQ2H 1QOKA 3KLHC 1CG9B 4YXKH 3GEWB 2CLVB 4M9OA 4HWZA 2E9BA 1TTGA 3QO1B 5FDWA 4LHUB 3T0EA 3IFNH 3HI6H 4H25B 4HHAA 4QYOA 2J8UB 3UAJC 4MNGB 5C0CE 4GKSA 2HVKA 3BWUC 3F7YA 3AS3A 1T0MA 4S2SB 3OG6B 2GITA 1U8NB 3UYRL 3BH9B 2NZ9D 2AAVA 4YXLH 2VZ3A 4BZ1H 4Z7NE 3W11C 1X9QA 3Q6GH 2CUHA 2UYLA 4JQIH 4LGPB 1ZT1B 1WIOA 2H6PA 5AUMB 1S9XB 4JFOB 1CL7H 1FO0L 2EEAA 4LIQH 4WGVB 2G9HA 1LP9A 4NQEE 4L8DB 4N0RA 2OLDA 4YH6A 2WK2A 5FHAL 1TZGH 3GFUA 3SDDB 3VXUD 3NCYS 3SDCC 4D9RD 4WFHD 5LXGL 3ULVF 3AXLB 3MA7B 4IEFB 2VL4A 1J5OL 5C0BA 2VDRL 2XICA 3G6JB 5HGAA 1S8DA 2HJKB 5HSFA 3MXVH 1FNLA 1UEYA 2W91A 4YPGA 3OSKA 2Y1VA 1F4WL 5GGSA 2Z35B 4P59H 2F9BT 4L5FL 1FYTB 4MJIB 3VA2C 5IR1B 5IV2B 1CR9H 3DUSB 4FTVB 1VENA 3PWLB 2OJZH 3IETB 2I5YL 4JFPB 5EZJB 3GM8A 1U3JA 5IFHL 2Y9RT 3L5XH 4NFBA 1F4YH 3OWEA 1JWSA 4JPVL 3MA9L 4Z77B 3AC0A 4ISVB 3FQRB 3LKQB 1V05A 4GFTB 1JGLH 1S5IL 3V5DA 2DQJH 5TE6H 1AQDB 5A16B 1MHEA 2JTDA 3CXHK 3BP7B 3WNKA 4V2BA 1EUTA 3MBED 2FIKB 3TBTB 1P1ZB 1S7XA 5DHYA 3BD5A 2KQMA 3WFBL 1NH6A 3MCG1 5SWSB 1IM3B 3SN6N 3ZDYF 1KJ2A 4OQTA 4JQXA 1EXUB 3A6BL 5C0AA 1BAFH 1CFSB 4Y5YC 5DD6B 4XP5L 4DFHA 4ZSOB 3VDAA 4I9WD 3QT2A 3D2UD 4HAFA 1JNNL 2OJEB 3DGCR 4HH9B 3RHWK 5GGUB 4XGZA 3V6ZB 1IQDA 1FSKC 2JK5B 5EPMA 3MLRH 4BFBD 4KKAC 4YBLC 3BPOB 3BEWA 3D18A 4WI3A 5TPWH 1Z5LA 2W59A 2FJGB 4V1DE 2VXVL 2FB4L 4PJFE 4XAWH 4UT6H 3SKMA 1NC2B 4JO4H 4Y4KB 1KIPB 4U6HA 3U4BH 4QHLA 1YEJL 4D9LL 4CBPA 4J23A 1NDMB 3DV6A 2FATH 3MV9E 4M5ZH 5JOFB 1QLRA 3IJSB 4GSDL 3OAUL 3FL7A 3I75A 4Z9KB 3LKSA 4EXKA 2IPTL 1R3KB 1T80A 2ORBL 3WCYA 3O9WA 2LU7A 5GXBB 4F7TA 3HZKA 4JZJB 4K94H 2J12B 3DBXB 2BCKB 1KOAA 5LBSH 2B7DT 5HVFB 1Q9WB 3FRUA 4NKDB 1KSRA 3AY4A 2DJUA 2GJJA 3MJ9H 1K6QL 3RDTA 4N9OB 3S34L 4MD4B 1BGXL 1D5XA 1CXFA 1HSBB 1KEMH 3MJGX 1UZ6F 3QQ9C 2BY2A 3UBXB 3W0WA 2HLFC 5F7MC 3UDWC 1A4KB 5E4EB 1LE5B 2X1PA 1FLTX 1MFDL 3ARFB 3HE6B 4G8GA 5FOJA 3P4MA 4NGHH 4PBXA 1BEYL 3BP6A 5GS3A 2Z8SA 3JWNC 1AXTH 2FH8A 4WY7L 3NN8B 1P6AB 5LWYL 4IDJL 3KPSB 3HPJB 4XNYH 2ADJB 4FQ2L 3OKMB 3VFUA 4NUGH 3FO2A 4ZO6A 3V7AE 3K4ZA 3QBTB 5FKPB 4LLDA 1JFQH 4DTGH 4R4BA 4PJBB 1YEIL 3T4AA 2KQNA 3BT2H 4HS3A 1PVHA 5IW3A 3QPXL 2BXYA 3TBYA 3HNSH 4M6NH 2RR3A 4OIAA 4FZEL 1RUKL 3RU8L 2CH8A 4Y1AA 5J56B 3MJ8A 1ZGLA 1TJHH 3MLYL 3PIQB 2J8OA 4FHBD 3V0AC 2FL5A 4HS6A 1ZOXA 3MOBL 4R2GC 5C6TL 3IU3B 4XX1G 2E8ZA 3WUWG 2N56A 1KCVL 2H32A 5E8EB 4F80A 4PRNB 2XIDA 5IMLB 1ZE3C 3MXWH 1OAUL 1P4IL 3U9UA 5EIIB 2VSCA 4YXHL 2ZUQB 3SKNB 1B0WA 4MNHA 5C0CA 1WV7T 4YHLL 1MH5A 2R9HC 4P3DA 1QR4A 4XVJH 1FE8L 4PGZA 4ZOBA 2VISA 3FAXA 5ICXB 1KJ3L 4RZCB 4X7EC 4U1KB 3OZ9H 1FC2D 4MCZB 1T5XA 4ZPVA 4OF6A 1TCRB 3BPCA 5C0BD 5TDNB 1KIRB 2QEJA 4Y19B 3L7FB 4TSAL 1INQB 1R5WA 2R4RH 3F62A 1X5HA 3C60A 3VRJA 3SE4C 1U9KA 1TDQA 2IQ9L 1B0RB 2VOTA 4GUPA 1QLEL 4YHKL 1C7TA 4JVPA 4XCYB 2Z9TA 1UYWH 1HWGB 4KRPC 4NQEA 5DF0A 1A0QH 1WIUA 1TPXC 3B8SA 5I15H 4N1EA 1N59B 5D6CA 3ROOB 3I6KB 1AFVL 1U8MA 4OLVH 2IANB 4BH8B 2ZSWB 3T0VA 4P2QE 5C0ND 4LLYB 4PLKD 4XXCC 1G9NC 2HFFB 1DBBL 5FXCH 4ESKA 4ODWB 2NYYC 5EU4B 4AIXA 4PJAE 4MXVF 1RVFL 3BIKA 3R4DA 3EAKA 2Z8VC 5EC1B 1MY7A 4GRWF 4JFDE 2KH2B 4QHKJ 4X7FC 3LRGA 4KKBC 4HIJB 3B2VH 4LFHG 2E9JA 1GSMA 1WUNT 5EO0A 4NQTA 2MQ0A 2XRAL 4X6BB 3V0WH 2EDEA 4LPTA 3H9ZA 1N3NA 1G7LB 2FZ3A 5SX4H 1I1AD 5MEOA 1HSAB 2X4QA 4UINH 1Q0YL 3WXVH 1EHXA 3MRJA 1N5AB 4WHTA 4FP8H 4IJ3B 4F7EA 3O3EA 2VLJA 5GGSY 1U8IA 1A3QA 5DJZB 2LABA 3CLEL 3P11L 4ZAKD 1FG9C 4X7TB 5HD8C 4XC3H 3AS2A 3V6OC 1TVHB 4RAVA 4TOYH 1B90A 3EJJX 4NO5A 4DGIH 4I48B 3QHTC 1NC4D 1INDL 1GAFL 4BKLA 1MWAB 5I16A 1MREL 1CD0A 4HIHA 2JCCE 3OPZH 1LMKA 2ESVA 3TJEL 1P84K 2CPCA 5B3JF 3CFIC 5EUOA 4HD9A 1I7UB 4PJ5D 2UWEA 3I2CH 3K0WA 4QRRB 4JCLA 4GG6B 3OXSA 1FIGL 3TPUA 3RNQB 3WLBB 3X13A 4TPRH 5J1SC 1ZVYA 4LCWD 4V1DA 3G08A 2VAAB 3H9SE 5E6ZA 4BFEA 2R2HA 4LK4A 3QWOA 2DI8A 4HULB 3PWPD 3WN5A 3RAJH 3K1DA 1ZSDA 3GMOA 3G9AB 3TP4A 1CFNA 4AT6B 4KQ4L 3L5IA 4PYGA 3T3ME 1I7TB 1QYGL 3MV9A 1CXHA 3HC4L 1TPXB 1BOGB 5DJ8B 3LDBC 5C09D 3OGCA 1FVCB 4WFFE 1LEIA 4BFIA 3W0WD 5E56A 3KPOA 3O2VH 2BNUB 4XPGH 5E9DE 4X0KA 4RIRA 5FO7A 5C0EA 1JPFB 1I7RB 1U0QA 4G8GD 3U7WL 3X12B 3OKEA 5E2WH 4UAOB 3S3JA 1MIMH 5BMFH 5I17A 1N2RA 4B50A 4OCNC 1P7QA 1PZ5B 3JUYA 1BLNB 4WEBL 1HHHB 1NFIB 1ZHLB 2V7NA 4JM4H 5BXFA 1D6VH 3HMXL 4WUKH 5BZWB 5FF6B 2P5WB 4Q2ZB 1YY9D 1EDQA 2AXGA 1JF1A 4P23C 4PR5A 3T65B 4OZGB 5H35B 3ZHDA 4HFUH 1NLBH 3JVGA 4KPHH 2VAJA 3HN3A 3ULVC 3LIZH 5D5MB 3T77A 1EGJA 3QUML 4LRNL 4O5LL 1IGYA 4W4OC 4AZ8A 1PY9A 4LVHB 3V4UH 1J1OH 2P8LA 3IDIA 4PTTA 5D96C 4WHYH 4F9LC 4QY8A 5HDOA 5B8CC 4JM2B 3IDJB 1XGPB 5MEPB 1R3JB 1J18A 3CVIH 2ITDB 3DIFA 2X4RB 4ZNEE 1I4FB 5CIPH 4PB9L 2VQ1A 3GSRA 4IMLB 4Q6IA 5HHPA 2BNQE 2FJHA 5F9OH 3KPRB 3RWHA 4YDJB 1GGBH 4Q0XH 3WE6A 1EVUA 4KK6C 3F7VB 3K2UL 2B1AH 2FX8H 4PRDB 2A9MH 1MNUH 3KLAA 4OCRH 5F9JA 5E8PB 5C0CD 2R1YA 1BD2B 4IRJA 1T6VN 3O41B 1K3ZA 2Q6WA 1DBJL 5DSCA 3UZQA 2VLKA 4YDLB 3PGDA 1NCCL 4PY8I 7CGTA 2D4FA 1W72B 3QXDA 4MLIA 2W65B 2HVJB 3C08L 1U92B 3EZ8A 1WAAE 4JFHE 2EC9U 1AE6H 5F70A 2Q7YB 8CGTA 3RI5F 2IADB 4DOHB 1ZLWH 4HUWB 5KW9H 5DD5H 3AREA 4NQED 4QLRA 1OP3K 3VCLB 1P7HL 5I1AA 2W1NA 4OLUL 5CSZA 4BSWB 2K1MA 4U1JB 1T21B 4YHML 3VFMA 3VXME 4LGSB 3TGXA 2HG5A 4HMCA 1OAQH 4L9LA 3TZVB 3LMJH 5FYJE 4HV8B 1MFAL 2EXWD 5ESQB 3UX9B 1FCCA 2ICWJ 4PLNC 1DQDH 2ZCHL 3TVMB 3FCTB 4FXGA 5ACZA 3MRHA 1HH6A 1YN7A 1V3JA 3CK0L 2KPNA 2BMKB 2Y5TA 1KN2L 3GBNL 1OTTD 1PSKH 1AI1L 4P2QA 1P2CA 5DJYA 2UUDH 4UTBH 5I18H 5CCKL 2X4PB 2PTUA 1N6QH 3BW9B 4OZ4A 1VEOA 3LPFA 1BQLL 1FNAA 3S7GA 1A6AB 4JFDA 1PKQB 2IAMA 4ZO7A 4OIIH 2YBRB 5H8DA 2P4AB 5F9AC 1S9WA 3Q6FA 1PG7H 4HS8L 3SDAB 2R2BB 1A2YA 4WI4A 4JKPL 4U1LB 4P5TC 1JK8B 3T0AA 1BJ8A 5T1LD 4FFVD 1TTUA 3GSOB 4BA8A 4H25A 1MCWW 4MNGA 4KDVA 4DVRH 4EXPX 4G9FB 1INEH 3BDYL 4YHZL 3KHOA 5LVEA 3QCUL 5T1DL 1XGYH 1WFNA 1AGCA 2R0ZH 1DBAL 3CH8A 3L9RA 4TNWF 3WBDA 2CDEA 3GSUB 5D2LF 4NZUH 4L4TE 4PJ7E 1FZKB 3QIWA 2V9RA 1AXSA 3DWTA 2GTZB 2I24N 2NY6C 1YNLL 3BSZH 3T0DA 2VE6B 3WFDL 2HT4D 2O5ZH 3MV9D 5FYLH 3GGWA 3EYOB 3IFPB 3SKJH 2D0FA 1EO8H 4AEHH 4QT5B 1OSZB 1CTNA 4M62H 1ORQA 1H3WM 1B0GA 4ZPTA 2E7LA 3H9SA 4CVXB 5GJSL 1E28B 1D9KB 2DQEH 2HKFH 2HJKA 1P7QD 3GSWB 5L7XH 5IBUB 4BQ6A 3AM8A 6CGTA 5EOQL 4KH2A 4S1DC 4J4PD 4XWGL 2JB5L 4PJHA 1FYTA 2XPGB 4R26L 2PYFA 3QCTH 5BS0E 1KJ2L 4OQTL 4TUJB 4HGKC 2EKSA 5C2BL 5EZJA 4JFPA 3JV4A 1JWMB 4C4KT 5E9DA 1NCDL 4NRZA 3FN9A 4Y16C 1JZ4A 2W9LA 3FQRA 5FECA 3F7PC 3I3BA 1BBJA 4XCFL 1CDJA 4PUBH 1IGMH 3PNWB 2NW2A 4APQB 3KXFE 1DQQA 3S35X 1MY5A 1TZHA 3CJJA 1T7ZA 1OTUD 1CK0H 4JO2L 1RZ7L 4YHOH 1T7XA 5JPNA 2APWA 3CH1B 1O0VA 1QG3A 1VFAB 3MRLB 1NGPH 3MRNB 1J0KA 3QNXB 4I5BB 4U33A 1GCFA 4KKLD 2B4CL 2BOCB 3BUYA 2LVCA 1FFOA 1CFSA 5DD6A 1IMHC 4IRJD 5BCAA 1NJ9B 3FB7B 3MRRB 1GGUA 2OJEA 4GMSH 4HK0B 1ZV5A 3VFVB 4YBHA 2BRRH 1JN6B 3FQNA 3I02B 5BO1L 3P77A 5F97E 4MZ2A 2Q3ZA 4ZFGL 2WNGA 3HR5B 3QG7L 4N1CA 4LSTL 3VWJA 2W60A 4JY4B 1U8QB 1I8LC 3QNZB 5C0FA 5L2KB 1HKLL 4J3XA 4O2FA 7FABH 2FLBT 4JY5L 5I1HH 3GMLA 1OT1A 4QRQB 3L7EB 1FNEA 1NC2A 3WFZA 3DX6A 1XF1A 3D0VA 3MJ9A 3K3QA 3GMMA 4HFWA 2HWZH 2JELH 1JYWA 1NDMA 4DN3H 4F15B 5JOFA 3VFSA 1MLCA 4UILH 2NZ9C 2WLYA 4L8BB 3CSGA 1WAAA 4KDTC 1ZHBB 1U91B 1X44A 1M7DB 3HC3H 4M43L 4LEOB 2JB6A 1Q72L 4H8WH 4JZJA 2GK2A 4UNVA 3SPVB 1N64L 3LS5H 3CFEA 3JTTA 2OI9B 4FG6D 4XMKL 2XOTA 3VXMA 1MCPL 3ORJA 5EDXA 1WFOA 4P2QD 2D0GA 5ESVA 1LO0H 1JHKL 3AB0B 1EAJA 1U8OB 2PXYB 3QP3A 5F8QC 5E5MA 5DC9B 4OM0L 2OMBA 1RJLA 1VSCA 4FQXD 4C4KO 3P0VL 3ARGD 1ZEAL 4JFDD 1HOCA 5F9DC 3SE8H 5HHOB 1EUUA 3QCVH 4QRPD 1ONQB 3PDGA 1A14H 5I73C 4PJCF 5F6HI 2DQFA 3OKMA 1YN6B 1RFDH 4JLRA 2HYMA 5DI8B 5FKPA 3WEXB 1XH3A 3IRPX 2AJUH 2NY0D 2BDNL 5C08E 3VWKD 2I9TA 2PTTA 1G6VK 5D1ZA 4F9PA 1DEEB 3RWJA 2EC8A 2FECL 1SYVB 4P4KA 4Z7NF 1QFWL 2DD8L 3SE9H 2O5XL 3TV3L 2AJZA 2OTWB 4X5WB 1I3RB 5DEZA 4M93C 1TXKA 4LAJH 2IMNA 4YHYB 1CDGA 3GK8H 4M6OH 3R1GH 1IGJB 1BIIA 4UOW0 1U8LB 1FP5A 1UVQA 5DMJB 5L8KB 1DQLL 4OTXL 5BV7B 2QSQA 3BGMB 3QFJE 5IMLA 4O02L 2HJFB 1UH2A 5HBBA 2DAVA 2NY5H 4OD2B 1Z0MA 4NC1C 4YO0A 3PWJB 5IIEB 4OFYD 4XB7A 4KQ3L 3O3AA 5AYQA 4U6VH 2G60L 4S0TD 2VZSA 5JNYB 3V6BR 4HLZH 5HHQA 5F7HA 3RPKA 4FQJH 2AEPL 4L29B 4MQ7B 5A2LH 5JXEA 2C3HA 2OR8A 1TVBA 5ICXA 3BMWA 1OY3B 3VFTA 3EHBC 3CMGA 4RGMB 4KMTL 4OCSL 4L4TA 1JRHH 1CGSL 4HJGB 4PJ7A 4IOIA 2W0PA 2X4TA 5IBLC 5J3HC 4KAQH 3B43A 1AO7E 3S96B 3QEUB 2VQTA 4NQSA 1RK0B 4ZUWA 3TO4B 3O6LL 4XCYA 2H41A 5BV7H 25C8H 4X9FA 4ZTOH 4F7PA 4WFFD 5DK0B 2NY1D 4CU6A 3K74B 4XX1E 5E9DD 5DJ2A 4U1SB 3I6KA 3FOMA 4RISL 3B9DA 4HWEH 4BH8A 2ZSWA 4PJGB 5AYUL 4LLYA 1AC6A 4NHUB 2HFFA 2FGWL 5FA4B 3W2DL 4QTIL 4KK8D 4NT6B 4G43B 3B9KC 2PYEB 2WUCH 4Y8AA 3VGFA 4JFXB 4J1UA 2ICEA 4H88H 4R9HA 1SJVA 1CD1A 4WW1A 3RWGB 2ICWA 3C9NB 4YE4H 1VPOH 4OD3L 1CFTB 3QSKB 5FV2A 1RI8A 5GISL 3QDME 5CSBA 3JV6B 2VC2L 5HHVH 2KDGA 5AWNH 4K8RD 4XP9H 3P9LA 4PRIB 3WFHB 3G6AA 1HQRB 3LEVL 4DK3A 5D8JL 1HSAA 4W81A 1S9KC 3SE3A 5JOPE 4YJZL 5TH2A 2ADIB 1JCKA 3VG9C 3DGGA 3KXFA 4K07A 4M1DH 5DJZA 4GKZB 1UH4A 4KJPC 4X7TA 1WBZB 1XIWC 4JFQB 1CE1L 1PJ9A 2BRQA 2ZG3A 4O51A 1TVHA 3MUGB 2BNQD 4PJFF 3GBMH 1WT5C 3IFOB 1KYOK 3S36L 1OSPH 2JE8A 4YDKL 3QEGL 5EU7C 5B38G 4XCCH 4E5XA 3O2DH 2Z31A 4XVTL 3B5GA 3FB5B 1KCSH 3O0RL 5I19L 1TETH 4LQFH 3H2WA 4PG2C 3NIFF 1BFVH 2GTWA 5D72L 5E6IA 4DUWA 1I7UA 1T03L 1WQVT 1EEZB 1IZJA 3VFNB 5E94B 3BZFA 2W0KA 3WLBA 4JFHD 4WUUE 1RD6A 3B2UC 5F1IB 5IROC 4NO3B 4ZOCA 4NRXB 3VFGH 3CNKA 2QR0B 3S5LB 2A6IA 1GXEA 2VAAA 5IB3B 1OAYH 1R3HA 3UTOA 1KIQA 1WCBB 3BPLB 3W9DB 3FT4A 1IT9L 1K2DB 4OUOA 5DHXB 3HZYA 3MLTB 4HJ0D 3VXMD 4CDHA 1AHWB 5IW1A 1KB5B 1IL1A 3BHBA 4JEGB 5FYJD 4AENA 5MP6H 3X3FH 1IEBB 1MPAH 1RZFL 3GBLA 3V79C 4QRSA 1Q1JH 1EGJL 1K8DB 3DROB 1I7RA 2EDOA 1MCKA 2QBWA 4PJXB 1WWBX 2WQ8A 1XGQB 3BUTA 3C5ZC 4OM1L 3EJZC 4U6XB 1IKFL 2DI9A 5IVXF 3PWVA 5HGBA 5CIPA 4WIQA 5I1IL 5I30H 5E6YA 4TRPH 3D9AH 4FFYH 1FH5L 1YEFH 5FF6A 2P5WA 1UZ8B 2FX7L 4U31A 1QO3B 2BVQA 4EOWL 1MI5E 4EI6B 3T3PE 2XN9B 5C0NC 4PLKC 1QACA 3MCKB 4JDTL 4EDWH 2DTMH 2YRLA 3NAAL 4GG8B 3FT2B 3IAQA 2MPAL 5BJTB 3T0WA 5C86A 4ZYKA 5GS0L 5BW7A 4F58L 1XGPA 4AYFA 3RZCB 1J9CT 1I4FA 3ULUE 3ABZA 4KJWD 4IMLA 1P5VA 5D7JD 1HZHL 3KS0H 4JFFE 1I1AC 1KB9K 5C08A 5L8JB 1J0JA 3KAAA 3F12B 3OKLA 3RTQB 1QSFE 2DQGL 3Q1SH 3F58H 4JHAH 3RWDB 3HI1A 2Q8AH 1I8IA 3B9AA 2K7PA 2CRYA 4YDIH 5DFWH 4M7JH 4GS7C 4OZFB 5SX5K 4ZAKC 4M7ZB 3H3KA 3U9PH 5GHWL 3DX7A 2VLLA 3W5MA 4MAYB 4HG4J 4Y2DA 1K4CB 1LE9B 1FFPB 3HUJA 2MFNA 5I8OL 3BKJL 2C4XA 5CD5D 3ZKND 1ODAA 4HUWA 3SGEI 5TQ2L 1XCTA 3KPNB 2Y06H 3HE7B 1BWMA 2E6QA 2ZNWA 4KTYA 2IALB 4YXKL 2IH3B 3T09A 3HS0A 1SY6H 4JQVC 2NQCA 3MRPB 4GLRI 4OZFH 4U49A 2DQUH 3HI6L 3QQ3B 2D03L 3RI5K 5FYKH 2OYPA 4PRBA 1LNUB 5F3BA 1HXYB 1GC1C 4HSQA 4K3JH 5I1EH 1K85A 4O9HH 3FQTB 4P2OA 1CZ8L 2A9NH 2FCBA 1MRFH 4FFZH 4RDQF 4YXLL 5ICZB 5J6HA 3FCTA 5BS0D 3Q6GL 3BGFB 4OZIE 1I1FB 1AGDA 4RRPG 1XR9B 4XH2A 4FA8A 3WL9B 3U0WH 2BMKA 1JZ5A 2R0WH 3LB6D 4U1MB 1CL7L 2BOBB 3EYFB 2OX5A 1CGYA 4JO3H 1MELA 5BOZG 1NEZA 4GBXC 3CFCL 1TZGL 3E6FB 3HRZB 4TVPH 4GXUN 3MCLH 2ZP0T 3WO4B 3JV0A 3ZKMC 1S7RB 3UJTH 5ADPH 1OB1B 4WV1A 1JGVH 1F3DJ 3LVEA 5KSBF 2W0FA 1MCLA 3LH2H 3MXVL 1W8OA 3BD4A 1RAMA 3BH8A 4I0PC 4P59L 4DGYH 4DW2H 3O11A 2R23B 4JRXE 4W6WB 1CR9L 5F7EH 1JK8A 4MD0B 2BY1A 4RMUA 3B4NA 5LGJA 1CGUA 3GSOA 3GSXA 4LSSH 3L5XL 1F4YL 1I3UA 1U6AH 1A7OH 1UB6B 1QSVA 2A6KA 4XP1H 1JGLL 2HLAB 2IG2H 5C7XH 2DQJL 5TE6L 1QHPA 4OZHB 3LN5A 5E8NA 2NR6C 4JG0H 2VWEE 1ZA6A 1K3IA 3IJYA 5MERB 5B39B 3GSUA 3WIIH 1KFAL 1MCBA 3LHPH 5HPMB 2E5EA 1F2XK 2F5BH 4H0HB 4M4RA 4XHQA 1RUQL 2C3GA 2DYPB 2GTZA 1L4IA 4OQ1A 5AG9A 1U93B 3IDMA 2Z92B 4JGUA 1BAFL 4TNWK 5IB1A 2FR4A 1T4KA 1HHIA 1DQMH 3Q2CA 3QUXA 1J86A 4RMWA 4WUUA 4NKMA 5KANI 4L3CA 3C09B 5CHNB 3QZWG 1NBVH 2FEEL 2QLVB 3A6OA 3MLRL 3TCLB 2R1XB 1HHJB 5EWIH 2J1KA 3O4LE 1F6AA 4X6EB 1PG7W 3QNYA 3QWRA 5D1XB 4Y2OA 4XAWL 2EDJA 1KPRA 4UT6L 4TQEH 3MYZA 4JO4L 3U4BL 1PGRB 3ZDZF 1UXSA 3FN3A 2XA3A 2EXWC 5HI3D 4KMLB 1S7WB 1IGFH 4PGJA 4LPYA 4KY1H 4I2XB 3MNZA 1RU9H 4K94L 3S37L 2PETA 5C08D 1MI5A 1ZS8B 2EH7H 3MRLA 1WC7B 4I5BA 3MRNA 4EUPG 3ZKXB 5IBTH 1CLZH 4ZXBD 3FONB 4OCYH 5ACMA 2WZPD 3MJ9L 4NNPL 1EV2E 5GS1C 5A1AA 3ILQD 2I25N 3REWB 5CGTA 3FB7A 3OKDB 3E0GA 1KEML 4JZNA 1KACB 1X4YA 2JKXA 4AEIH 5DMYA 3QIUC 4NGHL 3PHOA 1AXTL 4JFFA 5T5FH 5J8OA 1OTSD 1WSST 1JPTH 3QFJD 1QRNE 1Z3GH 5AZ2H 3CPLB 1DQJB 5L2KA 4XNYL 3KDMA 4NJAL 4NUGL 3ARBD 3L7EA 4FFVC 4S10A 3CCHB 1CLOH 4DTGL 1JFQL 1FVEB 4N68A 4W68A 2CQVA 1F45A 4RGNE 1UKTA 3BT2L 3HNSL 5D2NB 4M6NL 4O4YL 1TJHL 3FTGA 4P2OD 1AO7D 2DWDA 4WW2A 3TBVA 3VI4F 1RZJH 2VERN 3SPVA 2BSSB 1HNFA 1W0VB 3VJ6B 1FZOB 2HT4C 1PYWA 15C8H 1G7QB 3LPGA 4KK9D 5F3HA 2RHEA 3MXWL 5CLWA 4IIQC 4E0RB 4NQXB 3HLAB 4ZO8A 5C6WH 4NCDA 1UA6H 2X9XA 5GSVB 4XVJL 4AL8H 3TYFA 2O61A 2XTJB 4J3OC 4ZD3H 4ZODA 3JWDL 3OZ9L 3QDMD 4OZIA 1FORH 3T1FB 2R4RL 5K9KB 4S1RL 3I6LE 5EFIB 1H0DB 3UROR 1EO7A 4HW6A 1R3IH 1UWEH 1N0LA 1D5ZB 3A0OA 3VXRE 3FFDB 5HGHB 1YN6A 5JOPD 5JW4Q 5DYOB 2YUWA 5GRVL 3WEXA 1UYWL 4KGJA 3L6FB 2AV1B 1A0QL 1XGTB 5I15L 4YPJA 1YMME 3UYPA 4MHHG 4L4VA 5GS1B 5E8DL 4YDVB 4KK5C 3RY4A 4OLVL 1K5NB 3B3IB 4X7CC 3DTXA 3VGGA 1KBGH 3RGVB 2Q76B 1VACA 3IRZA 1URLA 3U30C 4ELME 2OK0H 5FYKE 4CMMB 4AMKH 4X5WA 3G5YA 5IBUG 3EOTH 2YC1B 3QAZC 3QPQD 4LOUC 1G9EA 4WEUD 1E4WH 3AAZB 3GSQB 5ETUA 1IGJA 5D1QB 4JRXA 1P4LA 4LBEB 2A0LD 3B2VL 4P49A 2FWOB 1V3LA 4JN2A 5E1HB 3JWOC 3QUYA 3V0WL 3QRGH 4NHCH 1D6EB 2Y72A 3BZ4B 2VABA 5CJQL 3NIDE 5HVGB 1NCAH 1A7RH 3RVUD 4UINL 1T5WB 4LFHD 5DS8A 3WXVL 5ALBH 1H15B 1ITCA 4LLUA 1XGRA 2P24B 1IGCH 1NQBA 1GIGH 3E6HA 2CK2A 2ZG2A 3G5ZB 4XC3L 4X4XA 4HJGA 1ADQH 2G5RA 4A2MA 1XF4B 3MRFB 4TOYL 3QA3A 4GQPH 3BQUD 3S96A 4R3SB 4PJDB 4DGIL 1DQTA 3D0LB 5DK0A 3FHAA 3VFWB 1SM3L 4U1SA 1N6UA 2Y7QA 3VFOB 5HYQB 4PJGA 4XAKE 4L3AA 5DUBB 2XACC 3I2CL 1NGYA 3UTSE 4JPIB 2FBJH 4LVOB 5HYFA 3RIAF 2YPLE 5F7LB 4JFXA 1FG2A 5DRZB 3ZE2E 4TPRL 3O4LA 1GGCH 2CO7B 3VGAB 3RWGA 2PW1A 5F7NC 4FG6C 5CEZD 1VHPA 4UQ3A 4PRPE 4XHJD 1MI5D 2XI9A 3JV6A 3O2DA 4YUEL 4NN6B 2YPVH 3WO3B 3RAJL 1DBKH 1JVKA 1OGTB 4KI5E 5CAYB 3U46B 1HQRA 1MHCB 4Y89A 4Z7OF 2EDTA 3CGTA 5SWSE 4PTUB 4YFLF 4I3GA 4Z7QF 4PP2B 1LD9B 1U8HB 4R4FH 5F71A 1XF5B 1CICA 3ARGC 3O2VL 4LLQA 4Y5XB 5F9WC 3TEUA 2VR4A 2WV3A 1KEGL 3OJDB 4S1QH 2GK0A 4MXQD 4JFQA 3U30B 3SO3C 3ULUD 4JJ5A 5E2WL 1WZ1L 4KUZH 4JFFD 1MIML 5BMFL 1WFUA 3PJSA 4LSVH 1QSFD 2APTA 3GHEL 1P53A 3REVB 1YEKH 2YXMA 1D6VL 3TBSB 2VL5A 3DX9B 4WUKL 1FAKT 5F6IC 5KSVB 4OKVB 3T04D 3VWKC 4K3EH 4X6CF 5ANMB 4HFUL 4HKXB 5EOTB 4WWID 5ID0A 4Y4HA 1NLBL 2VQUA 1MFEH 3VFNA 4KPHL 3LIZL 2NXYB 2ERJB 4PGCB 4J3VA 1PY4A 5TDPA 1C12B 1DEDA 5DT1H 2A77H 5F1IA 1IAOB 1FL6B 1UM6H 3V4UL 1J1OL 4NRXA 5INDA 1LO4H 2QR0A 1F4HA 3KYMA 1FQ9C 1P6FA 4C56E 4GRLD 3BDBA 1MHHB 2W38A 3FMGH 3ULSA 5F9OL 1MEXH 1GGBL 3FT3B 4Q0XL 1TMCB 2B1AL 2FX8L 4UV7H 2A83B 4JRWA 1X5YA 3CDYA 3SDXE 3PWNA 4YNYA 1TENA 4EI5D 3GM0A 1IEBA 3H3BC 1P7KA 2W9DH 6FABH 3CC5B 2ZOLA 3H42H 2CLZA 2LU4A 1SHMA 4GO6B 4JFYB 4PJXA 4XPFH 1NL0L 4LP5A 4FNLL 2JJWA 5BVJB 5TFSL 1QEWB 2VDNH 2X4SA 4PV8B 1AE6L 5JIPA 4CKVX 3C6SA 2VSDA 5FHBH 1NMAH 4G80A 4RSVA 4H1LG 1M1SA 3KPMA 1DBMH 4MB4A 5KW9L 4UIKH 5DD5L 5MENE 4DKFH 3SQOH 1JNJA 3PL6C 3KPSE 1CS6A 3HG1B 1NFKA 4LKXA 1VFUA 5IFJB 3HRPA 2JJSC 4ODUB 1OAQL 3LZFL 1DVFA 5J11B 4X6DB 3P4LA 4M1CC 1VFBB 5EIVA 2IH1A 2ZSVA 5HVWA 1X5FA 3T0XA 4Z7UE 1G1YA 5FGCE 3O8XC 3QDJB 3H7BB 3OKKB 5GGQH 4HKBA 3T8XB 3EUUA 3PABB 5ESAB 1TJIH 1U95A 3GIZH 4JRXD 3MX0A 1KCUL 1OGAB 4K8RC 4LDLB 2GUOB 1MFNA 3RKPA 5KJRH 2QHLA 4KROD 5GGRB 4WCYH 5FA3A 5IKCB 5FGRA 1MCHA 4G6JL 3G6DH 1SY6A 4ZFOL 3IXAA 4CJ1A 2L7UA 4OZFA 1HQ4B 4Y4FB 5DFVD 2CIIB 4ELMA 2VN4A 1KELL 5DQJA 2P5EB 4NPYA 3GMPA 4UTBL 5I18L 5LXGH 2QHRH 2R29H 4CDGC 2HTKD 3PGCB 2XWBB 1N6QL 4OGXL 2G5BB 3KPPB 1G1CA 4N0CC 3N1FC 4PJ8A 5D6DC 5ALCL 5LCVH 2ADFH 3D3VE 3VH8G 5IMMB 3JZ7A 2H8PA 2XKUA 4PGBA 4X98B 5AAMA 4EN3A 3SCMC 4Z78B 3MODH 2A38A 1S7QB 4NP4H 3O6FD 1PG7L 5ACLA 3V6FA 4P46B 1H5BA 1AY1H 1U3HB 3DMMC 1OP5H 2ZCKL 4GAGH 3RJQB 4MVBC 4W6YB 3VGBA 3FKUS 2I5YH 5BRZB 1TVDA 4WWKB 2XNAA 4JPKL 2MNUA 1JNHB 3MA9H 3QUZB 1S5IH 4HMDA 1LEGB 2BJMH 5IF0A 4P9MH 4DVRL 4UIMA 4BFGA 5KG9B 2V5MA 1INEL 2W92A 3WJJA 1U42A 1QZ1A 4YQXH 5H37H 2R0ZL 3M07A 2NY3D 5SWQA 3EO0A 1U41A 1YEHH 1X7QA 3IB4A 3C6LD 4G8EA 3C2SA 3RUGB 4ODTH 2PO6D 4HJ0C 3SJVB 4F33A 3U0PA 2ICCA 4E41D 3MYJB 3BSZL 1EAPB 2BOBA 1T6WA 1R6VA 4HZLB 2O5ZL 3HFMH 5FYLL 5EU6E 4H20L 5GIRB 3MRDA 3SKJL 1JNNH 4PIRF 1EO8L 1CIUA 2FEDD 3E6FA 4AEHL 4M62L 5TF0A 2BZDA 5CBEB 4GW5B 1IILE 1T04B 2I07B 4U1GB 3QH3A 2ZJSL 4AM0B 2HKFL 3MV7E 4QOKE 5L7XL 4ACPA 1BZ9B 4UDTB 4AIOA 4GAYA 3DX8A 4LRIA 3QCTL 3DXAE 4MD0A 4YHNB 5F88B 1BVLA 2VB5A 4W4NA 1FZMA 5F96H 1QFUH 3JTSA 3LAFA 1EVTC 4NQCD 5CWSA 3UTZB 3G5VB 4EZMA 4U2YA 2NXZD 4UB0H 5KSAD 2FRGP 1A4JA 1NGWA 4OCMC 1N6VA 1CTOA 5T33H 2IPTH 2DN7A 4PUBL 5KS9F 1NBYA 5I1CH 5CJBA 1QRND 2NCMA 2NY2B 4U7MA 5MERA 5B39A 5JQ6L 4ZFZB 1CDUA 2E7MA 3UJJH 5EBMB 1T3FB 3RY6C 5HPMA 4FQQB 1CK0L 1I8KB 4LKCA 4UOJA 4YHOL 1ZWIB 4TUKH 4CVUA 2GJ6D 4RGND 1NGPL 3DMMB 5JW5B 1A9EB 3DETD 4K7PH 1YPZF 4CJ0A 1EIBA 1F11A 4MA3A 1ZT7B 5C07B 3S34H 3I50H 3GJFB 3DRQB 4QHUB 1WICA 2V9QA 1IJ9A 1HINL 5KSUB 4PGEA 4ZMAT 3PGFH 4GMSL 3MMEA 3LCYA 1X5JA 4C56A 2BRRL 4WY7H 4KKNA 3TCLA 1ZKAA 1LQSR 2R1XA 1FAIL 2H45A 3B5HA 2AXJA 4R96B 2XZAH 2DJSA 3T3PF 1M71B 5D7IB 3TH4T 4IBLT 2F15A 5JDSA 7FABL 2H3NB 4XBPA 1TQBB 5CZXC 5T3XH 3CX2A 4Z7WA 3TIDB 2PCPB 1JTOA 4AY0A 2JELL 5I1KH 1RZGA 1YMHA 4DN3L 2DJ4A 5DZOA 4QWWD 1IKNA 1JZ3A 2Q8BH 4ZS6C 1DVFD 1QRKA 4UILL 1S7WA 3I3EA 3CZFA 1OQOA 3TA3D 1D3CA 3ULUF 2DLGA 3I6LD 1Z9LA 2BC4A 4I2XA 5D5ME 1A6VH 5TJWK 2NW3B 1JZ8A 3VXRD 3HC3L 1UM5H 1MUJA 2XWTB 3GJEA 1CT8B 3ES6B 1IEAA 3I9GH 3IDNA 5MENA 3LS5L 3GMNB 4FN0A 4M02A 4XRCB 3A6CH 3GZKA 3V6OE 1I1YA 4J3SA 1OAUH 4J3WA 1VESA 1YMMD 3FFCB 3L3DB 3K2MC 3S4SB 3IKCB 5E2UL 3KR3H 2O5YH 3GMQB 2H1PH 2ADGB 1LO0L 3OKDA 2R1WB 3K4AA 4F7CB 3QULB 3DI3B 4ZUUB 4CADB 5DD0H 4Z7UA 4EDXA 3GMRA 1BD2E 4PJ8D 5E2VH 2G2RA 2YN3A 4WNQB 3EDJA 5K9JH 4ZS7H 2EYRA 4G6FD 4TSAH 3EOAB 2KZ1B 3SE8L 4EN3D 1SVCP 3B9EA 4MDJA 3STLA 2EECA 2M1KA 4YHKH 5E8OB 32C2B 3UPAA 4G6MH 4LF3B 1DQJA 5TGBB 2EDFA 1F4XH 4PJIE 3ARDC 2OTUB 3HAEG 3MV8E 2AJUL 1C08A 2VMFA 4DOHE 3G9VA 2P46B 3QO0A 1DE4A 4NNXB 5D2NA 5EBWA 4DVBB 3MLXH 3IDGA 4IMKC 2YD9A 3D3VA 3SDDD 1ZVHA 1DUYA 3SE9L 3EJYC 5M94B 2YHGA 3PE9A 1UACH 4LLAA 2VDPL 4U4BA 2X70B 2QSTA 4GRWH 4QTHB 3VXOA 1K4DB 3DO7B 3GK8L 4M6OL 3R1GL 3S97C 1EEYA 2XRAH 1JV5B 1MCOH 3NFPB 3QI9C 2C3VB 1Q0YH 2X1XR 3BRFA 4E0RA 2CO6B 2NY5L 4XAKD 1S7TA 4JR9H 4H1LH 5F1OB 3CIQA 4U6VL 3BVNA 3UTSD 4HWUA 4FQJL 4XNZB 5DZLA 3WHXA 1NSNH 2YPLD 2D7QA 4X80H 3VXUB 3LEYH 5JXAL 5JO5A 3UDWA 4R7NB 5DDHA 1YYLH 1JRHL 4U6YB 4PRPD 3ULVE 1RHHB 3S35H 4KI5D 4KAQL 5IHUH 1D5ZA 3HA0A 1T20A 1P69B 1MCNA 3VD4A 2Z93A 1H3GA 5SWSD 4HUXA 1QA9A 3VDCA 3KLHD 25C8L 4ZTOL 3TJEH 1ZK9A 1YQVL 2ED7A 4H0IA 1AGFB 5DEFB 1KXVC 2WBJB 4HWEL 2GY7B 5AG8A 3QDGE 4YR6B 3QEQB 1I8MB 1UB5B 2A1WH 5ITFB 2UWEF 1LK3H 4U05A 3MV7A 4QOKA 3TN0B 2YC1A 4PJEB 3ARTA 1WWWX 2WUCL 3MBEB 1ADQA 3RPIB 2GSGB 2GFBB 3BP4B 4NN7B 3Q3GA 4H88L 1F3RB 4YE4L 1VPOL 4LSPH 3W11D 1UXWA 3DXAA 2PTVA 4KQ4H 5HHVL 4LVNB 5AWNL 4X99B 4OKDA 1EO5A 4XP9L 1ETZB 1QYGH 2VKWA 1YJDH 3ZDYE 2ZCLH 1T5WA 3NIGE 4GRMB 1HHKA 1N8ZB 1A1OB 5EBLA 1R3LB 4J8RB 4RRPA 3EYSL 3VGEA 4CAGA 3QUMB 4AEFA 3L3IA 4M1DL 4WEMB 3ET9F 3QEHB 1MJJB 4NKOB 3SDCD 1QSZA 1RMFH 2DMCA 2EO9A 4ZUTA 4C56D 2FECI 5ERWA 3NCEB 1QFWI 1QLFB 3GBML 2Z91B 2R4SH 5I71C 4WEBH 2RQ8A 1OSPL 4WI6A 5KN5A 1RZKC 2NZIA 1FGNH 3ARBC 4XCCL 3O2DL 4MDIA 1IGTA 1CXEA 4R4NC 1KCSL 2F74A 4PJ9C 1OWRM 3IU4H 3IXTB 1YA5A 3UPCA 1RIVH 3RVTD 5HYQA 5I1LA 2AK4E 5DUBA 1A9BA 4HBCH 1MCEA 4PD4J 4MGXA 1FJ1A 1YC7A 4JPIA 1C7SA 5FK9B 2YSSB 4XXCA 4Z0XB 1MVUB 4CN4A 5DRZA 3RL2B 3VFGL 1DJSA 1RSFA 5ID1B 4IRSC 3V2AR 1VCAA 5SX5H 3CX5K 5MEND 1WWAX 1OAYL 4WFGE 4KK9C 5IMKA 4PBWD 2YOCA 3KPSD 4K71C 1NFDB 3MLSH 3RIAK 4JRYE 1JGUH 1NGQL 2DTSA 1DBJH 4PP2A 3F5WB 1LD9A 2APXA 3M8OH 3X3FL 1MPAL 4P5KB 1Q1JL 1NCCH 1S78C 4XMLH 1UZ6E 3QIBC 3MSPA 5FKAA 1KJMB 1ACYL 4QCIB 1JWUB 3LN9A 1WWCA 4URTB 4KKAD 3V6OA 1NAKH 5I74B 1HN1A 3QZWA 3MJ7B 43CAA 5I30L 12E8H 4FQ1H 3SBWC 4TRPL 4NKIH 3D9AL 3DX9A 4FFYL 4YWGL 1YEFL 5ITBH 1FC1A 4ZFFA 4FABL 5CEXB 4OKVA 4DWHA 5FDWB 2F53E 1KYOJ 4YHMH 3T0EB 4HHAB 4HKXA 1A7BA 4PY8J 4HDIA 5FB8B 3SHSA 3KNBB 2HVKB 3F7YB 1MFAH 3D6GA 3UC0H 3VXQA 3QPQC 2DTML 4EDWL 1C12A 1T0MB 3DARA 5EO1A 3N50A 2GITB 1JGEB 1FL6A 3TESA 5C0IA 1C5BH 4OT1L 2R0KH 4Y19D 5GGTH 1OM3H 5JHDE 2UYLB 2BVUA 5EULV 4PJIA 4PRHE 2M8XA 1A6ZA 2DQHL 4YHIA 2B4CC 2H6PB 3FT3A 3GBNH 3OB0K 4JHAL 2ZWLT 3Q1SL 4P3CH 4X9IA 2DS4A 4JHZA 2G9HB 1LP9B 2Q8AL 1FFRA 3S3SA 4YDIL 5CP3A 4M7JL 1M6OA 3RNKA 5D7LE 4GOSA 1HWHB 1G0XA 2VR9A 3U9PL 3QQ9D 3SGDI 5DJAA 2HLFD 5E4IA 3DOSA 4CW1A 3O9WC 1PX4A 5C0BB 4BM7A 5HGAB 1S8DB 5BVJA 1H3PH 1QEWA 4QO1A 4HS8H 4XTRD 4PV8A 2DKUA 3LQZB 4G8FA 5HHOE 3MRQA 3P9WB 5EU6D 1FVDA 5JW4R 3RDTC 4ZDHA 1SY6L 1JWSB 1MQKH 2BSRA 2IPKA 3E2HC 4P23A 5A40E 1HYSD 2J8UF 3V5DB 5FYKL 3CFBA 5GQBA 3QCUH 1ZT4A 1MHEB 5T1DH 1JE6A 4XB8A 3HCVA 4X6DA 2CK0L 2Y23A 2CR3A 5HYIA 2VZVA 3NPSC 1AQKL 1S7XB 4POZC 1MRFL 4FFZL 5DHYB 5F1NA 5BQ7B 2VDMH 4FRWA 4R2GD 2H2SC 1XZ0A 5B8CA 1OGAA 3NIDF 3RBGA 4GRWE 4O2CA 3WFDH 3U0WL 5IKCA 5C0AB 2R0WL 2YA2A 5DJXA 4K7FA 2HFTA 4Y4FA 1B6DA 2CIIA 2VUYA 4JO3L 1JI2A 5EZOH 1KB9J 4MNQE 2ARJQ 2R9HD 2MOVA 1PBYA 4XGZB 4TVPL 2G5BA 3KLSA 4QRRD 3MCLL 4QRTA 5IMMA 4MAUH 3MLZH 1DN0A 3BEWB 3D18B 5K9OA 5ADPL 1MCRA 3G6JF 1S7QA 1Z5LB 3OF6A 3LH2L 1YNKH 3O3BB 3BWAA 1NC4B 1EFXA 4OQTH 3CAFA 4NSKA 2P7TB 3IT8D 5F7EL 3WNOA 4KRPD 1U8KA 2GJZA 1JNHA 4YGVB 1ZA3A 3QUZA 3DV6B 4LSSL 1SBBA 1QLRB 4JANA 1A7OL 3U6RA 4DAGH 5J1AA 3V5HA 3I75B 2XA8H 1TFHA 4XP1L 2IG2L 3LKSB 3HZMB 5C7XL 1ZHKA 5C0GA 4FQCH 4D9RE 4JG0L 2NYYD 1G0YR 4I0CC 3C60C 3HZKB 5CINH 3ZT6A 4OAWA 3R06A 4KI5F 5CS7A 4DKAA 4JREC 3WIIL 3LHPL 3PWPB 4N0UE 3ARSA 2F5BL 5LQBH 2PYEE 3NZ8A 4HBQA 2J5LB 4KKBD 4TVSa 3WS6A 3MYJA 2B5IC 5K59F 1T1ZB 2J6EH 3FRUB 3FQUA 5I8KH 1M7XA 2P43B 3ARWA 2AK4A 2OMNA 4R97C 1MAKA 5GIRA 4NQDE 5C09B 4P57A 1DQML 1D5XB 2ITCA 2OXHA 3W0WB 5MEQB 1DLFH 3VXSA 1GRWA 1G7IA 4G8GB 2FO4B 5CBEA 3BP6B 1NBVL 4LCCA 1T0PB 1GC1H 4EQ3A 2BX5A 5HD8D 5EWIL 1U2CA 4WO4C 1BZ9A 1UENA 4JRYA 4JY5H 5KANG 3FO2B 5JQHC 3KPRD 3HNTH 4V2CB 2ZUUA 2K3TA 3D39E 4LLDB 3T2NH 4R4BB 5GS2D 4TQEL 1T22A 2OSLB 4P5TA 4Y5VC 3T4AB 3R0MA 4ODVH 3RVXC 2MCG1 2FSEA 3BKMH 4OV6F 3TBYB 1BD2D 1CL7I 4U7KA 3EGSA 3G5VA 3UTZA 3EDFA 1T0NA 5GRUH 3D1MC 1RZ8A 4KWUA 3E3QC 4NC1E 3MJ8B 4I9WE 1C1EL 5CGMA 1ZGLB 3U36A 2FL5B 4HS6B 1IGFL 1J0YA 4YZFF 1Q72H 1A7NH 4KY1L 3UZVB 4KRNA 2H32B 2ZUWA 3AROA 1RU9L 4NYLB 4YK4C 5IQ9A 3MV8D 5HJ3B 5ABDE 5L2JA 3WYRA 3KYKH 5JIIA 2F53A 4XMKH 2XQYK 4OI8A 3SDXF 3S3PA 4U2ZA 3MFFA 1BM3H 1MCPH 1NANI 5CP7A 5HYJE 5IBTL 1CLZL 2E3VA 5HGDB 4OCYL 4L8SC 4MNHB 4ONOA 5C0CB 1MH5B 2NX5E 1YNTA 4P3DB 1CQYA 2APBA 2VISB 1UADC 4RDQG 2V2TA 4LHQB 1X3DA 5HDQH 4NRYA 4RQQB 2IGFH 4NO0A 1RJZA 3TWCH 3TZVD 1GH7A 1T5XB 4ZPVB 4AEIL 5JHDA 3BPCB 3SQBA 1S7VA 3OJ2C 4ZQKA 1R5WB 2DIBA 3C60B 3VRJB 3KWWA 1Z6JT 3MRKA 5T5FL 4GUPB 1JPTL 1SYSA 1Z3GL 2CIKA 2WWMC 2NY4C 4NQEB 1CLOL 1QFOA 5D7LA 3WFEL 2CJUH 5HPOA 4PJBF 3LEXA 2EKJA 2CUMA 4Y16A 4A6YH 5J13B 3BYTA 4X5XA 3ULVD 2NY3C 2DOCA 3GHBH 2GCYA 1GZQA 5SWZE 3BIKB 4B7LA 3BPNC 2XY1A 2FEEI 3P4NA 3ES6A 1RZJL 3BIAX 3BOVA 4OTXH 5EO0B 1XMWA 3SDAD 3W39B 4O02H 2DQTL 3FFCA 15C8L 2FZ3B 3S4SA 5DQ9B 5J0BA 4KK6D 1A6WH 2X4QB 4QHKI 4HJJL 2CGRH 1T1WA 4KQ3H 4X4ME 1E6JH 3QDGD 5EU7E 3S6CA 3MRJB 4Q9CA 4WHTB 2EDBA 1UA6L 2AEPH 2JLLA 3JVGC 2DL2A 3O3EB 4IDLA 4F7EB 2R1WA 2VLJB 4AL8L 4ZUUA 1G7PA 3ZE1F 4G9FD 4ZD3L 4KMTH 4OCSH 4XBEH 2EEDA 3EOAA 4RAVB 1OW0A 1FORL 4GXVH 2AXHA 3OF6D 4Q6IC 3KYNA 4J3UA 1XF3A 1I9EA 1HXMA 2DWEA 5TGBA 1F58H 1R3IL 1UWEL 1X5KA 4BKLB 3Q48A 4ORGA 1I8LA 5I16B 1SJEA 3NPZB 2ESVB 3L95A 4MNQA 5T1LB 4N8VA 4NC2B 2NXZC 2OP4H 3BESR 5DK3A 4H1LA 2NPLX 5EUOB 5KSAC 4WFEE 4RMQA 1ZHNA 1A7QH 5CMAA 3UP1A 3OXSB 4D2NA 1KBGL 1WZMA 4QTIH 2YUZA 1KJVA 5GS0C 3PG2A 2OK0L 5GGRY 4AMKL 4P2RE 4V1DB 2CXKA 3G08B 4KDTA 4OBRA 1E4WL 2R2HB 3SKOB 1ROWA 2AJXH 3QWOB 3HTLX 3ARXA 3DO7A 4BZYA 3EO9L 2VC2H 3FQWA 3WN5B 1ZSDB 3GMOB 5D2LE 3AREC 1CFNB 1RJYA 1FNGA 3QRGL 4U0RC 4NHCL 3MV9B 4POUB 4J12A 2Z0BA 5HYEA 1NCAL 1TQCB 2AQ3A 1A7PH 4DN4H 3OGCB 3RRQA 4CVZA 2QQLH 4DZ8A 1LEIB 4BFIB 5ALBL 3KPOB 4KV5F 1IGCL 3BEVB 4LSQH 4RIRB 5FO7B 5C0EB 4G6KH 4Q9BA 3B83A 1CGTA 3OKEB 4UMGA 4Q58C 4U6YA 4WFGD 4GH7B 5EN2A 4YDKH 4N0UA 1ADQL 4YAQA 3QEGH 4JY6A 3BPNB 1P7QB 5F1SA 4BSVB 3X17A 4LU5L 4JRYD 5IM7A 3VH8A 1CVSC 3TO2B 3I6GB 4NQDA 1E6OH 1JF1B 4PR5B 1PEZA 4RAUA 3K8MA 2YZ1A 2JF1A 4UQ2A 4QWWC 1J10A 4PREA 2HRPH 4GAFB 2Q87A 3T77B 3MREB 1CU4H 4LLVA 5DRXB 5IOPB 5I0ZA 4GG6F 4KUCF 2GKIA 2V5SA 4HQQH 2IAMC 3IDIB 2P8LB 2FBJL 4FFWD 4NN5C 3ARVA 3MBEA 4QY8B 1WEJH 2GSGA 2GFBA 2GT9A 3BP4A 1GGCL 2DM2A 2VQ1B 3GSRB 4OZHE 3PP3K 5HHPB 1CDBA 2FJHB 3D39A 4KRMB 2EIZA 3RWHB 4RAHA 1CGVA 2F53D 2YPVL 4H26A 5BZDA 1DBKL 3EFFA 2NY6D 2IF7A 3KLAB 4TSCH 4TSBH 2R1YB 4HG4K 4IRJB 1A1OA 1R3LA 4U1IA 3U7AA 2Q6WB 3RWCA 3D2UA 5DSCB 3BN9C 3WIFA 2EYSA 4R4FL 3HMWH 4NO0D 1ORSB 2VLKB 3PGDB 1VB9A 2DQCH 2VDQH 4NKOA 4S1QL 1G9NL 2GAZA 5JHDD 4PRHD 5A3IC 4K7PY 2OCFD 4KUZL 3P40A 4XNXH 3L3JA 2FBOJ 5HYJA 4LCUA 5JIKA 1FH5H 5DEGA 1YEKL 1D5BA 3CDFA 2BY0A 4S1DD 5I1JH 1GOFA 4U0RB 1JPGA 5I1AB 5D7LD 5CSZB 4K3EL 4LMQE 1WISA 3VFMB 4OZGF 4LPVA 2YEZA 5SX4I 3W9EA 3SDDC 2H9GB 4Y16D 4L9LB 1MFEL 5D5MF 2MPAH 4AIZA 3LRHA 4Z0XA 3RQ3A 5C0DA 1MCQA 5DT1L 5IHBA 1IVLA 1JJUA 2A77L 1UM6L 3BGAA 2AEQH 2HAZA 1LO4L 5HHOD 1FNSH 4JM2F 3B9KA 4FXGB 5ACZB 5C71A 1KC5H 3MRHB 1YN7B 1RV6X 3FMGL 5KZCD 3VGHA 2PW2A 4ZO9A 2ICWI 4LPCA 2Y5TB 2VLRE 4UV7L 4LLMA 4P2QB 5F7KC 1EPFA 3P30H 4RX4A 1VGEH 1P2CB 5DJYB 3F5WA 1CE6B 2VXQH 3ZTJG 3NGBC 4PJAB 2YRZA 4ONFL 3MJ6A 4P5KA 4OZ4B 4FQXB 1BJ1J 2W9DL 4J7RA 4LNRB 4JFDB 3H42L 1KJMA 1JWUA 1XIWA 5I8OH 4XPFL 1P5UA 5JIHA 1WBYA 3NTCL 1FZJA 5GGTA 1S9WB 3Q6FB 2VDNL 5INCA 1NMAL 1A2YB 3UPRB 2ICES 4UZGA 1DBML 2YD3A 4UIKL 3LKOA 4MJ6A 2VO5A 4PJCE 3X14B 5EO9A 4JKLA 5CEXA 4DKFL 2NY0B 4LP4A 3SQOL 2WM0A 4MNQD 1I3GH 4WI2A 4XXDB 2D03H 3VU2A 4RFEB 4M7LT 4PG2A 5I9QB 3OXRB 3IDUA 4GT7A 5FB8A 1CXIA 3KNBA 2VKXA 3D25A 1QBBA 1NCUA 3O45A 2YRPA 3TIEA 3UTPE 3EYUH 2DLIA 1JGEA 2B2XH 5KVMC 1CZ8H 3BPOC 1AGCB 3L9RB 4A2LA 4XI5C 4NM4H 2CDEB 4UUJA 5D7SL 3QQNA 2R15A 4HMEA 3OKNA 2HH0H 5GGQL 4K94C 5FM5O 3QXTA 1Z9MA 1TJIL 3GIZL 3QIWB 1AXSB 5CJXA 2JCCB 2JJVA 1EEQA 3ALXA 5KJRL 4Y4KC 5CBAA 1OAXL 1QBLH 3RX7A 4JDZA 4WCYL 4WHCA 3GGWB 1IGIH 5E7FA 3ZZ1A 3KGRA 1N7ML 3G6DL 4LPXA 3CFCH 3X3GL 1CLCA 2ZZUT 1BF2A 1ORQB 2QHRL 2R29L 3ZDXF 3NABH 1KTLA 4OB5L 1B0GB 4ZPTB 3H9SB 3N1MC 5LCVL 4BUGA 2ADFL 3KVQA 2PYED 4JZJC 3T1WA 4P2CG 5D2LA 1NANH 3C5ZA 3MODL 4NP4L 3LQZA 4PJHB 1XT5A 2PYFB 1AY1L 4ELKA 4NQDD 4GAGL 2EKSB 3X11A 3JV4B 4PRID 3RVTC 2NY1B 5EB9A 5E9DB 1EA9C 5L8LB 4NRZB 2RJMA 1YECH 3LKRA 3QR2A 5FECB 5E4EC 4N0YH 4M7LH 2BJML 3NGBB 4P9ML 1QQDA 1BBJB 3FRPA 3ARFC 3HE6C 1B2WL 4GMTH 2NW2B 1DQQB 4YQXL 5IFAH 1TZHB 3CU1A 4Z6AT 1B4RA 4OF8A 1KFAH 5BQ7A 5FO8A 4OCXH 1F6FB 1YEHL 3HZVA 1RUQH 3D39D 5JPNB 1X5AA 3DHMA 4ODTL 4IOFD 3NIGF 3F8UB 4NNYA 3BUYB 4OFIA 4WI8A 2W07A 1I1AA 1FFOB 3FZUC 2R0LH 4XCNA 5JTWA 5J12C 2DMKA 3HFML 1IBGH 1LEKA 4F9PC 1BZQK 4P4KC 2PR4H 4ZAKA 1VFMA 3FQNB 3UTQA 2B0SH 3EHBD 1FL3B 3BN3B 3P77B 2DLEA 2ZUYA 5HI4C 1H3XA 4U3XA 3VWJB 2W60B 5HYJD 4C83B 3O3BA 5IBLD 5J3HD 5C0FB 1NC4A 4O2FB 1KLUA 4K8RH 2NX5D 3GMLB 4OLEA 5J57B 1FNEB 2ZUQC 2J6EA 2P7TA 3DX6B 3D0VB 1JTTA 4IRZH 3GMMB 4YFDB 5F96L 4HFWB 4YGVA 1QFUL 4HKZA 1GZPA 2OBGA 3VFSB 4JQVA 5JOEA 3NIFE 4PJ5A 1MLCB 2WIMA 4DCQA 1U58A 3CU7A 4UB0L 2CKNA 3CVHB 1QSEE 1JIBA 3HZMA 4RNRA 2VITB 5T33L 3R8QA 5I1CL 2WMPA 2I60H 5EZIH 2D2OA 5T5NF 4LCWA 4L8CA 2JB6B 3B9KD 4WHDA 4R6UA 2V2XB 1YDPA 3S37H 3UJJL 5EA0H 3PWPA 3QXUA 4G42B 3CFEB 2C1OA 3JTTB 1UT9A 3SY0A 5FUCC 4TUKL 5L0QB 1I1RA 3LV3A 1T1ZA 5H94A 4GW4A 4ALAH 3VXMB 5D71L 4K7PL 4NNPH 2ZUTA 3M17A 1NUGA 5ESVB 4RX4D 2C1PA 3I50L 5C09A 5DA0B 5MEQA 5E5MB 1RJLB 3DSNA 5SWZD 5BVPH 3CVHH 2MTPA 5JPMA 1T7VA 3PGFL 4GBXA 2FO4A 1HOCB 4P9HC 5DC0A 4XTRC 4J2XA 4KJPD 2GHWB 1XIWD 4KFZC 1PKOA 2X9WA 3NFNA 1T1XA 2DQFB 2XZAL 5IVXE 2C3WA 1RY7B 4NJAH 4Q7DA 1JP5A 2EIDA 4BZ2H 4JLRB 4I0PA 1XH3B 1HYRC 5C6PB 2OSLA 1HYSC 1J8KA 5T3XL 4Z18A 4IJ3C 5J12B 1FN4A 5FYJH 2I9TB 4HX1A 5I1KL 2PTTB 2GW5A 4ORZC 1KIUA 5D1ZB 5FUZH 3RWJB 1K8IA 3AGVA 2YR3A 3O2WH 2Q8BL 4P4KB 4O4YH 4JAMB 2AV7A 5HHXL 5ANME 2AJZB 2FH6A 1EZVY 1JMXA 3IFLH 5EU3A 3B2UD 1A6VL 5KTEH 1UM5L 1BIIB 4NYLA 2Z31C 4PJCA 3HNVH 3I9GL 5D7JB 5HJ3A 3OB8A 1UVQB 3V4PH 3A6CL 4BH7B 2F58H 4HLJA 3HE7D 5HGDA 4WFED 4MLSA 5GRXG 4YO0B 1HHGB 1HI6B 3O3AB 1XFPA 3KR3L 2O5YL 5LG1A 5B4MC 5HHQB 2H1PL 2ATKA 2A73A 3S88H 4P48A 1Q38A 1TVBB 2V5YA 4RQQA 3VFTB 4A6YA 4P2RD 3JWDH 5DD0L 1IFHH 1NMCB 1T83A 5E2VL 4F2MA 4L4TB 5F7FA 3MRMA 5K9JL 4PJ7B 4ZS7L 4IOIB 2PNDA 1FV1B 2X4TB 4S1RH 5IJKA 3GSVA 3C5ZD 3EJZD 4RMSA 1I9JH 3L3GA 3STZB 3BRDA 3BP5A 3UO1H 3NA4A 4MYWB 4NQSB 4G9DA 4ZUWB 4G6ML 3L1OL 5ICYA 1F4XL 4OI7A 1ZLUK 4F7PB 5FUOH 4NM8H 2CRIA 3BKCL 4YBQD 5E8DH 5DJ2B 3FOMB 5IEHA 1S3KH 3K81A 5FCSH 3MLXL 1K9TA 4S1SL 3CSYA 4GQ9L 1HIMH 1G7HA 2ZPKH 3HG1E 3HI5H 4UAOC 1OL0A 2IBZX 4J1UB 3GO1L 1XCQA 2ICEB 2X41A 1CD1B 1Q94A 4WW1B 2ICWB 1UACL 3PV7A 4OI9A 1L9NA 5BS0B 3MGOB 4QRPE 5IK3B 4MD5A 1KPVA 1BBDH 3MTRA 2RBLA 1MCOL 3W39A 1JF5A 3P9LB 5CJQH 3G6AB 3L5HA 5DQ9A 4MMXC 2XWJA 3LQAC 1CI5A 4X9BA 2XQYG 3TNMA 5CEYA 5TH2B 5HVHB 4JR9L 4D0DA 3DGGB 3KXFB 2VZOA 3B8YA 1NSNL 2G75A 4LVHC 4X80L 1KXQE 3ZYJA 3TF7C 3GNMH 3LEYL 4RWYH 5K9QI 4KVCH 1N5YH 4JM2C 4O51B 4PV9A 1YYLL 3QIUA 3S35L 2UY6A 3G04A 1PG7X 1WZLA 4E5XB 3VXTB 2Z31B 1KUMA 5IHUL 5DLMH 1LDPH 5KSBE 2DYPD 4X83A 4LGRB 1BREA 3HB3C 1SM3H 2ZUVA 4O2EA 4DZBA 4H5SB 3LKPA 2EXYC 5T1LA 2GTWB 1OAKH 2VXTH 5E6IB 5C9KA 5F44A 3K1KC 1EHLL 4YDLC 3BZFB 3K7UA 5IWLA 2A1WL 3ZT7A 1LK3L 3V4VL 2XZZA 4BQBA 1S7UA 4MA8L 2A6IB 4PJFA 3SKOA 4OJFH 1R3HB 2HFEA 1KIQB 2BHUA 4YUEH 4JVUA 4LSPL 3RWEA 3FT4B 1T66D 1F13A 1IM9A 1FNHA 2WWKT 3HZYB 4EBQH 1WF5A 5IW1B 1YJDL 2ZCLL 1IL1B 3BHBB 1KT2B 4GKNA 4IIQA 4KU1A 1G6RB 4AENB 5I66A 2YD7A 3BX7C 4DEPC 1KEGH 3VRIB 2AABH 2ZUXA 4M4PA 3TZVC 4QRSB 3BEVA 5I1EL 4GBXD 2HT2C 1NAMH 1J05A 1WZ1H 3ZE0F 1RMFL 3ZKMD 5MHSE 3TVMC 3PWVB 4NZTH 5HGBB 4BSVA 4G7VL 2R4SL 3GHEH 5CIPB 3TLRA 5I6XB 2VLRD 2AQ1A 4J4PA 1FGNL 5FYKU 1XEDA 4I0PD 3TO2A 3I6GA 2BVQB 1EHAA 1BX2A 3MR9A 4OGAC 2E27H 4AH2A 3GB7B 3QXVA 1MFCH 4BK5A 1G6RH 3IU4L 1RIVL 2A6JB 2J4WH 5FO9A 2HT3D 1OLLA 3MREA 3TFKC 4HBCL 5DRXA 4CUCA 5IOPA 3ZDZE 1KPUA 5J06A 2VDKH 4ZYKB 2VDLH 3OB0H 3N9GH 5C0JA 4F8TA 5JA9A 2NR6D 5IVXA 3OHXA 4ODXB 4HXBH 3SDAC 1JRHI 3TJHC 5C08B 1EK3A 2J3SA 3OKLB 1WBXB 2EIBA 3FOLA 4ZXBB 3HI1B 3MLSL 1RK1A 1JGUL 1I8IB 4HIIA 3ROLA 1U3YA 3UTPD 1NKRA 3M8OL 1MCFA 1ORSA 3DX7B 4EIZC 2YA0A 2VLLB 4XMLL 4X9GA 3PQYE 2Y25A 3QB7C 3CFKB 1NL0H 1JNLH 4PY7A 4Y2DB 5DVOA 4FNLH 4PJXF 5TFSH 3HUJB 1NAKL 3WDJA 1H3UA 1XCTB 12E8L 2V2WB 3LN4A 5C70A 4FQ1L 1F00I 4NKIL 2R2CA 4HZAA 5ITBL 5TQ0H 3HS0B 4Z7VE 4ZFOB 2RCSL 1MJ8H 3DVFA 2F8XC 4XCEB 5D7IE 2WWKO 3C2AH 4DEPB 4D0CA 5HYSG 2H9GA 3I85A 1MAJA 2JJTA 3LZFH 4PRBB 5F3BB 3W81A 3KYOA 3UC0L 2NLJA 3MACH 1R24A 4P2OB 1D9KC 3ZSTA 5J6HB 1CGXA 1C5BL 4NQVA 1KCUH 2R0KL 1AGEB 5GGTL 1OM3L 3IDXH 5C0RH 4I3SH 4JFZL 1AGDB 4XH2B 2XFXB 3VI4E 3JUZA 3WUWB 4G6JH 3V52H 1MJUH 2RGSA 1MLBB 4P3CL 1DTUA 5ENWB 1F42A 3CX5J 5TE4H 4UOW1 4GXUM 5IB2A 3GSNA 1CE6A 1KELH 3MZGB 3QQ4B 1NEZB 3D85A 2EYTA 4PJAA 4XP6L 4OGXH 4FQXA 1VADA 3EOYG 5ALCH 4NDMA 3ARGA 1RUAL 4LNRA 4APQC 3RGVD 4Y8DC 1Z0NA 3O4OC 4QRPA 3OJVC 3QDMB 1J12A 3QIUD 4WV1B 2W0FB 1H3PL 4JN1H 1CYGA 2F5AL 5IQ7H 3BH8B 1OLZA 1DN2A 3P9MA 2ZCKH 3UPRA 3O11B 4POYA 2XV6B 1KTDA 3X14A 3MRGA 4JPKH 5LGJB 3GSXB 4WENB 4XXDA 1NGXA 4RFEA 1OF2A 3VWKA 2B1HH 1MQKL 4X4YA 3OXRA 5T3ZD 2A6KB 3ESUF 4JDVA 5LAXB 4FFWC 3LN5B 5E8NB 4KXZH 3RGHA 4HC1A 1ZA6B 3IJYB 4H8WC 1AD9A 2VDML 5KSBA 1A3LH 4K23H 2WAHA 3TCXA 2UUDK 2JCCA 1IM9D 3I3DA 3IDMB 1MVFA 2P49B 3AS0A 4LASH 4K3GA 4FQHA 1Q0XH 2E7BA 4ENEC 5IB1B 4PG9A 4H20H 2FR4B 4OFYA 4RFNB 5HY9B 1T4KB 1HHIB 4HUUA 5TDOB 4F15C 3QUXB 1QSED 4DKDC 4OUUA 3DRTA 4ZOEA 3G5XA 4WUUB 5EZOL 3VRLF 1X6LA 4NKMB 3MNWA 1UWGH 2VYRE 4L3CB 3RVWC 5F7DA 3OX8A 2ZJSH 5DJCA 2DIAA 2MJWA 4MAUL 2WANA 2N7BA 3MLZL 1WGOA 3RP1A 5JHLH 3H0TA 3BQUB 4F7MA 1F6AB 1YNKL 2OI9C 3BJLA 2I26N 3QNYB 3AFLA 2VXUL 5T1KA 4M1GL 1KPRB 4N9GA 4GAJH 4YIQB 2P8PA 1M05A 3AB0C 1GGTA 5ISZE 4N5ED 1UXSB 2PXYC 1J1PH 3PL6A 4U3HA 2J8HA 5CD3A 4D0BA 3SO5A 3MNVA 1FBIH 3OKOA 4HIXH 4KK5D 5EZLA 4DAGL 2XA8L 4YC2B 4FQCL 4OZHF 2P47B 2QQNL 3O4OB 2VXSL 5I75B 5JQ6H 3QEQE 3RL1A 1BP3B 2KL6A 3MNZB 1Z2KA 4LOUD 5CINL 2V9TA 4RFOH 2X44D 2OL3A 1R0AH 1MI5B 5LQBL 2YPKA 1GJIA 2CLRA 5A43C 1B9ZA 3UTTE 2J6EL 4B5EA 1J8HE 5F1KC 5I8KL 1HILA 2X6MA 3PHQA 1HINH 2LTQB 5I1DA 4CNIA 5KBNC 4Z7OE 1DLFL 4ZG1A 4F8QA 4JZNB 4Z7QE 3H9HA 4F37F 1A6TB 2NXYD 4CMHB 4R0LB 4ZNEA 1MCIA 5DGRA 3EDKA 1FL3A 3TBWA 1FAIH 2XXMB 2BNQA 1GC1L 3P73A 4XC1H 3PHOB 3K46A 4YHYC 4JFFB 5CEZH 1F6LL 4KMQA 1QSFB 1CCZA 4C83A 1IAMA 3FQXA 5ADOL 5L9DH 3KDMB 5BV7C 4MCYA 4LCIH 3IAGC 3HNTL 3EYVA 3T2NL 2VZUA 1FLRH 5GRWA 1S9YA 4ODVL 4C57C 3O3UN 3QHFH 3NACH 3BKML 2HN7A 2OR7A 3EDEA 1FRGH 3PQYA 5GRUL 4X6CE 2Y6SD 1BQHG 3CVHA 4WI5A 4RGMC 2VITA 3EOBA 4OFPA 3FTGB 3ULUH 2DICA 1DLHA 2DWDB 4WW2B 1A7NL 2L4OA 3TBVB 1J88A 1OARH 1RJCA 2V2XA 1F97A 2EE9A 3TO4C 4G42A 2W9EH 43C9A 1ZANL 4LHUG 4CGTA 1PYWB 3KYKL 1EH9A 5F3HB 4JZOA 5E2UH 1BM3L 3ELAT 1OWWA 4ZTPH 4M6AA 4X6FA 4LCYA 3HG1D 1AGBA 3T2OA 1EHNA 3TYFB 3D85D 4EI5B 2K9UA 4KZDH 2O61B 2LAGB 3MROA 5HDQL 3CSPA 1RZIB 2IGFL 1I85A 3TWCL 1T7YA 1R5VB 3K4DA 3KYAA 3IJHA 4PLJC 4OZIB 4DQOH 2VUOA 2SEBA 4OF7A 1H9VA 1JMZA 3U0TB 3IDYB 1ES0A 4QRUA 2EDHA 5TE7H 4M7KH 3DVGA 1DUZA 4BQCA 2Q86A 2K7QA 2GY5A 2CJUL 4L4VB 1MRDH 3DTXB 3VGDA 3ZT5A 1VACB 3BRGC 4A6YL 3QRFM 4JAMA 3LKNA 1Z9OA 3G5YB 3GHBL 5FGSA 2VDPH 1OAZH 2AKRB 4NQUA 5ETUB 3KPQA 4Q9RL 4IOFC 4JRXB 4CRPA 1P4LB 5D7JA 2HP4A 4Y7MA 2IPUK 3QXAB 4JN2B 3RY6A 4BH7A 3QUYB 4P46D 4KROB 3WS3A 3V5KA 2QKIA 3KJ4C 2VABB 1D5IH 4G7YH 5BRZD 1A6WL 1HHGA 1HI6A 4WWKD 2CGRL 5DS8B 4PRAA 1E6JL 1E4KC 1JBJA 4Y4HC 5J9PA 1MJ7H 4LLUB 1XGRB 5F89A 3T0BA 5JXAH 2X05A 3E6HB 4QKXB 4I13B 4XBEL 4X4XB 1HEZA 4AQOA 1FV1A 3QA3B 4GXVL 1M7IA 4XPBL 1RUPH 3O6FB 3STZA 1JGDA 3BPLC 1HCVA 1F58L 2Q7NA 5T1KD 2X10A 3KJ6L 4D94A 5DHVA 4PD4K 1OT2A 3IGAB 1AHWC 2DKSA 3MRBA 4UTAH 1YQVH 4Q9QH 4OV5A 1F02I 5MI0C 5D93B 5AEAA 2Y7QB 3DHJA 3PL6D 2OP4L 4XZUA 3MLWL 3NH7H 3PP3H 2F54E 4LAQH 1A7QL 5MHSD 1NGYB 4OFVA 1C16A 2OXGA 1E4XH 4WTZG 2AW2A 2V5RA 1FG2B 4M1CD 1QVOA 3O4LB 1Y18A 2PW1B 2XKNA 4WDIA 3O8XD 5BS0A 2CKBH 5EORH 3MGOA 2AJXL 5IK3A 4MA1C 4UQ3B 2DQDH 3BXNB 1FDLL 2PO6B 5IP4A 1T7WA 4TTDC 2YKLH 5ISZA 1BFOA 1WCQA 5F7WC 3NMEA 5DVNA 3EYSH 1A7PL 4DN4L 2QQLL 2Z4QB 3MO1A 1CDHA 1CICB 5C0AE 4LLQB 5E2TH 1FCGA 3FB8A 3IF1A 1UCBH 2GK0B 4LSQL 2BVPB 4NBXB 1L0YA 1X5IA 4G6KL 4P4RB 4JJ5B 4ETYA 4N0CD 2I9LB 4PB0H 3RZCC 3PJSB 3SCMD 3VG0H 3VXTA 3UTTA 4PJDF 3RTQC 1RQ5A 2VL5B 2EDLA 3C5SA 3A67L 4H5SA 3DMMD 3KJ4B 3UBXG 1E6OL 4MVBD 5C07D 1BVKA 4M7ZC 5ID0B 4CU8A 4Y4HB 3PQYD 2HRPL 5E99L 1V7NH 2N1KA 1EEUA 1HH9A 1A8JH 5TDPB 1CU4L 4HGWB 2YD8A 4MAYC 4IMKA 1NAMA 5KAQG 4HQQL 5INDB 1QRNB 1FL5A 3N06B 4HWNA 1WEJL 3KYMB 5KS9E 3MUJA 3RX5A 3MUZ1 1F3DH 3ULSB 3HE7C 3QJHA 4RGNB 3B6SA 2X42A 3QI9A 1NGQH 4TSBL 4TSCL 4TYUA 4MS8C 4EVNB 4X6CA 1KT2A 4OFKA 1G6RA 3PWNB 4YNYB 5MI0B 3ARUA 2VH5H 1YPZE 3VRIA 1CIDA 1P7KB 2LQRA 3HMWL 1FYHB 2ENSA 2ZOLB 2CLZB 3C5JB 3D69A 1ACYH 3AUVA 1G9MC 3CDGB 2DQCL 2VDQL 1IRAY 2EE3A 4QF1A 3RWFA 5CFHA 1RPQA 4IS6A 2X4SB 3BGFC 5I76A 3C6SB 4XNXL 4G80B 4MA1B 2YXFA 3KPMB 4YWGH 3UJIH 4B53A 2EZ0C 3J8F7 4KKCD 5CEZE 4FABH 4KZEH 4YBQC 1A1MA 3WD5L 5IJVA 5I1JL 1QKZH 1OQXA 3GB7A 4OLWH 5J6GA 3QG6A 2A6JA 4LKXB 5I1GH 5L88H 4C58B 1QR1A 3WO4C 1DVFB 5DRNA 1BMGA 1NLDH 2Q20A 2IH1B 3TA3B 2ZSVB 4OT1H 5D9SA 4HKBB 2AEQL 4HUNB 3VXRB 4ODXA 4Y1AE 1FNSL 1U95B 2CMRH 5E08L 1DL7H 4JFEE 2B39A 4HPYL 5FAAA 2DQHH 1KC5L 1SEBA 2ATPA 2R56H 4ETQA 2NTFA 1WBXA 3PUCA 1YMMB 5FA3B 4ZXBA 1A02N 1KLGA 2C4FT 2GSIA 1EBAA 5L6YH 3WSQL 1QPPA 3IXAB 2VRAA 3NOIA 3P30L 1VGEL 4ELMB 4Y88A 2VXQL 5DQJB 4NPYB 3GMPB 3FB6A 2EICA 4PJ8B 1QBMH 2MSPA 3CFKA 2QADC 4G6FB 2H8PB 4PGBB 1AIFA 4EN3B 4LARH 3T4YB 3ME0A 2L0DA 3QFJA 1VGKA 1RUMH 4JGMA 4JB9H 3QUKA 3V6FB 1R5IB 1H5BB 2V2WA 2IC2A 4Z95L 2X4OB 3ARBA 1AKJA 2XNAB 4ZFOA 1I3GL 4XCEA 5C9JB 5CZXD 1MIEH 4JKWA 3GSNL 4PJ9A 5HI5C 3RWIA 3TYGH 5IF0B 3GI8H 4L1DA 2V17H 3C09C 4UIMB 2CK0H 5HHNA 2X7LA 3H3PH 2A2QT 4BK4A 4ZS6D 4X6DF 3EYUL 1AQKH 2B2XL 5E95B 1AO7A 3VXPA 5SWQB 3EO0B 1Q8MA 4NM4L 5ECJE 2EDXA 1UJ3B 4I4WB 1X7QB 2BSTB 1AGEA 2HH0L 3HPLB 1T66C 4G8EB 5DD1H 4JGJA 2CDFA 4IRSA 3FO9A 2DM3A 2EIEA 3OR6A 3U0PB 5D1XC 4F33B 2XFXA 3WKML 4O00A 3MRIB 2X5PA 3P0YH 5ISZD 4JCMA 3WUWA 3H6JA 1QBLL 1MLBA 1MFBH 2F19H 3VFRB 4MX7B 3SGJC 5ENWA 2F54A 2IEPA 1IGIL 3UZEA 3MRDB 1IKNC 3QQ4A 3UTSB 1T89C 2WBJD 2YPLB 4DJMA 1HK6A 2JIXD 3OR7A 3QEQD 3NABL 2EDKA 3MV11 5EU5B 2VLJE 4HC1L 1UGNA 3QH3B 3QIBA 3QDMA 3TN0D 4PRPB 5H2BA 1JUFA 4XPAH 3E3QE 5D70H 3UTTD 4GAYB 5GZNC 3DX8B 1J8HD 1RIHH 3DURA 3ZKXC 4G6AC 1LGVA 1BVLB 3C8DA 3SBWA 1FZMB 3ARDD 4NC0B 3K8LA 4JG1H 2HT3C 3JTSB 2ARJA 4FQPA 3AS1A 1EJ6A 5CWSB 1YECL 4WHYG 5LAXA 1A4JB 2XG4A 4M7LL 4N0YL 1NGWB 2ESVE 1FGVH 1NBYB 5EUOE 4GMTL 5KVFH 1ERNA <