4GAJH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 411-424)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
209
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDTSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
total genus 37
structure length 209
sequence length 217
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH02
1KB5H 2IQAB 2XICA 4DFIA 4YHPB 1I85C 1IC1A 5FYJD 2BX5A 5TDNB 1GJIA 5C07A 3REVA 2W65B 3NCJH 5I9QB 5HHQB 1SM3L 1TVBA 4I0PD 1IEBB 4XP5H 3GSNB 1JGUH 3VFVB 3QUKA 3PQYB 3UO1L 1HQRB 4HS8L 3W39B 1D6VL 2ZSWB 1RJLA 2GI7A 2Y6SC 3ULUC 4H1LH 4ZFGL 4HJGA 2Q76A 3WV0A 1G0YR 1BQHB 3C5JA 3O6FB 3VGAB 4XP9H 4G6MH 3JV0A 1IRAY 3MLVH 4WIQA 4AY0A 1N5AB 5KVDL 4Y89A 3CZFA 2LV4A 4NN6C 1LO2L 3SO5A 3HE6A 4G7VH 3QIBC 3VXME 4PRAA 4P9HC 4NQXB 5DMKA 5IJKC 3QPQC 4GMTL 1DDHA 4ZUWA 4LSQH 3L6FB 4F58H 2DAVA 4HH9A 5AWNL 3HNVL 4DFHA 1ZT7B 1J1OH 4B53A 3I3EA 2JK5A 5HYFA 4RNRA 3U0WL 1IBGH 4YFEA 3HE7C 1JHLH 1FZKB 1ORQA 1HHHA 4IRSA 3OKNB 3D48R 1T0NB 3B2UC 3NCBB 3BJLA 4ZS6D 4YPGA 4NQDB 1BVKB 2W9DH 4KAQH 1ZTXH 3BSZL 2Z8SA 3SDAB 1B0GA 1IJ9A 2F58H 3HKFA 5GS1A 4MCZA 4M93B 1YEEH 1AJ7H 4D0DA 3LPFA 5TE6L 4WTZA 3RI5K 5KS9A 1FFNA 4M62L 3TYFA 1QHOA 4CADA 4LLQB 5D7IA 5ISZA 1ZLUK 2YD6A 4F8QA 4XWOD 1UVQA 3QO0A 5BZDB 1WV7T 2DLFH 2VN7A 5I1KL 1FC1A 2CDGA 1EEUA 4ODUB 4P4RB 4GG8B 3O41A 2Z8RA 3CLEH 3NFSH 3RZCA 2AGJL 2KZWA 2WNGA 1JE6A 4R4NC 4U6HA 4KQ3H 4JPWH 4LBEB 3NN8B 3GIVB 3KXFE 4JDVB 1ZAGA 4YHLH 4TRPL 4MHHG 1Y18B 2I5YL 1E27A 1BQUA 3IDXL 3L5JA 5CJOL 1RZ8B 3VXMD 3ZDZF 4BQ9A 4QRRB 3D2UD 2CK2A 3U2SB 2B5IC 3WXVL 4HFUH 3BP4B 3KPMB 1VFUA 5ESQA 1H5BB 1DE4B 4OCRL 4YQXH 3HMXA 1IGJA 3QEGH 2CO6B 1HEZA 4HKXA 3CFDB 3PIQA 3ZHDA 4JM2B 3S36L 4MA1C 2QADB 1T22B 5I73B 5D1ZA 3PWJA 3GJFH 3HPLA 4DK3A 4WFFE 1I1YB 2R0WL 3NAAH 1UG9A 5KG9A 5HHVL 4YX2H 4LQ1A 5FYKL 3AREB 5A2FA 3KDMA 4Z7WF 5TQ2H 1OW0A 2NY2B 3MCLH 3EYOA 5HHMD 5IR1B 3OX8B 1OB1A 4KJYA 1A6ZB 5GS0D 4M6MH 3SE4C 1JWSB 3ARDB 5JPMA 1DP0A 1OOAA 4S1DD 5I9QC 5GS0H 3GJEB 1IC5H 1B9ZA 4K8RL 5DJ2A 4UUJB 2PXYA 2GAZA 2HVKA 2JCCB 4KK5D 1JI1A 3UPCA 4WVRA 3OF6D 2PR4H 2W0FB 3P11L 4HXAH 4JG1H 4HULB 1UWGH 1A8JH 4PREB 4L4TB 5DRWB 4YBLB 4NKIL 2GJ6B 3O11A 2ATKB 1D6VH 4XBPB 1IGTB 1T20B 3MJ7B 1TITA 5CHNA 3N9GH 1DEEA 1S9YB 1Q8MA 5EBWB 3UTTE 1RJCA 5D2NB 1NC2D 2QQLH 2XZZA 5I75C 5E6IC 3QIBB 3S36H 5C3LD 3P0GB 1XFPA 3KPLB 3OZ9L 5JHDA 4BFEA 3QDMD 3RWEB 2P44B 1FO0H 4QTHB 4EEEA 3JWOC 4HCRL 1H3VA 1MCLA 2AXGB 5HDQH 4HUMB 1CR9L 3PP3K 2GQHA 5J56B 1BBDH 3H7BB 4JKLA 4TNWK 3GI8L 3HE7B 4ODBD 4PJBB 3U0PA 5DVMA 4UT9H 2FZ3A 4CVUA 3M17A 4OI9A 1MHPH 1RFDL 2DM3A 2XT1B 4F57H 4K3EH 5MHSD 1G7JB 4ODXB 3IU4H 2K1MA 4FQXC 4R26H 5HHME 3KXFB 1OL0A 1RSFA 1MCWW 3E8UL 5IVZA 1RUQH 2NY6D 3HR5B 3VU2A 2AXHA 2FD6L 3I02B 5GGQL 4M3JA 5GRUH 2BOCA 4LAQH 4RAUB 3E3QE 3OR7A 3RJQB 4RZCA 15C8L 5LQBL 4QOKD 5EO1B 5LBSH 4JPVL 4LNVA 1B4RA 5BZWA 3L7FB 5DD6A 3OMZA 2VB5A 1EUUA 5CGYD 1DBAH 5ILTH 5D4QA 4RMSA 3VMNA 5ADOL 1IKNA 4ERSL 5ESVA 4AJ0A 1TPXB 1X44A 1A4JB 4JFFE 3TBWB 3SE3C 3HNSH 3PG2A 5B39A 3TO2A 4JANA 1VB9A 3G5YB 5C0ND 2XWJB 3MRIA 4M1GL 1M6OA 3TT3H 4ZS7L 3RWDB 4NRXB 1QFPA 4QRUA 4S1DC 5D7JA 5EOCH 4ZFGH 3QUYD 4P0DA 3T77B 3OAYK 5D9SB 4V2BA 4X6BA 5FYLD 2HVJA 4RMWA 3SE4A 2O5YH 2AEPH 5T1KB 5EIIB 4HWZB 4I2XE 3E3QC 3BPOB 1NBZB 1H5BC 4ZOCA 5IBUB 2AJVL 4L4JA 3SGJA 4N1CA 3CPLA 1JPTL 1KIPB 1FL5B 1T5WB 4KMQA 1BLNA 1N6QL 3SCMB 2AJXH 3TPUB 3EYUH 3O6FD 1KLGB 3QIWB 1SEQL 4MD0A 5TQ0L 1SJHA 2ZNWA 1R3LB 1UM4L 2I60H 2QADC 1FC2D 1CD1A 3S98A 3N50A 2E7LC 3FL7A 4GRLA 4N9GB 4DEPB 4J3OC 1HI6B 4ODVL 1KBGH 4X9IA 4KJWC 1GC1C 5CEYB 5IB3B 1DUYA 3MLUL 2M2DA 2X4OA 4D0BA 4KTDL 4Z76A 4G8GB 4LHUB 2ZPKH 1H3TA 4XCFH 4YC2B 2GTZB 3H9HA 5K33A 4DGIH 2IBZY 3JUZA 5I1GL 4JN1L 3WS6A 4MNQA 4P9ML 4K3HA 3QQ9D 3BD4A 4YHNA 4F9PC 5EIQA 4DK6A 4PJCE 4XCNA 2UZIH 3MRLA 3ROLB 3QULA 4WTXA 3SDAD 3GDBA 2FECI 2OMBA 4PGEA 4KHXH 2Y4SA 4LF3A 3ALXA 3EOAB 4F33B 4R7DA 1SVCP 1X5YA 1QVOB 1F6LL 4H20H 4M1CD 4NGHH 4EI5A 3NPZB 1MRCH 3O2DH 4YBLC 4KUZL 4TTGA 3AGVA 4K7PX 1MFCL 1D6EB 5E6ZA 1UCTA 2X89A 1CDUA 4KK5C 4KZEH 2SEBA 3QQ4A 4IOSD 4L4TD 4K23L 3S35X 4DZBA 1WBYA 5IV2B 3TA3B 5IHUL 2GJ6D 3NAAL 1K6QL 2YKLL 3BO8B 1IAKB 2V17H 5F71A 4QRTA 1NAKL 5E1HB 3ZKXB 4QCIB 2IH1B 4YE4L 5HDOA 4NBXB 4Y2DA 5B39G 3QXAA 2PCPB 2XQBL 2KH2B 2BY1A 4UT6H 4MJIA 4JFDE 4U0QB 1HOCB 3OGCA 4P23A 2D3VA 2X4TA 3DGCR 4G6AC 4OLWH 3GBNH 3LRGA 1U9KA 1I1RA 2OX5A 3VFMB 3W0WA 4R9HA 3WSQH 1ZA3B 1QSED 1PKQE 4XNXL 1DANU 1PG7H 2BVPA 3D25B 3OHXB 5GIRB 2FWOB 3BJ91 4NYLB 4YHLL 2YZ8A 4L9LC 3BVNA 2ZSVB 3JTSB 5DGQA 1RMFL 1TTFA 1XR9A 2QADD 5KSAA 2XZQL 1P7KB 2CMRH 3O0RL 1MCDA 3LEYL 5T1LB 1HQ4A 2D0HA 4C57C 3DUUA 1Q9KA 4I3RH 1DCLA 4QOKB 5IF0A 5IHBA 3BH8A 5EG6C 3VXMB 3RVTD 5BOZG 3DUUB 2V5SA 5GRJL 1HQ4B 1HYSD 3UMTA 1CLYL 4JY6A 1LQSR 2Z31A 5IM7B 1QBLH 4PP1D 4QHUB 3RWHA 1AHWA 4P23C 1UM4H 2I60L 3PGDA 5LJYH 3V7MA 1BOGA 5JDJA 3VWJA 4S1RL 4EIGB 1Q0XL 3RUGA 5JQ6L 3IS1X 2X70A 3QSKB 1YPZE 5MHSE 3RAJH 2AEQL 2RR3A 1S7TA 3CFCL 2FEEI 4UIMA 1V3LA 1A3LL 2VLKE 4IDLA 3N9GL 3S9DB 2HWZL 3P3YA 4MA3A 4GW5B 3A6CL 1MWAL 1GGCH 4GRWB 3LIZL 3QR2A 4OF7A 2X4TB 43C9B 3IDMA 4FQ1H 1HOCA 3HTLX 4CVZB 4Y4HA 4GW4B 4MJIB 3GHBL 4M00A 4N5EC 1QBBA 2UVFA 2BNUA 2H2SD 1F5WA 2AK1L 4Y2DB 1U3ZA 1YYML 1J0ZA 1OSPL 2C1OA 1OTTD 1BF2A 3C60D 4HH8A 1QSEE 5JW5A 4OZHF 2GFBA 3QIWD 4BZYA 3ILPA 1ZKAA 3QZWA 2YA1A 2Z8VC 3H9SE 2GK2A 3L3JA 1A6UH 1NUDA 1ZHLB 3W2DL 1AC6A 4DZBB 5DHVB 4G6JH 3MV7D 5DHYA 3EO0B 4ZPTB 4KKLC 2Q86B 2Y6SD 2SEBB 2BMKB 2FX9H 4ONGH 1D6EA 4HGWB 1BWMA 4TPRH 1FV1B 3BXNB 2QQKL 2FBJH 4PJ9C 3S3SA 2P45B 3I2CL 4XPGL 2Y23A 3IAQA 3RUGF 5I1HL 5JOFA 3MODL 2EXYC 1H8OA 5CILL 5MEOB 1OGAD 3FB7B 2KZ1B 1NPUA 5DF0A 5E1AB 1UYWH 1CI5A 4XCNB 3QJFA 4DN4H 1RAMA 4KROB 2CR6A 4KRPD 2OBGA 4WRLA 2D2OA 3BPCB 3RWGB 4FQIH 2C3VB 4J3VA 4KI1A 3F58L 3K74B 4P5TC 3VXUB 1FZJA 3I50H 5D6CB 5FOJA 2DTSA 4NO2A 3LKSB 4JREB 2A9ML 1SY6A 2O26U 3TJEL 1QLEH 1CTOA 1OGTA 4H5SB 1XGTA 1YEKH 1T7XA 2GUOA 3GSUB 4AEHH 4LCIL 2WQRA 3SGJC 1R3LA 4YGAB 3ZSSA 4Z7NE 3I9GL 3C8KB 4NNPH 1JP5A 3QO1A 5JOPE 3MLXH 4ZTPH 3RIAF 2EDXA 1JK8B 5IT2L 2OLDA 3FFCE 4HEME 5EIIA 3QFJD 3FN3A 3KR3H 4O2CB 3UZQA 5I8KH 5D9SA 3ZDXF 4NRXA 1KENH 3U4AA 1KCVL 2C1PB 3GRWL 2BSTA 1YEJL 1LO5B 3B3IA 4JZOA 3TBWA 3SGEH 1UM5H 4X4YB 2CJUH 4PJIE 2B4CC 4JCMA 1A6TB 3JXAA 1DSFL 4MZ2A 2O61A 5FUCE 1JPSH 3NA9L 4QXWA 1TQBB 2WBKA 3BN9C 3WLWD 3RWJB 4IDJL 5EO1A 2FX7H 3MLYL 3IFLH 2BDNL 3WUZA 4OZGF 2VL5A 4YIQB 4JHWH 2F19H 3SE9L 1JV5B 4AZ8A 4OZFH 2H2PD 4X9BA 1FAKT 2X4QA 4OM0H 4AL8H 1HN1A 5KJRH 1TJIL 2BC4B 1TETL 1IGFH 3L5XH 4LVOB 5MEPB 3KXFA 1ZWIA 3O8XA 2BXYA 3BAEL 4D0CA 2IGFL 3LMJL 4ODXA 4ODTH 1QZ1A 3ULSA 5FCSH 1KJVA 1J0HA 4DGVH 4GAFB 1BFOB 2AV7A 4R96A 4Y16C 3EJZC 4X98B 1AGEB 3W2DH 3IF1A 4PJBA 4WWKB 1DQQA 3RY6C 2CXKA 5DLML 5T1MA 4ZUVA 5FXCH 3UYPA 4FQ1L 3MRHA 3IDYC 5FYKH 4XMLL 5CCKH 2YC1A 4H0IA 2R39A 3GMRA 1PAMA 4FQQB 1TENA 2FCBA 2Q6WB 3UX9B 4QRSA 3ZKND 3P9MB 5JHDB 4M7KH 3QIBA 4ZO9A 4GSDH 5KSBE 5EZOH 1A6WH 1NLBL 3BMVA 4CDGC 4CJ0A 4AIOA 2QL1A 4ZSOA 3ARFB 5ETUB 4HS6A 2GY5A 2I26N 3IDNB 2HFGH 5IFJA 4PP2A 4PREA 1P4IL 4XP6L 3NH7L 4GLRI 2LVCA 3S8WA 2QKIA 3IF1B 1ED3B 1A47A 2PYED 1JPGB 5MEQA 4ZFFA 4NQVA 5C08E 4LRNH 1MNUL 4K3JH 2GK0B 4UUJA 1RHHB 2P7TB 5ADPL 4D0CB 5LCVH 2PO6C 3ARSA 5CJQL 1ZWIB 3MJ8A 4PJ9D 5E9DD 3ABZA 1KACB 1HK6A 5FYLL 5EDXA 2EDQA 2B39A 5E4EC 2X6MA 4ZMAT 1T66C 1ZLVK 2DB8A 5DQDL 3NA4A 4YIQA 5I1GH 4HQQH 3MV7A 3RWJA 1ZGLA 5AWNH 5I1JH 4OZ4B 1SQ2N 4IOFC 2DLHA 1MIML 5BRZE 3TGXA 2FYYB 2MFNA 3X13B 2E9BA 2EDOA 3UZVB 4PUBH 1XF2B 3DUHA 1T22A 3HC0A 1CU4L 2JELH 1U8NA 4HD9A 4JO3L 4PLJD 1Z3GL 5EN2B 2HJKB 4GKNA 3VG9B 3U30B 2VDQL 1ZT4B 4LLMB 1KJ3L 4CVXA 4RRPA 4UTBH 2AEWA 1DE4A 3WLBA 4URTB 1EHAA 5E70A 4MB5A 1OAKL 2P43B 4ZSOE 4OLXL 4PJEF 1QFUL 1FDLL 3E2HC 1IGML 1C16A 5C0RH 1NCAH 3CVIH 3O9WA 4LPCA 3WN5B 5E00A 4G8FA 2DWEA 3HNTH 3BOVA 32C2A 5H37H 3PDOB 2VZOA 3QUMH 4ZUTA 3TT1H 5TE7H 2VZ1A 4OGAC 2P49B 1A7NL 1YUHB 3ZKNC 2WUCH 3TN0B 1ZT1A 4EN3B 1U95B 4XCCL 1OQXA 5E8PA 2FL5A 1TTUA 5I1DB 4NOFA 2OI9C 1MI5A 2AAVA 1XGTB 1EO7A 4KUZH 3TIDA 4JFDA 5D7IB 1JF1A 2A1WL 2I27N 2QSCL 4AEIH 2Y25A 4JRYD 1INQB 3C9NB 4M48H 3ARQA 2CDFA 3VXUA 2Y5TB 4U7KA 1V3JA 2NW3B 4HIHA 2J5LB 3V7AG 1S9VA 3HCVB 1AR2A 5SX4I 1JZ5A 2F53D 3O6MH 5J13C 3IRZA 3H42L 3IFNL 2DQUL 5EFIA 3VDBA 1T0MA 4WU7B 5MEOA 4HG4J 3LIZH 1IM9B 1VFAB 2QR0A 1MCWM 1ORQB 4IRSB 2P48B 4ZAKD 3R0MA 2V2TB 3BXNA 3H3PL 1FV1A 1KCSL 2VZUA 5E7BA 2DM2A 5CINL 1NGZA 4FNLH 5K9QI 3OWEA 4U0RC 3AY4C 2Q86A 3MLWL 4U33A 5DHYB 2HN7B 1VEMA 2A73A 5JNYB 3NFNB 3EFFA 1ZHLA 3ILQC 3V52H 2A9NH 1RZJH 4LNRB 2Z91A 2BNQE 3S7GA 2AS5M 4LLDA 2J8OA 4WI8A 2GFBB 5DMYA 3VCLA 1F13A 4S1QL 5JW4R 1AR1D 3MLRH 4IBLT 1U3YA 5GJSH 3QIBD 3ARFD 4JN2A 2BY3A 4CUCA 1MPAL 2EH7H 3NACL 4GW4A 1RJYA 3UBXG 3H42H 3IFNH 1HQRA 2OJZL 4HBQA 3IDIA 3PP4H 2E3VA 4FG6D 5HGAB 4GXVL 3LQAC 3TLRA 3D39D 4D8PB 1D3CA 5FB8B 2BNQD 3I6KA 2NR6C 4LQFH 3LKRB 4PJGB 1IC5L 1QBML 4M6AA 4YHPA 1MJJA 3EDEA 4J3TA 3U4EA 2O5XH 3R4DA 3JBG7 1AHWB 4MXWL 2IQ9H 3DSFL 4PJGF 4Y5YA 4GBXB 4UMGA 5CJBA 4JFHD 5FGCB 1IC4L 5I76B 3H3KA 4JFYB 1MEXH 1UZ8A 1D5BA 5DQDH 4FOMA 2XQBH 4JQXA 1AGDB 5HHVH 4MCYB 2G5BB 3SDDC 2BSED 2VXUL 1YEGL 4U1IB 5DFVC 5DR5L 5IF0B 3TO4C 2GJZA 3E8UH 3MNZB 3D0LB 2XKUA 1AGBB 3QUMA 2A9NL 3OAUL 4D9RE 3FOLB 3U30C 4G8IA 1OSZB 1XR9B 3UAJD 3V4VH 5D1QB 5KSAB 3WIFB 1BPVA 1HXMA 2AABL 5GHWL 2ZSVA 2BJMH 3ES6B 5GIRA 1EXUA 4TVPH 1FGNL 4K7PL 4H1LA 5FOBB 2VDQH 1CXIA 3MNWB 1F4WL 1I8KA 1CG9B 5A2KH 4PLJC 3MYJA 4NZDA 1N0XH 2H6PB 3QT2A 1K4DA 3VXQA 4ZDHB 4Z7OE 4JGMA 3FCTB 1ZVHA 3MOAL 2FSEA 4BYHA 5L7XL 2FJHA 1ZXQA 2ICWJ 4G43A 4H1LG 2VR5A 2YSSA 3I9GH 3Q48A 4ZFOA 4HMDA 4KFZC 1A6VL 4GG6E 3STLB 2FH8A 4Y5XA 2P1YA 4IRZH 5JTWA 1HXYA 4KKBC 1UWGL 3DO3A 3VRJB 4C54A 1T7VA 5DK2B 3CU1A 3BHBB 4KRLB 2YD3A 3FO9B 4WY7H 3RY4A 1H8SA 3SDCB 3MPCA 1Z0MA 1F58H 4NP4H 5HYJD 3T1WA 1JHKL 5JORA 5E2TH 4JKMA 5A3IC 2VIRA 1PDKA 5JHDE 4MWFB 1HH6B 4WGVB 3G6JF 2DN7A 1U6AL 3GSNL 5KJRL 2QHLA 5D7JC 3BRGC 4U49A 4HC1L 4JFXA 3TT1L 5GS0C 3EYUL 1QVOA 2PF6A 1YMHB 1PSKH 2VXTL 2HLAB 2OZ4A 5I66B 2HT3C 2EYRB 1I7RB 4J23A 4OZHB 3DTXA 3FB6B 3FT2A 3IDGB 3VGAC 3U7AA 1F4HA 3AROA 3EO9H 3EO1B 1MCEA 3PNWB 1RD6A 1A4KA 5EPMA 3JVGC 2ZCHL 4NN6B 4RWYL 2PTTB 2GTZA 3VGGA 1OAYH 2Y5EA 1CYGA 3L95B 2JJVA 2J88H 1LO2H 2I5YH 2FRGP 3TCXA 3TNMA 3EYVA 3FRUB 4LEOB 4X99A 1SVZA 4G6ML 3RNKB 5JOEA 1GIGL 3FAWA 4NC0B 1NFDB 4HIIA 1QA9B 3CC5B 3ILQD 4WW2C 2X7LB 4GBXD 1A6PA 2VLKD 4PRNB 3AFLA 4N0FB 5IGXH 1U8OB 3ZE2E 3HI1A 3TBSB 3SDYL 3LVEA 1FL5A 3O4LE 1INEL 2MHAB 3SDXA 3H3BC 5C1MB 1ETZB 4NKDA 4POYA 4JHZA 4UOW1 3THML 3EYFB 1X3DA 5I8CB 3BZFB 3P73B 3D0VA 3VDAA 4M93C 4OTXH 3QIUB 5IG7B 3BE1H 1G6RA 5IW1B 1JN6B 3CSPA 1J05B 4L9DA 4MYWB 3L5IA 3SKJH 1FGVH 5GGVL 4X6CA 1A4JA 2NY5L 5E2VL 1VKXA 4Z7UA 4PRIE 4YDVA 3SDDB 1JBJA 4LHUD 1WVZA 2OXHA 8CGTA 4Q6YA 4OSUL 3VXSD 1N59B 5ANMA 1F4YL 1D7FA 1EZVX 3BE1L 1ZHKA 4N8VB 1A64A 1T1WB 5J06A 4RAUA 2XQYK 4RBPH 5EUOA 4WNQA 1MRDL 2NXYC 4OIIH 3SJVA 5CSGA 4HC1A 4DKDC 1AIFB 3HR5A 2FBJL 1CXEA 3O3BA 5ACZB 2B5IB 3IJHB 3KYOB 3GSQA 4Q9CA 3WIIH 5CIPB 1XZ0B 1FVEA 3U9UB 3WO4B 5IMLA 5INDB 5IGXL 1Y6MR 1OW0C 2UUDH 5FHBH 5FF6A 1U8MA 2Y7QA 3ZMRA 4JFFB 3KPQA 4G8GD 1R3JB 4WI9A 4CN6A 1OLZA 4NM8L 3OQ3B 4LU5H 5EUKB 1FL3A 4WEBH 5E6YA 3HA0A 1IAOA 3UO1H 2DQDH 1TXKA 1KFAL 3IB4A 3AS2A 3WMSA 1F4YH 2ZOLA 4X6FA 1REIA 3EJYC 1NSNL 1S9YA 4Y16D 5EBWA 2DQHL 3VRLE 3QWOA 1IGTA 4JRXB 1A7QH 2AP2A 2GJ6A 3O11B 2O93L 4QHNB 4O02H 1EZVY 1XAUA 5J6HB 4QYOB 4KQ4L 4Z7QE 4X7SH 5CLTA 3QPQD 2KL6A 1X4YA 3QDJD 1OQOA 4U6VH 3STBA 2HLFC 5EU3B 5DJ2B 1EA9C 4G9FA 3KR3L 1UC6A 3R0NA 3CSYA 4U1SA 4UDUA 1FNLA 1OWRM 5B38A 1DL7L 2VDRH 1U93B 4DGYL 3QUXA 1NKRA 4BELD 1A6VH 3QAZB 4NUJA 3WFHB 4ISVA 2X4NA 1YN7A 4KI5F 3H9SB 1WZLA 1WC7A 3H0TB 1I1YA 3HC4L 4JB9H 5EU4B 5FYJL 5KVGH 1AFVL 2G60H 2X44D 1A1MA 4X6DF 4ODWA 2DL2A 5TE4L 3BZDA 2P24A 3VWJC 2EXWD 4XNMA 2IADA 3QFDB 5GRZA 1IGJB 1BOYA 1RK0B 4NHUA 2AJXL 3DRTB 3GMNA 1ZEAH 4FQCL 5GSVB 3EHBC 3W5MA 1H5BA 5E8NA 2NX5E 2E9JA 5KOVC 4YUEH 5IWLA 4DN4L 4YDKL 2WP3O 5I1AB 1FFOB 4HUNB 5I71C 4OFYD 4R4ND 1U8IA 5E95B 3T09A 4GFTB 5IJVA 5IBLD 5EBLA 5C0CE 3RWIA 4HC1H 4U6YA 1L6ZA 1ZVSB 3O3EA 4P2QA 3QIUD 1CXLA 4KUCF 1HINH 3NCCB 3PWVB 5D7KE 4BA8A 3PWLB 3OPZL 1MRFH 5LVEA 4Y4FA 4NFDA 4XH2A 4QHMA 4LLWA 2H32B 2K3TA 1IAIM 1NC4A 1AKJD 3SKMB 1KB9J 4AH2A 4ZPVB 4Y2OA 1LK2B 1ES0A 2H32H 5EZLA 2EIZB 4FMFA 3GSXA 4A2MA 5BV7L 3BDYH 2W38A 2ARWA 4P2CG 1ZLUH 5ID1A 4GKOA 4HGMA 2ZCKL 4HPOL 4HMCA 4JFOB 1DQLH 1YA5A 2NTFB 4KRMB 1MREH 5F1KC 3JWNC 3PDGA 4MVBC 4MCZB 3RBSA 5GS1B 4AIZA 4PJXE 1K5NA 5HI5C 3FZUD 4PJDA 1B0GB 1GZPB 5IW6A 2AQ1A 1U8JB 3JV4B 4LLVA 3EO9L 4Z77B 4PJDE 4PJHB 3CXDL 4QT5B 2CK0H 1MVUB 4ELMF 1T0NA 1MHHB 2Q8AL 5EC1B 5FO9B 4JM2F 3OKNA 5CBEB 3F12A 4JRXD 2JCCE 2AK4B 1BJMA 1DBMH 4HBCH 5HHPA 5L9DL 1S3KL 1CDIA 1MJUL 5ESAB 2WUCL 3V4VL 5HHNA 1XF3A 2I24N 3QI9A 5DMKB 5EU7E 3BDBA 1A7PH 2VOTA 4WO4C 4YC2C 4L8SA 1W0YT 4A6YH 1N5AA 5E08L 2HMID 3SDXE 3NMEA 4XXDA 1U36A 3V5HA 2ZUVA 2V5TA 4NIKB 5C0BD 1KPRA 1MJ7H 5F9OH 4WUKL 5J89A 1P7QB 1RJLB 4OFPA 1T04A 2EYSA 4G3YH 1S8DB 3MRFA 1ZGLM 4KRPC 3H9SD 1NMCB 2H9GA 5IB2A 4MNGA 1IEBA 4J4PA 3VXNA 1NGQH 2W0LA 4TOYH 4ACPA 5DJDA 2OTWA 5ADOH 3Q6FB 4C83B 5C8JB 5E8EB 3MNVB 1TTGA 5HI3D 3ARVA 5KS9F 2B1HH 2JJSA 1S7RA 2JKXA 4L5FH 1NCUA 4XBGB 1JF5A 1EV2E 1FFPA 4JRYA 2F8VA 5HDBE 3KNBB 4Y1AA 1MAJA 1CXKA 3VFUA 3VD3A 1Q0YL 2AKRA 2O5YL 2Y07H 4X0KB 4P5MB 5F1OB 4DQOL 1QFHA 5L8LB 4OF8A 1F00I 1BM3L 3OF6A 3V9FA 3F7QA 3ZTJH 4XMPH 1KJ3H 3QUZB 4LSSH 4LVHC 2GITA 5TDOB 3TBVA 1XIWC 2XZAH 3UPRA 4Z78A 5EU7C 2ZG1A 3L3KB 4QO1A 1NCBH 1CGUA 1GZQA 3WNKA 2XYCA 3DPBA 4UV7H 4LKXA 3IJSA 3DV4B 1U3HA 1OM3L 4LASL 4M7JL 3NH7H 4X4MA 5EO0A 4MXWH 2BCKA 4ZS7H 4OQ1A 5F9DC 2EYTB 1LEIA 4TSBL 4O51A 5CD5C 2VLLA 3K81A 4ZUUA 1FL6A 4LVNB 1Q94A 5GPRA 1YC8A 1OAUH 1MHEA 3CH8A 3M1BB 1XGPA 3DX6B 4JVPA 5H2BA 2WLZA 4JJ5B 5KVFH 1R5IB 1YDPB 4YK4B 1GGYA 4EN3C 3MRDA 1Z9SA 1EX0A 2MPAH 4O2EB 4C58B 2DWDA 1RPQA 3BGFB 1GSMA 1QO3A 3LN4A 5FAAA 3S4SB 2H2PC 2R69L 4G8EA 2DMBA 3ETBF 3PXJA 4CMMB 2QEJA 3MRRB 1BJ1H 3GMOB 3MFFA 2W92A 5DO2C 4F7PB 2AJUL 3RP1A 3HZVA 1T1YA 2YK1L 1WCQA 2ZWLT 1G7HA 5TE6H 2VDLL 1LEKA 2ICWA 3G08A 5HY9B 4P3DA 2G75B 3BPNB 1MCPH 3UTTB 4F15B 1SJVA 3EJZD 1HKFA 5EOQL 4YEEA 5AAWA 3LEXB 3X3GL 1E6JH 4AM0B 1A14L 1MHCB 5C2UB 2KBGA 3H3PH 1BD2E 1GYAA 2R0LL 1X7QA 3OXSB 1CR9H 1NC2B 1W0VA 3D6GA 3PHOB 1EAPA 4QHLA 3UEZA 3ULUF 4WHTB 5HJ3B 1QFUH 5C0CD 3DROA 2FATH 5C0JA 3U82B 3IFOA 1JNLH 2E9WA 5T33H 1P2CA 2XTJC 3FQRA 4O4YL 4HK3N 4P3WA 2A6KB 3HE7D 4QNPF 4X5LA 3CDGB 4LSQL 2DIAA 1YPZB 2YXMA 3DV6A 1VERA 5GSRA 1S5HB 5EULV 3RWCA 1LGVA 3WE6B 5IMKB 1XF4B 1N6VA 2BVYA 4PJGE 2DLIA 2ZZUT 1SY6H 4RMTA 4WHYH 4ODTL 2CDEB 3NIGE 4PRBB 1QRNA 4L3EB 1LO4H 4FFZL 4NT6A 5ACMA 3VGBA 2PKDA 2R0WH 2X4RB 3AC0A 4I0PC 5HHOD 3LKOB 3BH9B 4NNPL 4PRHB 4Y19B 3VJ6A 3ZE0F 1FNGA 4KROC 2F5BH 1SM3H 5M7QA 1AE6H 1CFTB 4KTEL 3B83A 5T3ZH 5CEZH 4I8DA 3GRWA 1WWAX 1F8TH 3MRNB 4Z5RA 5A43C 5E2WL 1CD8A 3PHQB 4GBXC 4Q0XL 3AB0B 3VXOA 3JTTB 2APTA 1U8PB 5C08D 3RKDC 2AJYL 5JIKA 2YBRA 4NO3A 3TO4B 3K46A 1QR1B 2OSLB 3QUZC 5D2LB 5TE4H 2QQNL 4R3SA 2K7PA 1ZE3C 1UYWL 5DI8B 3RHWF 3RIFK 1AO7E 4PBXA 1E6OL 1EFXD 1IAIH 5DQJA 3U6RA 5EU6D 4UB0L 5GGVY 1HILA 1KFAH 4C55A 5D2LF 5FGRA 2VDKL 3ZDXE 3PGCA 4X7EC 4JZNA 1R3KB 3L1OH 4H88L 2GCYB 2IG2H 2MTPA 5D7LB 1JPFA 5SX5K 3MUJA 1IGIL 4XVJH 1X5ZA 4S0SD 1I3VA 3DXAB 5IP4A 4LHUG 1QACA 1UFUA 5ENWA 1I1AA 1H3XA 1NUNB 1CK0H 4FTVA 5JIHA 3V6FB 3CLEL 3T2PA 5LCVL 2G2RB 3BAEH 4OKVA 1C5CL 3CMGA 3HI6L 1HYRC 1MLBB 3OXRB 1SJXA 4HG4K 4OM1L 1T3FA 4BSWA 2P5EB 5I15L 1Y6NR 3TNNB 1CVRA 3HUJA 4RAVA 1KN4H 1HHGB 4PTUA 5CSZB 1JMZA 1AP2A 4NM4H 5C70A 2YD9A 3LHPL 4OSUH 5BXFA 3AVEA 3ARPA 2Z92A 1IE5A 4MA8L 4XPFH 4EDWH 3CSGA 1QLFA 1V7NL 2F74A 3BT2H 5DQ9B 5EZOL 1LE5B 2CKNA 3KHOA 4GAGH 2AJZA 1VGKA 4FTVD 3HI5H 4P4KA 3QXUA 1J5OL 3BEVB 1S7UA 2X4SA 1NBYA 5A40E 1MCPL 5E5MA 4QTIL 5JHLL 4WWKC 4H26A 4WY7L 2UVEA 5MERA 5ELIA 3O45A 3PJSA 5T3XH 3T3PF 5CP3H 5EC2A 4HW6A 5EOTB 1A6UL 4HKJB 2F53E 4RGNB 1H3PL 4Z18A 1I1AD 4HS8H 3QQ3B 4CW1A 1Q9LB 2XZQH 5DJ0B 4U7SA 1TJIH 5BQ7A 5I75B 4E5XB 5J9PB 3ARFC 1MCOL 4I2XB 1S7VB 5DUBB 1EGJH 2NW2A 4L9LA 1IL1B 5EIVA 3NFSL 3MA7B 3F8UB 3ZYJA 2UYLB 1BD2A 3ARTA 3MLSL 4OCWH 5IVXA 3T4YA 1NCCL 2ADFL 1G7MB 1HZHH 4RGOH 1F97A 2VH5L 3BQUA 4IMKC 1CFSA 3WKMH 2R1WB 4K7PH 4I0PB 1U42A 3ET9F 3RX5A 4J3WA 3SE8L 1LP9A 4J1UB 2PO6B 1XH3B 2BVTA 3JWDL 4XCYA 5DJYA 3GSNH 3V2AR 5HHOA 2VUYA 5J1AA 5KN5A 2CLZB 4KH2A 4ZD3H 3HZYB 4E0RB 9CGTA 4JFDD 3QRFM 3ZHKA 1DBJL 3LEVL 4R2GB 1K2DA 3UDWA 5FECA 1CT8A 1GGBH 1INEH 3EZ8A 5CUSL 2HA1A 4Y4KD 2DMKA 1ACYH 3BGMB 4LPTA 4H88H 1SY6L 4HHAB 4OFDA 3BRFA 1EFQA 3FQXA 3PWNA 4DVBA 2EDRA 1MRCL 5AUMB 5KVFL 1A7BA 3FO1B 4L8SC 3TO4D 5B8CB 3MXWL 1K8IB 3I75B 1MFEL 4IOIA 2DI8A 4RMVA 5T1DL 2ED7A 4RFNB 1RURH 4E41B 4M03A 1FRGH 2OM5A 1EFXB 4G5ZH 1N8ZB 4Q9RL 1U91B 4HAFA 1Z5LA 1LNUB 3NACH 2R23A 4L8CB 5ALCL 3TWCH 3D3VA 1NDMB 2M26A 2DBLH 1QSEA 1UWEH 3HS0A 4NPYB 4KDWA 2HWZH 3O6LH 4YHOH 4UQ3A 3U4BH 5HYSB 1CE6A 3VI4F 3L7EA 4QY8A 3QEHB 4IIQC 4YXKH 4JFPB 2HTLD 3P77A 5IK3B 1CLZH 1LK3H 2E7LA 3GSVB 3MODH 1I8IA 2UWEB 5GGRY 1I8MA 2VISA 5DC9B 1DVFD 2NYYC 3BMWA 2IH3A 3PWPA 4WHCA 5DJ8A 1UXWB 1JTOA 4OGZA 1GXEA 3FB5A 3Q5OA 4I9WD 1IM3A 3T0BA 3OV6A 2PYFB 1BZ7A 5D71H 1FVDA 4QRPB 1XEDA 5IKCA 3VWKA 1JPTH 4U6XB 2HFEA 1WIPA 1YEGH 1ZA6A 3WHXB 1KT2A 4Y4HD 3V6BR 4BFGA 4HF5H 4YH6A 5A1AA 3QEUA 3CXDH 4ENED 3UBXB 4DCQB 3D39A 3EOTL 5AG9A 3RGVD 1P9MA 4CU7A 5DFTA 4EVNB 3VXTA 4KK6D 1RUML 1BQLH 1EEYA 2AQ2A 5EOCL 3Q6GL 1MQKL 3MJ9A 1KLUA 3HAEH 4EUPH 1HSBA 4J8RA 4EBQH 2JB6A 5DK0A 4NQCB 1PG7L 3QNXA 2QV2A 2A74A 2YA0A 1WZKA 5ITFA 2H3NB 4YHIA 1EBAA 2MMXA 3RTQA 4O00A 4X8JB 3UTQA 4NCC1 4I3SH 4BKLB 5JQ6H 1X5LA 3DVGB 4OJFL 3LKPA 4ZQKB 1U58A 3NFPB 4WUUE 5C2BL 5T3ZE 3CD4A 1X5KA 4OD2B 3I6LE 4LSVH 4RMRA 5MEND 3U0TA 3U9PH 2N56A 3EOBB 1CDHA 3MRCB 4HUWB 1WZ1H 3R06A 1A21A 1QD0A 3KVQA 4MB4A 3DGGB 3G04A 2HJFA 3MLZL 3WFBL 3RNQA 4PYGA 5DXWA 2YPKA 1DUZB 3EFDL 1WEJL 3T4AA 4MNQE 1NGXB 4FRWA 4LHQB 1AI1L 3JV6B 3SDAC 3T8XB 1G7PA 1XR8A 2E7MA 2HRPH 2R2EB 4TQEH 1KPVA 1V3KA 1BAFH 4HV8A 2FO4B 4FFWD 2R4SL 3C09B 3MREA 4JAMB 3CMOL 4QF1A 4LGRB 5DRNB 2OYPA 1RIHL 4K3DL 4IMLB 5TDPB 5BOPA 1YECH 4GW1A 4AEEA 1SYSA 5DJZA 5IB5B 2A1WH 2QSCH 1Q9WB 4HX1B 3RTQC 1WAAE 1TJHL 3ARGB 5GS2H 3O4LD 1DQJB 3TP4A 3IFPA 1R6VA 1M4KA 1JI2A 4Y4FC 2EC9U 2KKQA 1YEFH 3GSWB 3O3DA 1RZJC 5FM5M 3QDHA 4CN4A 4NWUL 4U6TA 4LLUA 1CFNB 3HFML 4NNYA 2BK8A 4PJ7E 3BZEB 4JG1L 1S5IL 2ADGA 1P6AB 5KSAC 5HYQB 4A6YL 3SKNA 2VXSL 2X09A 1XIWA 4HSQA 1Q72H 3ARBB 3FQTB 3TV3L 5EOCJ 2X4PA 2YUVA 2PW2A 1BBJB 2R9HC 3V6ZB 4U3HA 4LAJH 3S37L 4HIJA 2IC2A 4N0CC 3OKKA 4P2OA 3ZTJG 4AK1A 4WWID 3T3MF 3WFCL 2EE3A 5F3BA 4PGDA 3FTGB 2CR3A 3DVFA 3UTPE 4AEFA 4HCRH 2CIKB 3OJVC 4OV6F 4P5TA 2C9AA 4IIQA 4Y2DC 3VMPA 4KWUA 3C08H 3QH3A 4UILL 4POUB 3OKDA 2EDKA 2KDGA 2Z8WC 4HDIA 5I1JL 1XCTB 3ZHLA 5BRZB 1UZ6E 4UBDC 3U36B 3RVUD 5C0DA 2HTLC 4GRLD 5FO8B 3O4LA 5J3HD 3MXWH 5FKPB 4M4RA 4M48L 4OAWB 1T1XB 1NLDL 3HZMB 5H35A 1FRGL 4PJ9B 5E9DB 4PB0H 4TUKH 5DD3H 5JDSA 3UYOD 3HB3D 3IKKA 3FHAA 2FEDD 1YNKH 1RK1A 5BO1H 1KXTB 1D5XA 1JWUB 4PJFA 4IS6A 4OZIF 3PL6D 4U1LA 5I74C 2WINA 1WUNT 5DEGB 1BECA 1KEGL 2FNBA 3SCMD 3CFKA 4XGZB 2OR7A 1G7LA 3TZVB 1ACZA 3P9LA 3WS3A 3LN5A 3QA3B 2VQ1A 3IXTB 5DUML 2GSGB 1QG3A 1C1EL 4MA8H 4XPFL 4EDWL 1YY8A 2DRUA 4TN9A 5C0FA 2ZKHL 4X5WB 3WL9B 1ZEAL 4ZO7A 4X6EB 4BH7A 2IPTH 3K1DA 3ULVC 2GJJA 5HGGS 4XPBL 4GKZA 2A6JA 1T03H 2ZUWA 2F8OA 1N64L 3NBNA 1GGIL 4EI6B 3RGVA 3HI6H 1NCCH 2P8LB 2QHRH 2ZCKH 1D5IL 4HPOH 3VFWB 1TZIB 4BH7B 1NLBH 1A6AB 3CK0H 3O6KL 3IYLW 5K9OB 1DFBH 5BMFL 4ORGB 3B5HA 1LWRA 4KPHH 2IAND 5JPNA 4NNXA 1ONQB 2XN9E 4DZ8A 5TF0A 4R90L 3Q3GB 1HE7A 1AY1H 4JDZA 1KGCE 3G6JA 4OZGA 2HJLB 5BJTB 3EAKA 4GG6A 4WHDA 2BVOA 1V05A 4KK9C 3GMPB 1WAAF 1CGXA 2EDTA 4KGLA 1AKJB 5FUZH 5HDLA 3CX5J 1HIML 2X4UB 4Q2ZA 1TIUA 4FQXD 3PWUB 3LKNB 2DIBA 1P4BH 1P9MC 5D5MA 2VRAA 3OAZH 1I3RB 3F7VB 4NZUL 1FE8L 1DLHA 3MGOB 3F6IA 1CDGA 1TPXC 1Q9OB 1V3MA 3O4LB 1J7VR 1C5DA 1WT5A 3UPAA 3OR6B 3TC9A 4UAOC 1B0RB 1BZ9A 2CIIA 1IFHH 4MJ4A 2FB4L 5EZJA 3WFEL 4PRPE 4HCRA 1BVLB 3N1FC 4HK0B 2RBLA 3SKUD 4BFIA 4IRSD 1T80A 1P7QD 3TVMB 2QQLL 2ZUQC 3W9EA 3RL1B 4PRDA 4TUOA 4MDIA 4PJHE 2WWKO 4L8BA 3WO4C 1BQHG 4GMTH 3HR6A 5ANME 4AT6A 3D85D 5LWYH 4Y8DC 4P2OB 5ALCH 5I1LB 5DLMH 5SWQA 3IDJB 2IPKB 2FEEL 3E0GA 2JB5L 1WFTA 4HXAL 5DURB 4EUPA 3MRQA 2WBJA 1MCSA 3S37X 4H25B 4MJ5B 1HWHB 4IRZL 2IANA 1YQVL 1P84J 1I4FB 1MFEH 1Z0NA 3DARA 4JCLA 3CFJB 3L1OL 3QHZH 4ZFOL 3BI9X 2NY3B 3KJ4B 1NCDL 1LE9B 2E6QA 1CFNA 2HYMA 4F7EB 5T5FH 3QWQB 3O4OC 1UQSA 3BN9D 2F19L 4MAYC 2IEPA 2B4CH 2GW5A 4KHTH 3OKOA 5CWSB 4F7CA 4YDIL 4D9LH 5DMIL 1ADQA 2VQUA 1EEZA 4WV1B 5KSBA 2F54E 3UROR 3VD9A 2FIRT 5D5MF 4J3UA 1LVEA 1T21A 3MV01 3HPJA 3OBAA 4YJZL 1OAQH 3B9KB 4IMLA 4NO5B 1OCWL 2BNQA 4OCMC 3MRPA 2WUBL 3FONA 4PJDF 1PSKL 3SKJL 2BSRA 1UADC 1KC5L 3QJHB 2FO4A 1KENL 4PY7B 4ELME 5I30L 1KB5A 4X6DB 5JLZB 1KJ2B 4LKCB 2M1KA 2N1KA 4OZIE 3KPRB 4NQTA 2DLEA 4LOUD 3Q0HA 4N8CL 4N0UB 5JZ7C 1CLYH 5F7FA 1MUJA 3UJJH 1OGAA 5JW3H 3DNKA 2FX8L 4V1DB 3FFDA 4Z7VB 2JJWA 4NDMB 3C6LD 1HYSC 1S9XB 1UCBH 3VFSB 2Y72A 5HPMB 3MGTB 3B2VH 2DQFB 3K2UH 4M8QA 4PGZA 3FKUS 1PY4A 1INDH 2ARJA 3U48A 4DTGH 4JLRB 5DVLA 3U0TB 2D7TH 3WYRA 2B0SH 1EPFA 2VE6B 1UENA 4G7VL 5IQ7H 2I07A 2IANE 3UJTL 1TCRA 1OAXL 1CN4A 4HIXH 4K9EL 1LEGB 1NL0H 2ESVD 3TF7C 2P5WA 3D9AH 5HYIA 5HYSG 4YR6B 3C6SB 1O5DT 4PJAA 4PJ8B 3MYZA 4GRMB 1OP3H 2VLRD 3SE3A 1WCBB 2YS4A 2HH0H 2Z4QB 1CLOH 4O58L 5D1XD 3PGFH 4M5YL 4NQCA 4W6XB 4PJCA 3BP7A 2F53A 5GGVH 4PB9H 5FDYA 4M6NH 5FGSA 5GJTH 1FAIH 5DD1H 4BSJA 2NXYD 3FB8B 5GGUA 4NQEE 3QCUL 4ZFZA 5IB1B 2Y36L 3MV9A 1DN0A 3ULUL 1HSAA 2IF7A 1VESA 3J8F7 2H1PL 3ZKMC 1ZA6B 2J4WL 3M8OL 4JZJC 3O8XD 3UTTD 2KPNA 1PG7X 5C9JA 3REWB 4P2OD 1JUFA 3B5TA 4LCWD 43CAA 3P4OB 4NC1C 4JVWA 5LGJA 2DD8H 2P47B 3BP6A 4X6DE 1UXWA 1J12A 3DMMB 4MQTB 4H20L 1CLCA 2V6HA 3WUWA 2DLGA 4S2SA 4U1NB 3CX2A 1N5YL 2PNDA 3S88H 3MV9B 3WJLC 3U7YH 4Y19D 5SWSD 3HS0B 5HHXL 4GXVH 1IC7L 3P30L 3CLFL 1NDMA 1X5FA 3LZFL 2XTJE 1TZGH 3L5WB 5FEBA 2VABA 3O9WC 1U91A 5JZ7D 1QLRB 2XN9A 4P3CH 1N8ZA 1N0XL 2ZPKL 4XCFL 4JM2D 3QRGH 2B20A 5ITBL 2FECL 5IJKA 4M5ZH 2HP4A 3K2MC 5INCA 4IOIB 3C08L 5B4MD 5DGRA 4G6FD 1A2YB 1WWBX 3KAAA 4FG6C 4RGND 4DVBB 1OTTC 1B0WA 3C2AH 1X6LA 5DJXB 2NY3D 1I8LA 1MJUH 1UJ3A 4MQ7B 2Q1EA 4N9OB 2KQMA 1FLRL 2NTSP 4HJ0D 2PXYD 2BNRA 3LQZA 4HKBA 3DX7A 4LSTL 5C6WH 1QOKA 3NZHH 4XVTH 1HNFA 5DC4B 2X1QA 3VFGH 5FV1L 4RQQB 4NKQB 4KZEL 1AE6L 3U46B 1YNTB 3DVIA 3RDTC 4IRJD 1HDMA 4PGBB 3RVWC 4N68A 5K9KA 3MCKA 3QJHA 4KMTH 2VXUH 4XCYB 1PQZA 2XOTA 2PO6A 3HUJE 4DN3L 2BSRB 3FQUB 4HWUA 2NY0B 4I0PA 3VXSB 3B9KA 2R1YB 1TZHB 4K7PY 5L8KB 3FN9A 5ILTL 4LDEB 1KG0B 4G42A 3LRSB 1OHQA 2B1HL 4LRIA 4MA7L 4PBWD 1U8HA 2VLRB 4OCSH 3GI9H 1PX4A 2YZ1A 4PLKC 5EO9A 1KIQA 4G8GE 3WLWC 3WNLA 4HIEA 3L3HA 2RJMA 3QDMB 3FRPA 1YJDL 5JR1H 4RCAA 3DXAD 1LE9A 4OGXH 4YHMH 5BQ7B 4I4WA 5DJ0A 1S7WA 3PV6B 4PS4L 3VXRA 3A67L 1CFVH 5DUPH 7FABL 4HKJA 1Y0LB 2BERA 2EZ0C 2JIXA 3CDCA 4ZAKA 2VZ3A 4ZOEA 2AJVH 2YKLH 1KNOB 2E7HA 3IVKB 3MACH 4OCYH 5F7MC 3S5LG 4Q74A 4MJ6B 5TJWK 1MHPL 1RFDH 4RMUA 4S0TD 5L88H 4XAWH 1UKQA 2IPKA 4K07A 5E2UL 1G84A 4KY1H 1XGQA 2NNAB 2GY7B 3VW3H 4L3CA 5CEXA 4PY8I 2WIMA 1AXSA 2EO1A 4KKCD 5IHZB 4XZUA 4EJ1C 3CFEA 2WBJC 2DQCH 4QXTA 3MLTA 3W0WE 2WUBH 1NGPL 4DAGH 3K4DA 4JZJB 1BVLA 5GGSB 4YAQA 4XRCA 1EDQA 4PRIA 2R69H 3G6AB 5CSZA 4NWUH 4F80A 1BZ9B 1ZANH 4AEIL 4DOHB 4FQJL 4EOWL 4PV8B 1JGDB 3RVXD 3BIKA 5GRUL 1DBAL 2FX8H 4FP8H 4LVOC 3VI3F 3BPLC 1MQKH 4ONHB 3TPKA 1I3RA 3B9KD 5D96C 1NCDH 1A0QH 2YEZB 5FO7B 4E42B 3ZZ1A 3ULUD 1KB9K 2R0ZL 4OT1L 1J10A 5KTEH 1MELA 1AD9A 5FUCC 3CCHB 4P59H 1DVFA 1U3HD 1Q1JH 1YPZF 1T66D 4LPXA 3UJIL 5C92A 2J6EL 4GG6B 2OJEB 3TJHC 2HJLA 1I7UA 3NCFB 1F6FB 2EDDA 4L29A 3NIGF 4U1MB 3MBXL 4DZ8B 1SMAA 2AW2A 4Y4KB 4MXQC 3CH1B 3LV3A 4ORGA 4YXKL 1NBVL 4Q6IC 3O2WL 3ARWA 3HG1A 5DEFB 1UZ6F 1RUAH 4YNYA 2YBRB 2N4IA 1UXSA 2E27H 1PEZA 2F54A 2HFFA 2A6JB 5I8EB 5EORL 4R97B 1A9BA 4DKEH 4F9LA 5GS3A 4Y16A 2PTVA 3VG0L 3WL9A 4FA8A 2W07A 3HC3L 1FNAA 2P42B 1VACA 3DBXA 4RA0C 2DQJH 4YWGH 4O2FB 3X11B 4BSVA 3EOYG 1UKTA 3IDUA 8FABB 4YGVB 3T3ME 3RDTB 5DHXB 3KPSE 3IAPA 4KK8D 1W8NA 1II4E 1R5WA 1NL0L 1R24A 3BP5A 3EDDA 5CJ8A 3GJFK 4WDIA 1FNGB 1NCTA 1JWMB 3MRMA 3LKOA 4WFHD 1JIBA 4OM0L 4AL8L 3OKEB 4LMQE 1QRNB 4L3EA 4PJIA 2CDEA 3FT4A 4PRBA 3C8HA 2IPUK 1TLKA 1T1ZB 3BW9A 1SYVB 3KYAA 3OGOE 3TA3D 5LGHL 5ICZB 4KDVA 3C6LA 1PYWA 1F6AA 4K3EL 3V8CA 4M6ML 4U1KA 1CFQA 1G9NL 1IEHA 1T1XA 2OTUA 1P1ZB 5IEKB 1JFQL 1AJ7L 1YPZA 2ICEA 1KLFA 2MQCA 3C5SB 2XWTB 5I8OL 1L7IH 1XCTA 4Y8AA 3INUH 4XXCC 1QTYT 3K1KC 2NXYB 4ETYA 1YMMA 4N0UE 4XPTH 5DD0L 5F8RC 1OTSD 3QH3B 4M7ZB 4XNZC 1WFNA 5IHLB 2FJFB 2NCMA 3QRGL 1A9EB 1OP9A 4OD3L 1PY9A 4JFEE 1K85A 2VXVL 5DMIH 4P99A 2H8PA 1ZLSH 1UH4A 3T1FB 3LEXA 1I1CA 3B6SB 1OARH 2HAZA 5GGTH 2NXZB 3V5KB 3DMMD 3VXPB 1EGJA 1KTDA 4U1HB 1A1OA 5K9JL 1UJTA 4H8WL 1KYOK 1NAMB 3WIHL 4K3JL 1VADA 2ITCA 2VDNL 4APQB 1CL7L 3N06B 1DBKL 2D7PA 4DW2L 3QCTL 2BHZA 4BM7A 3AU1A 1XCQA 1KPUB 2BXZA 3QUYA 1UWXH 3VXSE 2YOCA 4ENEC 5F88A 1L7TL 2IPTL 1ZLSL 1ZHBB 4O02L 1HHJB 2IGFH 3I50L 1OWWA 2J5LC 3GSWA 3O3DB 3LN4B 4L3EE 3PE9A 2EH8L 2EDEA 1RJZA 3DI3B 3SGDI 4YX2L 4WFGE 2R1XA 4P48A 5FDWA 1XGPB 2ED8A 4GAGL 1JGVH 1IGCH 3ULUH 2GT9B 4I9WE 4XPTL 4S1RH 1HHKB 2JTDA 4QRQA 3ROOA 1MCFA 4HKZA 4G6FB 4JFQB 1PZ5A 5I74B 4PYHA 5E6ID 4TSCH 4U0RB 4QRPE 1OAZH 1U3HB 2O5ZL 2VDLH 4X7TA 1CICB 5DK3A 2FX9L 2QSVA 2VDML 4U1JB 4YFLF 3BD3A 2MJWA 3L3KA 3VWJD 3ZE1F 1YY9D 5DFVD 3MV11 3QCTH 4ELMA 1G6RL 5GGRB 3GB7B 1K4CB 4AQ1B 3RNQB 4GUPB 1CXHA 5E94A 1R5VA 3MMEB 3G04B 1J0KA 5H8DA 6FABL 1FFQA 4YHKL 4P5MA 3O3UN 3PABA 1EO5A 4XTRC 3EOBA 2B0SL 5TF1H 1S5IH 2OTPA 3QDAA 4YBHA 2W60B 4B0MM 3ARBD 4OCNC 3NFPA 1QFWI 1FN4B 1EHLL 4WW2A 3GO1L 2HTKD 1QPXA 2XQYG 3X3FL 5C8JA 1JTPA 4JKKA 3VGFA 5E24E 3HC3H 2OTWB 3T04D 3WEXA 5E2UH 2RFXA 1NGWB 2E6PA 4KMLB 2DTMH 4J8RB 3BZ4B 4OGYH 2H9GB 2F58L 4WI4A 1S9WA 5CEZL 3JWDC 4OV5B 2NY6C 6CGTA 4WEMB 2EYSB 3HI5L 1QBLL 1CGTA 4HUXA 3MFGB 3K3QA 5F1NB 5FK9A 4Z0XA 3S6CA 3UBXA 4DCQA 3THMH 3NABL 4TSAH 1A3QA 3V5HB 5FGCE 3GMQB 2DF3A 4MVBD 3RA7L 1MI5E 2HFEB 5AEAA 4TVPE 3DYMA 1FNSL 5IKCB 1MH5B 4PG9B 4KTEH 3VI3E 2VDOL 5I0ZA 1IM3B 4TYUA 5T5FL 4HWBA 3I84A 3ZYOA 3FB5B 5CBAA 1VENA 3GJFB 5EBMA 1QR4A 1XF3B 3V95A 4C4KO 1RMFH 1NEUA 1QSVA 2V9QA 3HAEA 3PP3H 5BVJA 5C0NC 4M7ZC 4XNZB 1U6AH 4DKAA 2VISB 5FYJU 3T2NL 1RIVL 1QBMH 3VWKC 1YN6A 2XWBA 4UNVA 4JFPA 2AK4E 2YPLA 3GSRA 3FN0H 4H0GA 2EKSA 3QEHA 3MX0A 1B2WH 3SPVA 2DLTA 2Z93B 4FXKA 5CD3B 1RVFL 1J8KA 2DQEL 2W0PA 3MROA 4Z77A 1MPAH 1VFBA 2RGSA 5KANI 5I19H 4Q97A 5E9DE 5C0GB 3W9DB 1CGVA 1GOGA 1VFBB 2DICA 3N1PC 4ZOBA 2P4AB 4ZUSB 3RVUC 4QXGH 1IQDA 4E41A 5J3HC 3BKYL 3KLAA 5HVHB 4X5XA 3D18A 5B3JE 3RZWA 1K8IA 5I16B 1NAKH 5SX4H 5L7XH 3PF2A 5D93C 3KJ4C 5M95B 1T4KA 1ES0B 2WLYA 2RB8A 5I8OH 4AH2B 3ARXA 3FQXB 4R4FL 4LCYA 4JGUA 2VO5A 5CZVL 4Y1AD 4AIXA 2P8MA 3DSNA 4QHMB 3TV3H 4YDLC 4XH2B 3T65B 2EE6A 4O9HH 4XXCA 4WV1C 3LH2L 5F7EL 4HJJH 3TZVD 3PWVA 5ICYA 4MAYA 3K7UA 1ADQL 1VHPA 4PG9A 3T08A 3UYRL 3T0XA 3X14A 2PW1A 3RWIB 5EBLB 4FXGA 2OL3A 1K2DB 5I6XC 4MSWB 4OF3A 4WO4A 4HXBH 4OKDA 3CUPA 1I9JL 5IMMA 4LFHG 3K8LA 2MKWA 4Z0XB 1XH3A 4WUUB 3WS6C 3B2UD 5E8NB 1FAIL 1KJ2L 1CICC 2DJ4A 2EE2A 1SMOA 4F7TA 3SGKC 4JREC 2PUQT 5E6IB 5F6IC 4TULL 1YYLH 4XP4L 3P40A 2C3XA 1CFSB 5AD0A 2IQ9L 5IQ9A 2I9TA 2DKMA 3KPPA 2EDWA 2P24B 2VITA 5D72L 1G7MA 4NN5B 1C7SA 3D87B 5AZ2L 2EH7L 4ODWB 1CDBA 4LSDA 3MUHL 3RDTD 1A1MB 1WLHA 4PJEB 1BD2B 1G0DA 4NZTL 5EU4A 1IT9L 4GAYB 4L8DA 3V0VA 2F54D 4WW2B 3H0TA 4WW1B 4ZO8A 4W4OA 4I2XA 1YN7B 3KLDA 5F6HJ 4LSPH 3BQUC 2BSSA 1Q9LA 4JO1L 4MNGE 4P9HL 3SJVE 2W59A 1MFDH 2PYEB 5AZEL 4OUOA 4XVTL 4IOFD 4Q58C 3BDXA 1X5JA 2XXMB 3MBXH 1WWWX 4GUPA 1P53A 4BH8B 5GGRA 3BUYB 4M61B 1X4XA 4H26B 1RZ7H 4U1JA 1OPGH 4NBYB 1Q1JL 2F9BT 4LIQH 3MXVH 5DTFB 3ULVL 3QNZB 1WWCA 4U1GB 1AQDA 2AJZB 4TOYL 1MWAA 5T3XD 1DBBH 5I1IL 5JO5A 3QWOB 4JRXA 4M5ZL 1HHKA 4QRQB 4A2LA 3GI9L 4OLYH 4XNQB 4J6RL 5IVNA 3O3AB 5A16A 2A6IB 4G80A 1M05A 2CUHA 3RVTC 3C8DA 2EIBA 3B2VL 3LDBB 5SX5H 1IZKA 4YDJA 4UTAL 4BSWB 3WDIA 4X9HA 1NMBH 4GAJL 5F88B 1P4LA 4P9MH 4LCUB 1QHPA 3MOAH 4NQCE 3WBDA 4MXVE 5L2KE 2BVQA 4JFFA 2H2SC 1RIVH 3LD8C 3ARED 3UBXI 4EIZC 2G5RA 1I1AB 4QHKJ 4JKPH 5DD5L 1XMWA 3RBGA 4PJXF 1U8QA 1CICD 1OTUD 1ZS8A 3B6SA 3KYOA 4PGCA 4NGHL 2AABH 1FNFA 5CMAB 3QEQE 1MF2H 4PJXB 2XN9D 3ZE2F 5I19L 4MAYD 3RWFA 1T1WA 1N3NB 2A77H 5D2LA 4LDOB 4GRWE 1NDGB 3ELAT 4YDLB 5MP6L 1YMMB 5DYOB 2HG5B 4FMKA 2ESVB 4KXZI 4GQPH 4NM4L 1NEZG 2XWTA 1T5XA 3JTTA 3EJYD 4QGTA 3DLQR 2NX5A 5D1ZD 3UTSA 3PHQA 5I6XB 2R2BA 4W68A 5FA3B 1G6RB 5D1XB 4I18B 3VFPA 2XFXA 4JG0L 4MMXC 1S9KC 3T0ED 3C6LB 2ATPA 3EYFA 2VC2H 1EIBA 1AR1C 5IEHA 5DRZB 3AUVA 5FA4B 2A6DA 4RIRB 2WIIB 3GUTA 4IRJB 1CD9B 3OKEA 3GUTB 2A6DB 3AB0C 3FQNA 4RIRA 1U8OA 3QUXD 5IEHB 2DMCA 5DDHA 4LOUC 1R24B 1CWVA 1XF4A 2BVQB 3TFKC 3H6JA 2ATPB 4OGYL 2NZ9D 3OKYA 3V4PL 3RNKA 3VFPB 3FRUA 3WD5H 3FT3A 1BJ1J 1CLOL 4O58H 5BV7B 1WITA 4XT1C 1QNZL 1T89A 1J1XL 5LGKA 4Z7WA 1GPOL 1RU9L 2QHRL 1BD2D 3K8KA 5GJTL 3FFCB 3FZUC 3UZEA 2NY7L 2A6KA 2GTWA 1DLFL 2ESVA 2LU4A 1UXSB 2HFFB 4KI5E 4YNYB 4PUBL 5ICXB 4HUVA 3R8QA 3IFOB 2ZUXA 3FT2B 3IDGA 3DROB 5C0JB 4LCCA 4RA3A 2VXQH 2DI9A 1AQDB 3RFZC 2APBA 1ZSDA 1X7QB 5HGBB 1KJ2H 4ZTPL 4PJXA 3KS0J 5CMAA 3NTCH 4OBSA 4ZNEA 2B2XH 4U2ZA 2PR4L 1U8KB 5C6TH 1F45A 5F7NC 5AYUH 1X5HA 4JRXE 3RKDD 3GBMH 4GO6B 1ADQH 3UYRH 1S78C 2HMIC 4WENB 3R8BB 4XP9L 1E4XI 5D5ME 1KTLB 2OR9L 1NFIA 3QUZD 3NCMA 4LCUA 4CMMA 3BIAX 4WW1A 2IPUG 2QSTA 4K8RH 3BIBX 3BIKB 4KJWD 1EMTH 3SBWA 5I30H 5TGBB 1SBSL 2DWDB 3QXDB 1TETH 1CTNA 5F6HI 2ADIA 5JW4Q 4NC2B 5FM5O 4HPYL 3FQWB 1M05B 2B4CL 4S11A 3LD8B 1ZTXL 3BSZH 4YAQB 4D3CL 4JZJA 5DA4A 5E6IA 4IMKA 4ZDHA 1UWXK 2DQDL 3TBYA 3HUJF 3JVGA 1VPOH 1CG9A 1OAKH 1MWAB 2BCKB 4K71B 1AXSB 3ES6A 4OQTL 4JE4B 5CEXB 2Q7YB 3DV4A 2JJTA 1UM5L 3CUPB 1OSZA 4WO4B 1ROWA 2RCSL 5CJOH 4NKOB 4JO3H 4MDJA 2ERJB 3BKML 5FUOH 2OL3B 3FO2B 1IARB 3D0LA 4Q6IB 4MAYB 4OCRH 1BGXH 5AYUL 1E0OB 3MBED 3T65A 1RZKL 2YRPA 2G5BA 1AGDA 4LCYB 1D5BB 3KPSB 1J0IA 2OCFD 3STZA 3V6OE 1T4KB 2DL9A 2X5PA 2IAMC 2VLMD 4Y5VC 3CFBA 4K7FA 4Y5YB 5C0IB 2VDPH 5DA0B 3V0VB 4GAYA 1GGCL 4L8DB 3K4ZA 5I16A 3I6LD 4HIEB 5C7XL 3U4EB 4HLZG 2OP4L 2ADJB 3QHFH 3W5NA 1FORL 5E8DL 3Q6FA 4ZUSA 3CVHB 4JHBA 3LRSA 1XGUA 4G42B 4C4KT 2XKNB 1EERB 4HPYH 4ETQA 4UINH 1G7QB 2R1YA 5D1ZC 5DS8A 5KOMC 4RDQF 4PLOB 3CMOH 4QOKE 3U83A 3AXLB 1T04B 1FYTA 1PQZB 2W9DL 1A7RL 4WUUA 2YD8A 2E6JA 5CP3A 1RZ7L 2VSCA 2X2YA 3WKML 4V2CB 3U46A 3BESR 3T0AA 2ZJSH 4WHYG 4JQVC 3G5ZA 4MSWA 1EHLH 1R0AH 4JO2H 2D03H 3DX7B 2PW1B 1MCCA 4L8SB 4PS4H 5HI4C 1MY7A 5D7SL 5CILH 1JZ2A 5BVPL 2DYPB 2IMNA 3QI9B 5BMFH 4OB5H 4PD4J 4J2XA 4FFZH 1A2YA 5C2BH 1G6RH 3GMQA 1YQVH 2AK4A 2YPLE 2FLRT 1JNHB 2C4FU 2J12B 4LVNC 1MHHA 5FO9A 5CEZE 5CGMA 1MVUA 4HUXB 1Z9MA 2DQJL 1NAML 1NLDH 1L0XA 4ALAL 5F96H 4OV5A 3MV8A 3UDWC 2XZCL 2V7HB 1CZ8H 4OFKA 2X9WA 1L9NA 2XN9B 5IW6B 1XGYL 2MNUA 5EUOE 1FQ9C 3HCVA 1A1NA 3WEXB 3GNML 1Z9OA 3MZGB 4YE4H 1ERNA 1QQDB 2LQRA 2CDFB 1W72A 4FQHB 3VH8B 1RZJL 1INQA 3C9NA 4JO4L 1E28B 3SPVB 5JUEL 5C0IA 1JF1B 3NA9H 5F7YC 3GSXB 4WI7A 4K23H 4LSVL 4FABL 1C1EH 3STZB 3WUWB 1NBQA 2HKHL 3OB8A 2YHGA 3ORJA 4KUCD 5MENA 1B4JL 2VERN 2D31A 4UV4L 3GJFA 5EBMB 5CBAB 4BUHA 1DZBA 3BP6B 5JMRA 3MMEA 2R8SL 4ZUTB 3BWAB 2Z31C 5EOQH 3GB7A 5C9JB 2IAMA 1EJ6A 1PVHA 2VKWA 1RZKC 5DEZA 2DWEB 5DHVH 1F58L 4NP4L 2IFFL 4W4NA 1I9IH 4X7TB 3O9WB 3QDME 3IDYB 3UTOA 1DN0B 4MXQD 5F1NA 4P57B 5IB1A 4Z7QF 3MC0A 1U3HC 5DVNA 1PGRB 4JN1H 1UB5A 4TTDC 1ZT4A 3FMGH 4LLMA 3GMNB 3TBYB 1AGCA 1LO0L 3BZ4A 2BZDA 5EN2A 5JXED 2HT2D 1I9EA 2RFXB 3HC0B 1A3LH 2A77L 3FQWA 2ESVE 3DYPA 2RHEA 1NGPH 4XPAL 2N7BA 4YR6A 2C3GA 1MCKA 4Z7WE 3FFCD 3ZL4L 4HFWB 1HHJA 4B5EA 1ZHBA 1SEQH 1F2QA 4CRPA 4UIKL 3G6DL 3MV7B 2X4NB 3GZKA 2W60A 2VXSH 1X5GA 3AU1B 2YUXA 5D6DA 4JLRA 2HKHH 3QUXB 1U93A 3VXRD 3GMMA 1X5AA 2XTLA 4M8QB 1NCAL 4UDUB 1J0YA 1XGRA 3C5ZB 3EDJA 1S9XA 3V4UH 5J57B 2H1PH 1K4CA 3G9VA 3F5WA 1FPTH 2VQTA 1RHHA 2NY0C 1LO3H 2ZCLL 4HWEH 3NCEB 2H8PB 1CICA 2NY6B 1C12B 4DQOH 5J11B 1YEHL 1JPGA 5MEQB 3AS1A 3GKWL 2QQKH 3ARGC 3HNSL 12E8H 3JWDH 4PB9L 1KCRL 1C08A 4K94C 3A6BL 3GIZL 3ARRA 4M7LL 4LCCB 1JRHL 4HWNA 5ICXA 3SDXF 3QDGD 3HPJB 4ZSOB 2EKJA 2GTWB 5LQBH 3FFCA 2ADFH 5FDWB 5KSBB 4POZD 4UT6L 3P9MA 3J7HA 3V8OA 1RJZB 2ICEB 5MP6H 2E8ZA 4P46A 1RUAL 3OKOB 5CWSA 5DVKA 5CKAA 2UZIL 2APFA 4ZUVB 2XPGA 4F7EA 3QI9D 3WN5C 2MWCA 3QUYB 1KPUA 3QEQA 4MX7A 1R3JA 1AI1H 3P2TA 2C4XA 2R2HB 1BFOA 1ZHNB 1U8MB 4G6KH 3KG5A 1KJVB 5FYKE 4H25A 4IRJA 2WIIA 4EQ3A 5DRZA 3V5KA 4EUPB 1T2QL 2BC4A 2VLJD 3RTQD 5JHLH 1A7PL 2NY1D 5F70A 3RDTA 2HT2C 1G9NC 3SJVB 1JYNA 3OZ9H 4I18A 2EC8A 5FA3A 4JVUA 1VACB 1A9EA 3RUGE 1YEDB 4P2RE 4L8BB 2BY2A 4MDIB 1N59A 2FEDC 5ANMB 4PRDB 1OLLA 1T5XB 5K9QG 5C7XH 5D7IE 1HHIA 5I18L 2P5WD 2XA3A 5I8EA 2CK0L 5SWSA 4XVUC 1EO8L 1CE1H 5DYOA 4BZ2H 1UJ3C 2BOBB 3RU8H 3RVVD 1NCNA 3WKNA 5B4MC 5HHOE 2W0KA 1JZ4A 1F4AA 1S7SB 3F62A 2P46B 1D9KA 2D0GA 1H0DA 5IEKA 1BQLL 3TH2T 5IW1A 2VAAB 3IETB 5E4IA 3RWFB 3DWTA 1OAUL 1MREL 5SV3A 1CFQB 3F7VA 5C09E 2LABA 2ICCA 3UJTH 4X9FA 1SYVA 2UY6A 4LQFL 3VI4E 3BW9B 1T1ZA 1ZS8B 1NANI 1JK8A 5FHBL 3ZE0E 5EBGA 3P0YL 4Y4KC 1DVFB 3V5DA 3EZJB 3HI1B 4U3CA 4JFHE 3TBTB 4ORZC 3C8KA 5DJCB 5AG8A 5F44A 5BJTA 4HIIB 4UOJA 5L2JA 2J4WH 1LMKA 5FO7A 1RUQL 4ONHA 4LEOA 1VFMA 1NCWL 4D3CH 2VDOH 3BKYH 2CLVA 5JPNB 1JGDA 3TNMB 4RAHA 4YDJB 4E9LA 2FH6A 1K6QH 3TT3L 1OGTB 3QQ9C 5C9KA 5IHUH 1UACL 4JY5H 2JE8A 5T1DH 3WFEH 3G6AA 1F3JB 3KLSA 3RGVB 1EMTL 5EPMB 2F54B 3QUXC 5A16B 3S3JA 1U2CA 3HG1B 3GK8H 1HKLH 1W72H 5F7DB 1JRHH 3NPSC 3AS3A 3QJFB 4NZUH 5JO5B 4EZMA 3EJJX 5SWZE 2IWGA 1AGFB 1AHWC 3CH1A 1IKFL 4XC3L 5C07E 3QNZA 1IGIH 5I66A 1YY8B 3NCYS 4OTXL 1UCBL 1OP5H 2HLAA 4U1MA 1L6XA 2HRLA 2BHUA 1XGQB 5JIIA 3WJJC 2VQ1B 3O6ML 4C56A 1EGJL 2JJUA 4EDXB 1P6FA 1BMGA 4JRWA 4DVRH 1HH6A 5D8JH 1ACYL 1KNOA 4O5LL 4YHZH 2BMKA 3IVKA 1RK1B 2JIXB 3SOBH 3SDCA 3EO0A 4B41A 3BHBA 5K59E 4L4VB 3VRJA 1FLTX 1ZV5A 2BSSB 3OJMB 4HLZH 5KSUB 3QZWB 4JGJA 5E2VH 3TCLA 2YEZA 3STLA 5H35B 2ZUTA 5L0QC 1NGYA 2L4OA 2IALB 5CIPH 1YEEL 3MJ9H 4ESKA 4FTVE 4LRNL 2VLJB 2C1OB 1CF8L 2R8SH 4EN3D 1KIQB 2YSSB 3P0VL 5GRXG 5C0DB 1N7ML 2QLVB 2YD1A 4F2MB 3B9DA 4RFEA 3CX5K 2FSEB 3IDMB 1X5XA 5TQ2L 3S5LA 1U8LA 5T1KD 3Q1SL 4IIQB 4XBEH 1BVZA 3MLTB 5HYEA 3FQUA 1I1FB 1I8KB 3MNWA 2CIKA 2DQTH 4KKLD 3RUGB 5IHZA 4QHKI 4L3CB 5F3BB 1YNTA 4APQC 4MQSB 1HXMB 1KIRB 3IKCB 1D5ZB 2NY2C 3NZ8B 1DBKH 4C56D 1H3PH 1SBSH 4MJ6A 3O4OB 1P4BL 3X14B 2BNRB 2PW2B 5ICYB 2NYYD 4ZAKB 1BQSA 5JQHC 3BH8B 4QOKA 5AYQA 2LTQB 5GQBA 1Q9KB 4XP1L 1H15A 2VN4A 4WU5A 3SDCD 4XNYH 4I4WB 5HYJB 1WQVT 1ODAA 4L1DA 3ECBB 2OR8A 1CE1L 4BZ2L 1MOEA 5E7FA 1M7XA 3L3HB 3QDMA 4X5XB 3H2WA 4UQ2A 2AI0H 4TSAL 4NYLA 5DMGD 3VA6A 3IU4L 2VLRA 3BISA 4PJGA 3T2OA 4M4PA 3LKRA 5DD0H 1A14H 2DQTL 1V7NH 1SYSB 4J3SA 4HS3B 4OM1H 4GW1B 1GHFL 4X9GA 3L5WA 3MROB 4ODHH 4BK4A 1IEAA 5DZLA 2CJUL 3WDJA 4KK8C 3B9EA 4QWWC 2NY4D 2PCPA 4JY4B 1HDMB 2A0LD 1XR8B 3BD5A 3T8XA 3ZKSD 5EH1A 4MQXC 1NGXA 5BVJB 1JJUA 3DMMA 5HBBA 4GSDL 3LQZB 4HKBB 2F5BL 1URLA 2OP4H 3QHFL 1HIMH 3VFTB 3NFNA 3P4OA 4OI7A 1CS6A 3REWA 1MH5A 4HUWA 5IB4A 4LFHD 5DJXA 1E4XH 2AEIT 1F11B 3C09C 1B6DA 4PRHD 4ZQKA 1DQML 3QIUC 4L4VD 5FIEA 5T3XL 5FK9B 3HE6C 2QR0B 1JF6A 4RWYH 4BKLA 2X41A 3QDGB 3UTQB 4KZDH 3KPOA 4ELKA 5A2JH 3LMJH 4HMEA 1S9WB 3RTQB 4K3DH 3K8MA 2H3NA 3W11C 2QQNH 4HT1H 4XMKH 4YK4C 12E8L 1QLRA 4PJCB 4OIBA 1S9VB 4MS8D 3RPIA 4J3XA 1AXIB 3EUUA 4GRMA 4KAQL 4ELKB 5IROC 3OG4B 1QKZL 5KZCD 5C0AE 5E99H 1LEGA 4YFLI 3Q1SH 1YNKL 3TIDB 4S2SB 2X4OB 4U1NA 4D0BB 1KCUH 4L4VE 1DUYB 1DSFH 1JL8A 1V7ML 3SQOL 3EYQD 1KT2B 1TJGH 5EU6B 3VWKB 3BPNC 4Z8FH 5IB4B 3PABB 3TN0A 1T6VN 2VLKA 3PQYE 1FVDB 3QG6B 1R5VB 2PYFA 4OZHE 3VFSA 3VFTA 5HPMA 1KLGA 5KSAD 3PL6C 4EXKA 4YQXL 4GG6F 3EYSL 5DJ8B 3SCMC 1BLNB 3LQMA 1KIPA 1T5WA 5CINH 4XB8A 2VYRE 3DI2B 5D72H 3WN5A 4X4ZA 1HSAB 4JY4A 4UZGA 5T1KA 3GM0A 1CE6B 3QPXH 2VR9A 4ZFZB 1J88A 3ULUE 3WLBB 5FM8A 3T77A 3FMGL 1IEAB 4JFQA 1RY7B 4KU1A 4QWWD 4U4BA 1GAFL 4ONFL 4EKXA 2WM0A 3L3OB 5D93B 3OL2A 1L4IA 2R23B 2VKXA 2A0LC 3WIHA 4L8CA 5DC0A 1A7OH 3BP7B 3TO2B 4HS3A 3T0EE 5B39B 1T21B 4LSRL 4EUPG 1WCBA 1EEZB 4WV1A 4NC1E 4PJAB 2Q3ZA 3M07A 3WFDL 4PJ7F 2EDJA 3I75A 5B8CA 3ECBA 1F90H 1ZGLB 3MBEB 5T3XE 2DD8L 5HYJA 2BOCB 5TPWH 1H15B 4WU5B 4YBQD 1M71A 4HHAA 1T7ZA 4APQA 2DIJA 5IVZB 1VADB 4MJ5A 4NZRL 1FH5L 4LRIC 1A1OB 3VXPA 2LU7A 2VSDA 2GK0A 3NVQA 2BP3A 5D6DC 3NZ8A 1OGAB 2B2XL 1MUJB 3T1FA 5JXAH 4M1CC 1KIRA 3IKCA 4LPVA 4HGKC 4JDTL 3KPRA 1GAFH 5KN5B 5HI3C 1IVLA 4LKCA 5DJ6B 5HHOB 3HE7A 5CJ5A 7FABH 1I1FA 4PP2B 2DQEH 3H8NA 5KVEL 1AQKL 3BFOA 3W9EB 4HS6B 3MRPB 4Z95L 3S5LB 4JJHA 4ONOA 1KJMA 4OUUB 5D70L 3IXAA 2YR3A 5I1IH 5EZJB 3DHMA 3BQUB 2AXFB 3ULVD 3MLVL 4HZAA 4RFEB 1OVZA 3VH8G 3V0WH 5CP7B 4JY5L 1DEEB 1C5DB 3ULVH 2CO7B 1T03L 2QJDA 5CHNB 1MIMH 3WXWL 3MGOA 3QUML 2ZCLH 4L9LB 4U1KB 5DRWA 2DYPD 2IALA 1F6AB 4XB7A 5I71B 1JNLL 1Y6KR 1YEIL 1RUPL 4NZRH 1F42A 3NZHL 2R4RL 4L4VA 4LEXL 4XNUL 2H41A 3FT4B 2JJTC 3MLRL 1JNJA 1KEML 5AZEH 5GZND 4U1GC 1TVHA 2WK2A 1AKJA 4FNLL 5CD5D 3O45B 3PJSB 1VCAA 2WBJB 5KAQG 1JWMA 3WHE1 5MEPA 5JPMB 4WDIB 4D2NA 3BYTA 4R4FH 3BP5B 1JGLH 3IDJA 1HH9A 4JQXC 3U9PL 1MCIA 3U7WL 4YGVA 4XMKL 3NIDE 3OX8A 4JPKH 1UKSA 4W6YB 5EU6E 1GOHA 2VL5B 1NANH 4AT6B 3X11A 1O7VA 4BSVB 3DBXB 4PJHF 3WDHA 1AGFA 1OAQL 2R56H 3RL1A 4WFEE 2E5EA 2LFGA 3HPLB 1YYLL 2CGRL 4AQOA 5D96B 3PWJB 2Z92B 1LO5A 3B3IB 4JM2A 1F3JA 1IC7H 2J3SA 4GAJH 2GKIA 3CFDA 4RAVB 1A7OL 4GMSL 3ARDD 3B8SA 1BGXL 3RIAK 3OXRA 4NM8H 2Z0BA 4O2CA 2GSGA 1NFDE 3QA3A 3WO3B 3P9LB 5D5MB 3WS3B 3WSQL 1BHGA 3LKNA 3RX8A 1Y18A 2AK4D 1FLRH 3PWPD 3NOIA 4KY1L 4FTVB 4Q2ZB 3TBTA 2K7QA 4IS6B 1T83C 2DBJA 4KK6C 1D5XB 1JWUA 3S36X 4JPKL 5DD5H 3RY5A 3M8OH 1J8HE 3WIIL 3QO1B 1BREA 4JDZB 4CJ1A 2IAMD 5B38G 1N6QH 5J1SC 1B4JH 4R97C 4M1GH 2VAAA 3IETA 3RVXC 1H0DB 1D9KB 3MBEC 1A6AA 4CADB 5E56A 4LMQI 4WEBL 5KS9B 1EH9A 4PRIB 5D1XC 2VNCA 4EI6A 1FZJB 5D6CA 1QKZH 2BOBA 4XRCB 1FIGH 3QYCA 5GGSA 2HH0L 3BPCA 3RWGA 5F9WB 2DQGL 4WCYL 3BYYA 3CNKA 1RURL 4P5TB 3CFEB 5E1AA 2JLLA 4XAKD 4PFEA 1KCRH 1X4ZA 4Q9BA 4PGDB 1G0XA 3UC0L 3U1SL 3W82A 3LS5H 2XG5A 4HIJB 2AGJH 1HH9B 2DJSA 4TULH 4XP4H 3WNNA 2JF1A 4KGJA 3ZDYF 4Y19A 4U1LB 1MRFL 1TVHB 1TQCC 2X4PB 4PJFB 4XC1H 3BKJL 4XBEL 4LVHB 4PRHE 4ZPTA 1Y0LA 1DDHB 1JRHI 4ZUWB 1ZHNA 4R90H 4YZFE 3PV6A 4QRRE 3ME0A 4PG2A 4FQPA 4R2GD 3AMKA 3VRLF 3QEQB 3MLUH 1RZFH 2X05A 4PJ9A 5E9DA 4NNYB 3F6LA 1WZ1L 4JHAH 3C5JB 3DV6B 1DLFH 4OAWA 3SQBA 4RGMC 2XXCB 3ZL4H 5FKPA 5CGYC 2Q76B 2E7BA 5FO8A 5CP7A 3CIQA 3U36A 4X8XA 1RULH 4N8CH 3ARGA 2AXFA 3WFZA 4HDIB 1UH3A 3F58H 5ITBH 5DJZB 3IXAB 5C0AD 1KJMB 4LIQE 2N7AA 4OUUA 5TDPA 1A02N 3VXSA 3JWOL 4OLVL 1MCQA 3TM6A 5DRNA 4MA3B 4MA1B 4Z7OF 4NKIH 5GGSY 4JAMA 2X70B 7CGTA 3MLXL 1OCWH 3MCKB 4QHLB 2J1KA 3PHOA 4OLZH 5DJ6A 2IQAA 1KPVB 3PGDB 1C12A 3RWHB 1I9JH 1MCOH 1MHCA 5L6YL 4RQQA 2VDPL 5CEZD 4X6CE 3MUZ1 3F5WB 2EH8H 3V6ZA 1OTUC 2OK0L 1C5CH 4JG0H 1AXTL 2W9EH 3LS4L 2RCSH 4PB0L 1G7HB 4XP1H 3GMMB 3R06B 1MAMH 1T1YB 1UJ3B 1M71B 4MQ7A 3P9WB 1U2HA 1NC4D 4N90D 5T1LA 5HYQA 5CFHA 4OD2A 4MAUL 3VFRA 3GMOA 5IFHL 2IG2L 4OD1L 3MBEA 3JSSA 1U58B 1RZIA 4YFDB 4OB5L 4HFWA 5FYKD 5I1EL 1WZMA 4NN7B 2FWOA 1I8LC 1R5IA 1DQJA 2BDNH 4HX1A 2XTJB 5IB5A 1C5BH 1MHEB 3GNMH 4RDQG 2IBBA 4XCEA 2YN3A 4LLYA 1OD7A 3L3OA 1AGCB 4GS7C 3DX9A 1J87A 2GJ6E 1J0JA 1UB5B 3PGFL 4M5YH 3WCYA 2CRZA 5ISZE 1I3GL 4FQLL 3VXTB 5IWLC 4J12A 4HV8B 2P5WE 4LKXB 3RIFF 2R2EA 2XACC 1FJ1B 4HT1L 5AAMA 5T5NG 3JV6A 2VDNH 2HT4C 4LVEA 3UPRB 3TBVB 2EZ0D 3T2QA 4QRPA 1A0QL 2UV3A 5C6PB 1K3ZA 1BZ7B 3X3FH 5LGJB 4I0CC 2HJFB 3NTCL 3QG6A 4KJQC 2VLKB 3HFMH 2D31B 4NRYB 2XG4A 3GEWB 3NIFF 5I1KH 5EU6A 3VGHA 2BFVH 2Q3AA 2VXVH 1DQTA 4PRID 4YO0B 5IK3A 4EI5B 3LKPB 3CAFA 2D9QB 4KKCC 3P11H 2VWEC 4R7DB 4I5BA 5H94A 1E28A 3RAJL 6FABH 4LF3B 5JIPA 4FQHA 3L9RA 3E6FA 1ITBB 1QSEB 4RBPK 5KW9H 3ROLA 3RPIB 2FGZA 5E2WH 4FZEH 2GIYA 1G9MC 4B7LA 3BGAA 1LNUA 3JWOH 4X7SL 5IFAH 4JHAL 1X5IA 3TEUA 1HSBB 3VRIB 1F3DH 1EFXA 2V7HA 1RULL 3MV8B 5F7KC 4KK9D 3KPOB 5BS0E 3C6SA 5F7LB 1FGVL 1KULA 4XTRD 1P7QA 3QDGA 2P5WB 1QFWM 3QI9C 1BFTA 1PFCA 2I07B 3ARBC 2YD4A 4FN0A 4XXDB 1F11A 3E2HB 1JGVL 4JQVA 4CKVX 1F3DJ 1N26A 5TF1L 1TFHA 1EK3A 3U1SH 2DYPA 4OIAA 3MGTA 3QIWA 1E4KC 1CT8B 1WICA 3C60A 3FFDB 4PTTA 4Z7VA 3PL6A 1IZJA 2YA2A 1MFCH 4F58L 2J6EH 3G5ZB 1YMME 4N0UA 1I8IB 2AK1H 3TN0C 2B7DT 3ALPA 2VDMH 3HZYA 5CS7A 4Z9KB 3K80A 2W9EL 1DFBL 4P59L 5HYSA 4PY7A 2OI9B 5BS0A 4DKEL 2LAGB 1FYTB 2ORBL 3F7RA 4QT5A 1LP9B 1VPOL 3SEPA 3RWDA 4PJHA 3FONB 5DS8B 5IROA 1U8JA 3JV4A 2E7CA 4ZXBC 5C07D 2XKNA 4PJDB 4R8WH 2XRAL 1CL7I 4MD4B