4GAJH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 411-424)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
209
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDTSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 209
sequence length 217
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH02
4DW2H 4P5MA 4EI5B 3G6JE 2BNQA 4G8GB 2A0LD 2WBJB 1JGVL 1KENH 3SCMA 5GS0H 2D7MA 2YD4A 4XHQA 3T08A 4C56A 1JPGA 2QSCL 4HT1H 4RMWA 3QHZH 5GGUA 5C70A 3MLWL 2VLLA 3MMEA 5CZVL 1NDMB 1MHCA 1QPXA 2G9HB 5E8EB 3MRKB 1CD1B 3E6FB 5F6IB 5K9OB 4H26B 2NY3D 1I9JL 4LQFL 4N0YL 3VRIB 5J57B 2RAMA 1QTYT 4ONFL 4IOSD 1F3DH 1YMMB 4FFZL 1BOGB 2ARJB 4HWBA 1DVFA 3FL7A 5IFJB 5EU5B 1LDPL 4IRJC 4KQ4H 5B4MC 2ESVB 5EN2B 4NZRL 2B4CL 4H8WH 1CU4H 2BNRB 2NY2B 4O4YH 4GBXA 4J3SA 4K94H 1YEDA 1YEIL 1T20B 3T2OA 3BE1H 4KJWC 3I6LD 5E1AB 5EBMA 1YY9D 3ALXA 3EDEA 3LN4A 4HD9A 1F6LL 3UTTD 5A16B 5ISZB 3WLBA 5C08E 2ZOLB 4JPKH 3KAAA 1H15A 3QISA 4NHCH 5DZOA 3G04B 3X11A 1EMTH 5EUKB 3TVMA 5AYUH 2R1XA 5HGAB 2GITB 5EPMB 3BAEH 4LCWD 2NYYD 5F9JA 5E00A 1RZJC 1S78D 1GYAA 2XN9D 2Q76A 2Q8AL 1AO7E 2FJGB 4JAMB 1UXWB 1SMOA 1R6VA 4N8CL 4OM0H 2HVJB 4PRIB 4WI9A 4JKPL 4UOW0 1IE5A 3CH1A 4YWGL 4FG6D 4JFQA 3B2VH 4PG2C 4YHKH 2VZOA 3QG7H 4TUJA 1CG9B 1RJZA 3B2UD 3GKZA 3I2CL 3LMJH 5EOTB 1QACA 4MJ6B 4RAUB 3EYQC 3QXDB 5IVXF 2HT2D 5C0CA 5LGKA 4D0BA 1WIOA 4GJTB 1ZANH 4PJ5B 1BX2B 3TYFA 3HR6A 4L8DA 5HY9B 1LP9F 3ARWA 3IDUA 5I1IH 1TCRB 1FE8H 3MOAL 3MSPA 1OAUL 1K8DA 1RHFA 2NZIA 4G42A 5JPMA 3S88L 4XVSH 5CEZD 3QZWA 3VXSB 4YH6A 5JW4R 1ITBB 2ATPA 2D3VA 4M1DH 3S36L 1QRNB 1BQHG 3QWRA 5AWNL 4P2OB 4WV1B 5C0BB 1NANI 4KKBD 3L3IA 1YPZB 4KZDH 4EXPX 2VJXA 4KRPC 1A4JA 2VB5A 4N0CD 1AY1L 2V5SA 1BBJB 5CIPH 4ZFOL 2X4NB 3HAEG 5GGVH 2KZ1B 2ED7A 4Q9RL 1OCWL 3MLTA 4X4ME 4G6FB 5I8KH 1MIML 1I3GH 4LCUB 5KSUB 4CADB 3PIQB 4OCYL 3VFGL 5DHVB 2IALB 1NAMB 3HG1A 2B2XL 4YK4B 3UTQA 4DAGL 2NX5D 1ZT4B 1UZ6F 1RUML 3D0LB 4M1GL 4QF1B 4OZIA 2RCSH 4PP2B 1LO4H 2FGWL 1K3IA 1I1AB 4IOIB 5TDNB 4EI6B 4Z7WE 1Z2KA 2GEEA 4U6TA 4NQCE 2JCCA 3SPVB 5ERWB 1CFVL 3RWJB 3C60C 1MUJA 5F8RC 1OGTA 4FMFA 1NBVL 3UTPD 3T1WA 5FYLH 4BA8A 1I9EA 1SYSA 1CLOL 2DI7A 3FT4B 5GGTA 1HIML 4X6FB 1EEZA 5E70A 2GTZA 3CXDL 1L6XA 2CDEB 1BZ7A 3EYSL 3FTGB 4JZJA 1ZAGA 2UY6A 5DJ0A 1U9KA 3IXAA 3VE0B 5C6TL 3QFJD 2PYEE 4HIHB 5DA4A 4HMEA 5TF0A 2YWYA 1OP3K 3FQRB 1NDGB 4Y4KD 1LD9B 1SM3H 5GS3A 3LIZL 4U6HA 5C0FB 4GXUN 1XCQB 5KSBF 1HHJB 1NBYA 1J8KA 3SQOH 1IAOA 3IF1A 3MA7B 3GMNA 4JB9L 3BDXA 4ONHB 5CJQL 3D5OF 1UJ3A 1T80A 2BXYA 2R4RH 3VGDA 1WISA 1EAPB 4MDIA 4U1JB 1JHLH 3CFCL 3Q48A 5HGDB 1CGYA 3QDGA 3U7YH 3OAUH 4OAWA 3OB0H 4I3GA 2PCPB 5EC1A 4F8QA 2HKHL 1T2QL 5J6GA 3FKUS 1X5GA 1WBXB 5DJDB 1IGCH 4YAQB 1HH6B 4JFZL 2RFXB 1OTUC 3L95A 2Y1VA 4P3DA 4LPVA 4WU5B 2HRPH 1J10A 5KW9H 3HNVL 2J12B 3PWJB 3LEVH 4LLWB 3QCUL 2YD1A 4EI5D 3HZKB 1E4KA 4G8GD 4OLZH 4PP1C 5C8JA 2WBJD 4UV4H 3MGAA 2A9NL 5LAXB 4GG6F 5DTFB 1N5YL 1EEYA 1MFAH 4WUKL 1T5XB 3UXFA 4QHLB 1RJYB 4NUJA 2DL2A 1UJTA 2VWEC 3D39E 3L3GB 3VXNB 2HJFB 2H8PA 4NM4H 1KSRA 3ZSSA 3JWNC 3NBNA 5E8NA 3OF6A 4L9LC 4LNRB 1WC7B 5T3XD 2DQIL 1RURL 3EFDH 1YMMD 3LPFA 4K9EC 3DNKA 3CFDA 3NAAL 4WWKC 5FGCB 4PJDA 5D9SA 3KHOA 5D1QC 1QKZL 2C4FU 3UCRA 4DVRH 2ESVD 2Z8WC 3VMOA 4MD4B 3ES6A 4XPFL 2VR4A 2BNRD 2NY2D 2Y07H 4LEXL 2ATKB 4ODVH 3VFUB 3MV7A 8CGTA 2PUQT 3A67L 4HAFA 3SGDI 4U1GB 2OJZL 4CN1A 3RP1A 4IIQA 3AMKA 1XF4A 2BC4B 1AGFA 25C8L 4J23A 4OGXH 5IWLC 1BJ8A 3ZDYF 5ISZD 2ICWB 5E99H 3FQUA 1IEBA 5CIPA 2X89D 1GHFH 5K59E 3T1FB 2DMKA 5LWYL 3VXMA 2ICEB 1PLGH 3ZE1E 4I3SH 4Q6IC 1E4XH 3VI3E 1S5IH 3B5HA 3D85A 5KAQG 1RIHH 3ULVD 5H8DA 1MVFA 2ADJB 1WQVT 4R26H 5C0IB 4NGHH 4YHPB 3VXOB 1SJHB 4Q97A 2XZQL 3ZT6A 1S3KH 1CFBA 1FVCB 3CAFA 5F1NA 3M17A 4PRID 1FVEB 1CDUA 3IETB 3SDDA 2Y5TB 2CUMA 3MGTB 5F9WC 2W0LA 1TENA 1MCDA 3OZ9L 3KPSB 2VKXA 1QVOB 1HEZA 3HLAB 3MLVH 4S1RL 1C08A 2BY2A 2X9XA 4RMRA 3TH3T 4XC3H 4L5FH 4APQB 4PJ5D 3JTSA 5IB5B 4AQOA 1UXSA 1U8IB 1ZHLB 4P5KB 2PETA 4NC1C 2V17H 1NJ9A 3STBA 3KXFE 4X7SL 4O51B 1RIUL 2JTDA 5BRZE 2WK2A 4LF3B 5L8JB 4LAQL 1AP2B 4HFUH 4O2EA 1D5ZB 5CP7B 4P2OD 1QLFB 5C0BD 4UAOB 1OM3L 2FX7H 2XKUA 3GSNH 5L7XH 4OZIF 43C9B 4HWBL 1DUZB 2AK4E 1HWGB 2EDNA 4OLVL 3UJJH 2JCCF 5JHDB 1T22A 3L6FA 4G6FD 1T7ZA 2GQHA 3HAEH 4HWNA 3CZFA 4DUWA 3RU8H 3SKNB 3FFCE 4KK9C 5F89A 4UILL 4Y2DA 1NFDA 1QBML 4TN9A 1T4KB 3PQYE 3RHWF 1UH4A 3S5LA 3F58H 2YPKB 4MVBC 4DGYL 5IGXH 4ZPVB 5DJ2A 1CICB 1I1AD 2I5YL 1P5UA 1AGCA 4M6MH 3VFPB 1HHGB 1N59B 4J8RB 4UTBL 5DRXA 1FNGA 3L7FB 4PYGA 3LV3B 3BD3A 5HYJA 4OCSL 5DK2B 4U0RB 2XTJC 1VHPA 1FLRL 1FFPA 1NCAH 4BK4A 1G7JB 2X9YA 3BGMB 4L3EB 1EXUB 1IBGH 3HNTH 3KS0H 3RX8A 2ZPKL 3U30C 4XCFL 5BO1H 1SY6H 4RGNE 2HG5A 2W0PA 1KUMA 2IG2H 1EHNA 3ARPA 1HHIB 3EYFA 5F88B 2MQCA 3ZHKA 4S1DD 4BELD 2CUHA 2V9TA 1KIRA 5DJ8B 2XNAA 4XXCC 1GC1H 1LMKA 4OI8A 4HXAH 5B8CA 3MUZ1 1LE5B 3FOLB 3QCVL 4XPAH 3RRQA 1KIQB 2PO6C 1KELL 1YN6B 3O3BB 3K81A 4OZFB 2NY7L 2E7BA 1HWHB 3NIGE 3P4MB 2FEDC 5FUZL 2X4SA 4QWWC 2FL5B 3A6BH 2HYMA 4YZFF 3BKJH 3LSOA 3HUJE 4PRBB 5DO2C 1J1PH 5JDSA 3VFOA 5HYQA 4DKDC 2J88L 5GJSL 1OL0A 3PP3K 3PWLA 5C86A 3D0VB 1S8DA 1NCCL 2GAZA 4JRYB 3LN5A 1UQSB 4NYLA 1X5YA 5C92A 4NSKA 3FCTA 5JIHA 3B9DA 5D5MA 5J6HB 1FZOB 3U4BH 5H94B 1J05A 1A14L 5EU4A 1J0YA 3QXTA 2LVCA 2DLTA 4XNQB 4O5LL 5DRNA 3SKOB 2IEPA 3OXRA 1F3JB 2PW1B 4BKLB 5KG9B 1C5DA 3UJIH 1JPFA 4MA7H 3WUWB 4NKOB 4FZ8L 3STLA 2ZUYA 1NEUA 2R8SL 1A7RL 3WEXB 4PJIB 3UO1H 2VDLL 2ED9A 3MUGB 3SE9L 5I76B 2YN3A 3NGBB 4WGWB 5EZLA 5CLTA 1QUNA 5CAYB 4KK6D 5ACZA 3GI8H 2V2WA 4QRPE 4IRSC 5IV2B 1IM3A 2MKLC 3CDCA 4L4TA 1IGMH 1Q94B 3BQUC 2DTSA 1UM5L 4JQXC 3WD5H 5D7KD 3HPLB 4OQTH 5DMKB 2P4AB 3SDYH 1MCKA 4DW2L 5IMMA 2Z31B 4M8QB 5FO9A 2W65B 5J89A 4M1CD 1MH5B 4KRNA 1KENL 5F6HI 3ZL4H 3N1PC 3KNBA 3N9GL 4KKNA 2WINB 3QHTC 5I1AA 5TJWK 5E8PB 4LK4A 2P5WB 2EO1A 4HT1L 4PJGF 2O61A 1BZ9A 1PKQB 1XR8A 1T1WA 3QHZL 4OM1H 4NZJA 4JFDE 3RGVD 3CMOH 2Y25A 2C1OB 3AM8A 3BZ4A 5F1OB 3QPQD 4GRWF 1I8IA 4NN6B 1FH5H 4CU7A 5J9PB 1JF1B 3GSNA 4OKVA 4GRMA 3P11H 2HTLD 2O26U 3FB8B 5MERB 1KCRH 3O4LA 1N8ZB 1XIWB 4BH8A 5IB2B 2AQ2A 4HUVA 5F3HA 4KQ4L 2X10A 1IAII 3QQ9D 4PFEA 4Z7VA 5B39G 3HAEA 3P4LA 5AG8A 4X5LA 3W11D 5IW1B 1T04A 2CSPA 1XGQA 3G5XA 5I19L 2VL5B 3FQXA 3BE1L 1VADA 3MNWA 4PRDB 4OCLC 2EDLA 1RZGB 4EOWL 2CKBA 5DUBB 3MLZH 3U46B 3C8KA 3VFNB 4X9GA 3OKKA 4GAJL 1HHHA 4JPKL 2X70A 4BFBD 2QQLH 3H9SD 2CLVB 3QI9B 4XC1L 1Q9LA 4Q0XH 1EMTL 4Y19B 4APQD 5AYUL 4JY6B 1DQDH 4IRJA 4ZFZB 1SY6A 4LBEB 3VCLB 4OGAD 4Z76A 1CDYA 2GJZB 4P23B 2DICA 2YRLA 4R3SA 3HRPA 3EYOB 4FQLL 1A1MA 3IDYB 4Y4FC 1ACYH 3KPPB 3B2VL 1WGOA 4FP8H 4QRQB 4YHKL 4ZO8A 4HUUB 2OJEA 3LMJL 1MI5E 3A6CH 2HFFB 4LSQH 4K7FA 1CIUA 5CZXD 3WFEH 4MXQC 1ZGLM 3O0RL 1ZANL 2NR6C 2XQBH 3UTSE 4ZSOB 4JKLA 4OCRH 5MEOB 5I1IL 8FABA 3TPUB 5D2NC 3R06A 1FE8L 4IS6A 5D7JC 3TFKC 5LVEA 4HHAA 1IGJA 1JL8A 4GG8B 4XVSL 5C1MB 3O3EA 3BEWA 4EUPG 3N0PB 3QO0B 4XWOC 4RNRB 4YDKL 4J2XA 1YN7A 4M1DL 2ZSWB 1LEGB 4Y8DC 1CBVL 3PGCB 1ORQB 1CICD 2C7UB 4LDLB 4RDQF 1MEXH 4LHUG 5EUOE 3WO4C 4ODSL 4BSVA 4PG2A 1RULL 5T1DL 4KZDL 5ALCL 4RFEB 3RPIA 1TVHB 5GGVL 2HFGH 4K9EH 2XWTB 3A0OA 4L3ED 5I8KL 2XZZA 1I3GL 1H0DB 1MIEH 3IFPA 1D5XA 3ZE0F 1FV1B 3MPCA 3OMZA 5EO0B 3BPLC 5D71H 3RVWD 3DWTA 5IVOA 3F62A 5EOCH 1ZLUK 1LO4L 4JFFB 5EBGA 4GKZA 1RZFH 1G7QA 1N6VA 1QSFE 3THMH 3GJFH 3GRWH 1CZ8H 3G5YA 3H9ZA 5DQ9B 3DIFB 3LRGA 1UM6L 1LEKA 4MNQE 3WNOA 1JWMB 5SWZE 4HUNB 3S37H 4LRNH 4QHNB 5IHLB 1IFHH 2J1KA 1CGVA 3MRGB 3KS0J 4OLWH 4MD0B 3RL1A 1FNSL 2V7HB 1WFOA 1QBAA 4OQTA 1KBGL 3UYOD 1T3FA 1UFUA 3R1GL 4B53A 4XMKH 3DSFL 4X7CC 4GT7A 4RWYH 4KHTH 5C0AE 1F4WL 4XBPA 1MCSA 1ZVHA 2A6JA 2EIDA 4WHCA 5ICXA 5GIRB 2L7JA 4JRYD 4NQDB 4Y5XB 4NQUA 4UQ3B 3QJFB 4HH9B 4TSCH 4CVXA 5FCUH 3IVKB 2KQMA 4M62H 1SM3L 2Q6WA 1ODAA 2V2XB 2LE9A 2ZP0T 3SQOL 4BFGA 5DGQA 2OK0H 1HKFA 5HGHB 3QT2A 4JY4A 1U36A 4D0DA 4HLJA 3QNYA 4EIZC 5DK0A 3O41A 3VI4E 3E2HB 2R4RL 2A83A 2CXGA 3C5SB 1JHLL 5EBWA 5GZOD 1DQQA 4RGOH 4U6XA 3OAUL 3O81A 4U6YA 5IB4B 1JF6A 4U2YA 5ADOH 1AXSA 3HE7B 4LFHG 2EEAA 4ENEC 1QSEA 4G9FE 2A74B 3TBWB 4ODHH 1IGCL 4OF7A 3MRCB 2G5BB 5KW9L 4KVNL 4M6NL 3LEVL 1LILA 5EH1A 4QCIA 2Z31D 4OLZL 4S0TD 3MCKA 5E2WH 4UV4L 1A5FL 1CGUA 4TOYL 3OKDA 4PV8A 2GUOA 1MFAL 1F00I 1BD2E 2HVKA 5SWSE 1RI8A 4UT9H 2XWBB 4JREC 3AY4C 3OAZH 1NFIA 1EGJH 4NM4L 5C07E 5B38G 1WAAA 2UWEB 1ZEAH 1EUTA 1OF2A 1OGAD 2DQTL 2DWDA 3LEXB 2APVA 4LAJH 1XIWD 5I1LA 3KLDA 5INCB 4HZLB 5ITFA 4J6RH 2IC2A 3MRQB 2X4QB 4DVRL 2VITB 4NDMA 3K4ZA 5IMLA 1N4XH 3F7YB 1UH3A 5SX5K 2I60H 1FVDB 2Y07L 4ODVL 3EJYC 4OIIH 1J0IA 4GMTH 4N9GA 2FO1A 3MJ9A 2QSQA 3U0PA 4AIZB 4Z0XA 3TBTB 3FQNA 5D2LA 4MX7A 2VMFA 3ZYIA 5EZOH 5BS0B 1IC5H 2YUWA 1NEZB 1MLBB 1KULA 5IMKA 5K9QI 4LIQE 1GHFL 3QI9D 4H0HB 1KG0B 1LGVA 1PLGL 4WWKA 1BVKA 4I3SL 5DZNA 2WBKA 4HQQL 1E4XL 4EVNA 4GKNB 5D1QA 3RKDC 4Y19D 1P1ZB 1S5IL 1HE7A 5FB8A 1OSZB 1RIHL 4X6EA 4FQPA 3NCMA 2YPVH 2AI0H 3BWUC 2FJFB 4P2RB 4X9FA 5E8OB 3MNZA 5KSAB 2FSEA 3Q0HA 4YHLH 1MCPL 1S3KL 2P5EB 4P23D 4W4NA 4YNYA 1FL3B 3VXUE 5HPOA 5FO7B 4HV8B 4M03A 4H20L 3GJFA 2W38A 4ZS6D 3MYZA 1X3DA 1A02N 3GRWA 4P2QA 2EXYC 4S10A 1SYVA 2AXGA 1VA9A 4DOHB 5FOBB 15C8H 3BGAA 4MXVE 2Z8VC 1B0RB 1Z5LB 1MLCB 2X4PB 1OLZA 4L5FL 3L1OH 5ETUA 5DD3H 1FSKC 1HILB 1P9MC 2XPGA 1ND0B 1RHHB 4MAYC 4Q6IA 5HI3D 1YEKH 2V17L 3VGAB 2HTKD 2E5EA 2ICES 4YGVA 3KR3H 3QDJD 3GGWB 5FUCC 4PJEE 3UAJD 3U36B 3DTXB 4HFUL 4DQOH 1KTDB 4EUPH 1CT8B 3BRFA 2EKSB 4RBPH 3QG6B 2A6IB 4OZGA 2FX7L 3FN3A 3GSNL 5L7XL 4BH7A 5IUSA 3GBNH 5EB9A 2OL3H 2J6EL 4LSDA 2C3XA 2F54E 1EV2E 1H8SA 3UJJL 2I9LA 4PJFA 2VO5A 3BSZH 3QWOA 3TO4A 5D7IA 4EKXA 3R8BB 3RU8L 1JWUA 5H35A 1MWAB 1KXTB 3TLRA 4PRNA 5T5NF 1JPSL 3LKQB 2VSCA 4KI5F 4PJHF 1R3HA 1JV5A 4JDZA 3RVUD 4Y4HA 1KLGA 4M6ML 1RZ7H 3K1KC 3TGXA 1F2XK 3T04D 3DVGA 3TIDA 3L5XH 3V5KB 5JTWA 1LP9B 3ZKXB 4H25A 4U1HA 4DKFH 1ZOXA 2Q7YA 4JPVH 5FM4A 4EI5C 1AGEB 1NCAL 2BOBA 1KXVC 2EYTA 5CD5C 1VGEH 2AJYH 4HJJH 3MACH 3PV7A 2WBJC 3ROLA 3MR9B 4EBQL 3ULUD 4FOMA 1IBGL 3HNTL 1DEEB 4PY7A 1ZXQA 1MCLA 1SY6L 5BO1L 4F7PB 5EOCJ 3GMLB 1ES0B 1N2RA 4XVTH 1KJVA 3MLRL 1FIGL 4Z8FH 1YQ2A 5J1AB 3MV9E 5IKCA 1VFBB 4TULH 4KXZI 4MGXA 5F6IC 1CDIA 5C0RH 5CJ5A 4HXAL 5EA0H 3OKMA 4I2XE 1EGJA 4QXUH 1BVLA 1HHKB 5FEBA 4LMQI 3U1SH 1JN6A 3A6BL 4TSAH 4WUUD 3BKJL 3ORJA 3WN5B 3DURB 4ERSH 5D2NE 4P4KB 1JRHL 3BHBB 4CVZA 5DEFA 2NY2C 5I18L 2RB8A 4XX1G 4ODTH 3WE6B 1RZJL 1NC2A 3Q5TA 3JWOL 5D1XB 4CW1A 4HGWA 3CX5K 4GUPA 3UDWC 1PYWA 1MY5A 3EOYG 2YPLA 5BJTA 3HE7D 1G7MB 5B39A 4XXCA 3BZFA 2FIRT 3NACH 4Z77B 4A2LA 2E8YA 1WEJL 3RVXC 3DX7B 2PO6A 1EPFA 3RPKA 1MQ8A 3KPQB 2IF7A 1BWWA 3QQ4A 2LV4A 3PL6B 4MA7L 2E6QA 4LLMB 1OW0C 4U7SA 2FDBP 3O6KH 3RDTB 3GMMB 3UO1L 1BJ1H 1T66D 2P1YA 4Y8AA 2H1PL 3NIDE 3VWJC 5F9OH 2DM4A 4B0MM 5KSBB 3NTCH 4V1DA 1QEWA 5KOVC 2BFVH 2AXFB 3CNKA 4PJBA 3GI8L 2J5LB 3VFMA 4AJ0A 5DMIL 1D5BB 5CBAA 1I9RL 1ZA3B 3RTQB 2QJDA 1IGML 3HPJB 2HN7B 4G8IA 3WD5L 3OXSB 4UIMA 1BAFH 3CFIC 4NKDA 4OQTL 4QGTA 1SMAA 3MRDB 1DSFH 1WUNT 3CVIL 3KYNA 4YHIB 1OHQA 1PKOA 3AB0B 4P5MB 1NL0H 3ZL4L 2BNQB 3DUSA 4F15B 1PG7L 3SCMB 3TBVA 3KG5A 2FATH 4Y16C 4C56B 1JPGB 1JNNH 5JW3H 3U7WL 4WV1C 4UBDC 3JV0A 1DFBL 1Q38A 3NABH 4CNIA 2AEPL 3MMEB 2NY0B 1MHCB 3HN3A 1VEPA 4OD2A 4EUPA 3LKNA 1HYSC 5AG9A 3DROA 1FH5L 3BQUA 4JQXA 1FDLH 4TNVK 5BS0D 3P11L 4GG6B 4LHUA 3QEQD 1CFTA 1KCRL 1M4KA 4GLRH 2EDRA 3W5MA 3MFGB 1DVFB 3I6LE 3MXVL 2HLAA 3SGKC 5BW7C 2H6PA 3G6DL 3UTTE 5B3JE 4P2RD 4GBXB 5DFVD 1JE6A 1VERA 2P5ED 1YEDB 4MZ2A 4M93B 5EBMB 4LCWE 3MLZL 1U92A 4HK3N 5TE4H 3LN4B 3BESR 4LLDB 4QHUA 2XN9E 3H42H 2AK1L 4QOKB 4ZOEA 43CAA 3WLBB 1WJ3A 1H15B 3UBXA 2FYYA 4OZGF 3E1F1 4S1DC 2WSKA 1DQDL 3X11B 3DHJA 1MAML 4C55A 3TVMB 3V52H 2R1XB 1UEYA 3PNWB 2DQUH 2BSSA 3WDJA 5E00B 3K74B 1TQCB 5AZ2L 2OR8A 4MD5A 1MCJA 1H3VA 2NXZB 2Q76B 3ZKMC 1KLFA 2GYSA 1ACYL 2UUDK 3S7GA 1S7UA 4WO4B 4UU9A 1EERB 5MI0C 2ZSVA 3CH1B 3SGJC 4JFQB 3A6CL 3WFDH 1WFTA 5DS8A 4YR6A 4TUJB 3M07A 1RJZB 4OFDA 3WNMA 5CEZE 2ZG1A 2DQGH 2XQBL 5C0CB 3QUZD 4M7KH 4K8RD 1FFOA 2XIDA 4D0BB 1Z9MA 1WWWX 3TYFB 3QXAA 3VD3A 1A6TA 4N9OB 3T0AA 1K8DB 5JPMB 4G42B 5HHOD 1UWEL 1RUQH 5IQ9A 3B4NA 3QZWB 4R7DA 3VW3L 2ATPB 4HG4J 3C9NA 4Y4FA 1B9ZA 5MP6H 3BUYA 5B21A 4KHXH 4ORGA 5K33A 1WZMA 1YEFL 1U41A 4LLAA 1IQDA 5HDBF 3BI9X 1M7IA 4AY0A 2IPUG 1TZIA 1JNHA 2NX5E 3PDGA 4X6BA 4PJ9A 3NN8A 1A4JB 4K9EL 1RVFL 3UPAA 5FO8A 3FJTA 3CVHH 3MLTB 1AXIB 1JHTA 1AHWC 1Q72H 4Q74A 1CDBA 1N6QH 3ZKQD 5EOCL 4KMTL 3UTPE 3HE6D 3UTQB 1F45A 1RZFL 4WEBH 4OZIB 3ARDC 3THML 1HK6A 2O93L 4R97B 4LASH 1INDL 4QNPF 5E4IA 4HJ0C 2JCCB 5GRVL 4UNTA 1LVEA 3S37L 4LRNL 2FJHA 1IFHL 3QFJE 4M1CC 2LQRA 3FT3A 1MUJB 4I4WA 1OGTB 1IQWL 5IR1A 3V0VA 1IC4L 4P4KD 2UZYB 4XMKL 4LVNC 2N4IA 1SYSB 5B38A 4UV7L 4RWYL 1EHLH 4KHTL 1EEZB 3P2TA 3VG9B 4JZJB 5TDPA 4AH2A 5DJ0B 3IXAB 1U0QA 1AFVH 5D1XD 1T89C 2P7TB 5DGRA 4U1GC 2NY1B 4GS7C 3N1QC 4R4BA 2MCPH 4LNVA 4TSCL 5FCUL 1JFQH 5HVGB 5FECA 2Q3AA 5E6IC 3WXWL 1A3QA 4GMSH 4DCQA 2JELL 4U6HB 2OK0L 2NXYB 1IGFL 1NBYB 2UV3A 3TCLA 1IAOB 1E6OH 3GMNB 4ZUVA 3PL6D 5E95B 1UJ3B 4L8SC 2NTSP 2VL4A 3MJ6A 2WIIA 3RDTD 3QEUA 4E41A 2FH8A 1TZHA 4MDIB 1GJIA 1HNFA 5ADOL 2A6DA 3QDGB 2DIBA 4OAWB 1OWRM 3D48R 5DMJB 4BSWA 1FAIL 5GGVY 5EC1B 5D7LD 4ZNEE 4PJAE 5J6GB 4G8GE 3VWKD 4MA1C 3G08A 3S6CA 1MCWW 2AGJH 1J88A 1JGDA 5E2VH 4PLKD 3L95B 2HH0L 1HQ4A 3W0WA 5JXAH 3DPBA 1A7OH 1I1FA 3T0WA 1V7MH 3FB7A 3KWWA 5E2WL 4M02A 4JZNA 2YN5A 4Q7DA 3SCMD 5C8JB 4OF6A 1UB6A 2JB6A 4JGUA 5T3XE 1EEYB 1T0PB 4C56D 2YA1A 1V3KA 1YMME 4JDVA 4NUJB 4XH2A 5F1IA 4UAOC 5F9DC 5KTEH 3LRSA 2NY0D 3HMXL 2H8PB 2H3NB 1W8NA 5GRXG 2ESVE 2E3VA 1YYMH 1YEHH 2XXCB 1ZEAL 3CFKA 5E8NB 1FC1A 1PD6A 1UCTA 3Q1SH 2BNRE 3ZKNC 2B0SH 3WFBL 5JXED 3IDNA 3CFDB 4J6RL 4PJDB 1DVFD 2P8PA 3WFCL 1NH6A 1L7TH 1N4XL 1Y6KR 3OGOE 3VRJA 4CGTA 4K71C 1IILE 5EFIA 2I60L 1CXEA 1NSNH 3ES6B 5ISZE 2BY1A 2E6JA 4OIIL 2GK2A 4FFVD 4GMTL 3MV7B 4LCIL 3AY4A 1S9VA 3L3HA 4U0RC 4X6DF 3ZTJG 1BFTA 4QYOA 4C59B 2GFBA 5EZOL 2Z93A 3QRGH 4HIXH 1IC5L 4IIQB 3ULVE 1AGFB 2EYSA 1I1YA 4PJGB 3FQUB 5JHLH 2HA1A 1IEBB 5CIPB 4PRIE 3DX8A 1IAMA 1XCTB 3IDJA 2ICCA 3VXMB 3CVHA 3ZLQC 4TQEH 2YPVL 2AI0L 4FQIH 3TVMD 1FGNH 4ZUTA 4GRWB 3D85B 4R4ND 3RVVD 1P7QD 2CRMA 3S3PA 2VLJA 5D70H 2JLLA 1E27A 2NXZD 4PJ5E 2WWKO 3K8LA 1S9YA 1J0KA 5F1NB 3P9LA 1MJJA 3M17B 1FFNA 4TSBL 3SDDB 2CIKA 4E42A 4CN6A 4L3CA 1S7XA 15C8L 3EIFA 4YIQA 5C9JA 3HR5A 2N7BA 2HJKA 1HEZB 4QXTA 5DD3L 2R39A 5C0CD 1C08B 4LIQL 4U0QB 1OD7A 4PLOB 2GY7B 1YEKL 5C0BE 3JTSB 4G3YH 3EUUA 1UXSB 2EXWD 2PYEA 1NMBH 1W72H 4PB0H 2FZ3A 4AEHH 3KR3L 3KJ4B 1NJ9B 3VDCA 5I6XB 4DQOL 1Q9OA 2Z4QB 2BZDA 4GKOA 2ZUTA 1YNTA 4O2EB 3QWRD 1YEJH 3TWCH 3GBNL 2OL3L 4LOUC 3CZJA 1OT2A 1EFXB 1UWGH 3VXRA 3BSZL 1OSPL 2GT9A 5E7FA 1O0VA 3B8YA 1JZ7A 4K7PX 4D9QD 5K9JH 1P9MA 1T22B 1TZGH 4H0IA 4MAYA 3NGBC 4GFTB 3CZFB 5F89B 3OWEA 3TCXA 4Y2DB 3HG1D 4Z7UA 1NFDB 4G5ZH 4BFEA 3S5LB 2A9MH 1FO0H 3G6JF 5DJ2B 1RZ7L 1TQBB 1DR9A 3BDYH 3PE9A 3X17A 1AGCB 3RZCA 3WL9A 1K9TA 2YC1A 5DRXB 1FNGB 4DKFL 1EEQA 4G6JH 1VESA 1VGEL 2AJYL 3P77A 3MACL 4HJJL 2JIXA 3LDBB 4P49A 4JZOA 4ZO7A 1FFPB 2XG4A 3V6FA 4H88H 2FNBA 2HG5B 5IW6A 5GRZA 2E7HA 3HI5L 1CQYA 4Z8FL 3EYFB 3ARYA 4HULB 4TULL 4KK5C 4PRHA 4YBQD 5GS0D 1NLDL 5C0RL 3MOQA 4XCEA 3SKJH 1KCUL 5EA0L 1TMCB 1JPTL 2XNAB 4FQHA 5DUPL 4NN6C 4QXUL 5B8CB 2DD8H 3P0YH 1J7VR 2HFTA 4JM4H 3HC4H 1FORH 4N0FA 4XPGH 2D7PA 4TSAL 3K46A 2M1KA 2J7LA 2NXYD 5HHVL 2WUCH 4ERSL 2X4SB 5F7HA 2N7AA 1A6ZA 2DMBA 4ZTPL 2VSDA 3JTTB 2KKQA 1KPVA 3LSOB 1C1EH 5JDSB 5HYQB 1YC7A 5CLWA 3T0DA 5DEZA 1J1XH 2JB5H 3MRBA 4KJQC 3PWLB 4LVHC 4PBVC 4BZYA 2I26N 4NRZA 1S8DB 5E8EA 2GAZB 3LN5B 3QDGD 1FC2D 4NYLB 1Q8MA 4G8FA 5K9OA 4NSKB 3FCTB 3LKPA 2Y7QA 4YHOL 3T3ME 1J05B 5EU4B 2ADFH 2OBGA 4PIRF 1G6VK 1BOGA 5DRNB 4B50A 4XCYA 4AL8H 1WWAX 4ZOCA 1MCRA 3T65A 1YQVH 3OBAA 1C5DB 3O6KL 3QUYC 1JPFB 3O8XC 5FKAB 2JKXA 1JNLH 3STLB 4E9LA 4J3WA 5F1SA 4M00A 5F9OL 3IDYC 5D7KE 3NTCL 4JHBA 3UDWA 2Z35A 1M71A 2BFVL 5TH2A 5KN5A 3LOWA 4M3KB 5EZLB 5F7NC 4OD3H 4OF3A 4HG4K 3KLSA 2QSVA 3WUWG 5ACZB 5FGCE 2V2WB 2J4WH 5E03A 1IM3B 2EH7H 3FZUD 1BAFL 4L4TB 2QADC 1X5ZA 5D6CA 3S8WA 1EK3A 3OF6D 1A7NL 1DSFL 3HS0A 5HI3C 1B2WH 2D31A 3D87B 5HGAA 1I7TA 1I7ZB 5IMMB 3C8DA 1OW0A 4HIIA 5B22A 4BZ2H 2NY6C 5FO9B 1MREH 3IJYB 3KNBB 2YRZA 2FATL 4GQ9L 5F7EL 3KXFA 3T4YA 2Z9TA 5I1AB 3INUH 1JNNL 3VWJA 5JW3L 2CUIA 1W72A 4WY7H 4W6YB 2NTFA 2O61B 3NABL 1BZ9B 1XR8B 5ICYA 1T1WB 2MKWA 1IGIL 4GSDH 3ARSA 3MV7D 4KY1H 5DQJA 3BZ4B 4HKJA 1OT1A 1I8IB 3MOBL 2ZUQC 2ENSA 4HMDA 4Z7WF 4OKVB 4GRMB 3MA9H 2DM2A 3PHOB 2NW3A 3IDGA 4TUOA 4HUVB 5F3HB 4Q2ZA 3MUHL 3VXMD 3VXSA 5IP4A 3FFCA 1D3CA 4MZ3A 4Z7VB 4K3HA 4NN5B 3REVB 4MJ4A 4PJXE 4Y16A 1E28A 3D85D 3OJ2C 3H9SE 4MAUH 3FMGL 4A6YH 1OQXA 1XGQB 3CDGA 1YPZA 2CLZA 1FO0A 3FQXB 3T2QA 1UM4H 5DEGB 4LPXA 1VADB 2B39A 2AJSL 3BKYH 3SDDD 4NQXA 4OLXL 2KH2B 3G9VA 4AM0B 4OF8A 2CKBB 1CXLA 3H42L 3C8KB 4LKXA 4PGZA 5IB3B 4YXKL 3OKKB 4N0UA 1HHHB 2EDHA 2X70B 4LCUA 1CGWA 5IHZA 1S7QA 4XP4L 5F44A 2XKSA 1NKOA 2Y72A 1Q9LB 2IALA 4LSTH 5FYLD 1ZT4A 5ID1A 4FXLA 3V52L 3K8MA 1JTTA 3SGKA 2XY1A 1IZKA 2DQUL 4IRJB 5KVMC 2EEBA 4UDUA 1HINL 2ZCKH 1JF5A 5D1ZB 4DVBA 4Z76B 3Q5OA 2AEQH 3QH3B 4FQ1H 3G5ZB 4R3SB 3T8XA 2QHLA 5ERWA 3DSNA 3TBYA 1A1MB 5C0ND 1TXKA 2QKIB 1ZSDB 3WFDL 3FT2B 1KLUA 1FG2A 2OJEB 3LQZA 4ZOAA 1QFUH 4R7NA 1KIPB 2DQGL 4K7FB 4X6FA 1MJUH 2ITDA 1HOCA 3C6LD 5IVZB 2PR4H 3VE0A 1DBMH 1IT9H 1G1CA 5JORA 5C71A 3AROA 5CKAA 8FABB 2AV1A 2QQQA 1W0VB 3R06B 4IS6B 4WCYH 4HHAB 1IGJB 4KMLB 5E9DA 4XRCA 1DP0A 1RUQL 5FF6A 3O3EB 1H3TA 3BEWB 4RSVA 1F90H 4Y2DD 1IEHA 1UADC 1YN7B 4L3EE 5HPMA 5MP6L 5GSVA 3S35L 4F7CB 4KHXL 1F3RB 5T3ZE 4KKAC 2VDPL 4BSVB 3ALWA 4ONHA 2EE9A 3SGEH 5I15H 3C6SA 4ZO9A 5HYJD 4KDTA 3RPIB 4LGPB 3CK0H 1ZLWH 1OAYH 4WHTA 3I84A 3CVHL 3TNMB 2E9WA 3PGDB 1SEBA 2WLZA 1Q72L 2HT3C 3IFPB 1D5XB 2PCPA 12E8H 2GJ6D 2W91A 1KC5H 4WEBL 4GKZB 4LASL 3QQNA 4YAQA 1DJSA 3IKCA 2WBWB 3G5YB 2JJVA 3QJHA 3RWDA 1LEKB 1E6JH 1T7WA 3KPRA 4JQVC 2QL1A 5T1LA 4JRYE 5BV7L 1RK0A 4PJHB 3RL1B 1P84J 3OJMB 5DJ6A 2YZ8A 2MCG1 1BF8A 3V2AR 1T3FB 1EHLL 5H37G 3LPWA 3I50H 2IJ0C 4U1SA 1AHWA 4QHLA 1RJYA 1AFVL 3LN9A 1T2XA 4G7VL 1N0XL 5ICXB 4IEFB 2D03H 5K59F 2H2PC 3ARDA 1A6PA 1JFQL 3ZE1F 3ZDXE 5JW5A 1BFSA 3EAKA 3VI3F 3GSUA 1B6DA 4GMSL 4ZMAT 3WHE1 4LHQB 4CVXB 4LNRA 1VPOL 2R1WA 2Q6WB 3P9MB 4PJ7E 4UOJA 1E6OL 5BMFL 1CGSL 4OT1L 4JY4B 4D0DB 3TBSA 2J2ZA 2ZUUA 2EZ0C 3QNYB 4DZBA 4KRLB 2EDJA 3O41B 3ARVA 5KSAC 3RI5F 2A83B 1E4XI 1RIVH 4U1NA 5EBWB 1DQQB 4U6XB 4I9WD 4TVPH 4YPJA 3RA7H 2JJSA 2BVTA 1T89A 4U6YB 1AXSB 1OY3B 5IOPA 3QUXA 3GM8A 1QSEB 5DMYA 1K3ZA 4A6YA 3NMEA 5E6IA 3IJSB 1K5NA 2AGJL 4RFOH 5F93C 4DWHA 2PNDA 2PXYA 3BPCB 2O5ZH 5E2VL 5IBTL 3T1FA 2ZCHH 2GSGB 5KBNC 5F72S 5JXAL 2MTPA 1A7OL 3TN0C 4F9LC 1DQLL 4H1LA 3P4OA 3CDFA 4JO3H 1FRGH 4QCIB 5I8OH 4IMLA 4L8SA 3VJ6A 3CFBA 4PY8I 1H9VA 3OKDB 4L9DA 4PV8B 2VQ1A 1GAFH 1OGAE 2GUOB 3T09A 5ENWA 3QA3A 1I75A 2HVKB 5KTEL 4ACPA 4KKCD 2DQCH 2X40A 2VR9A 2C26A 4ZPTA 4G7YH 5I75C 1H3PH 1NFIB 4YDIL 7FABH 1TDQA 1CE1L 1VDGA 2RHEA 3HLAA 4K8RC 2VLKA 1OP5K 1Y6MR 2B0SL 1OF2B 2X42A 2IBZY 4BFIB 2DWDB 1UKSA 3O4LD 5I1LB 1L7TL 5ITFB 1NGQH 4NDMB 5IMLB 2W9LA 1PEZA 3FO1A 2YA0A 4FTVA 1XGYH 4EDWL 2AABH 3U4EA 4M7LL 5JW4M 1QLFA 4TUKH 1JHKH 5FAAA 5TGBA 2LTQC 1A6VH 4Y19E 4Z0XB 3BP5A 3GMQA 4HIXL 3FQNB 5D2LB 4XNXH 4XPBH 4MX7B 2XA3A 1GZPA 4UIKH 2XY2A 5JHDA 2W9EH 5IMKB 3NZHL 3GMRA 2V2TA 3SKNA 1T7YA 4WWKB 1BVKB 3P0VH 4TQEL 3NIGF 2VLRA 1FGNL 2CRZA 5FB8B 4X6EB 1K4CA 4IRJD 5B4MD 4P5TA 2PW2A 1NEZG 5D70L 5GQBA 1KEGH 3MNZB 4NRXA 3HUJF 1FNAA 1N59A 2FSEB 5EU3B 4YNYB 3SOBH 2R0KL 4JR9H 4LDOB 2WWKT 3WN5C 4KJWD 4P2QB 4QLRA 5D4QA 1SYVB 1OAXH 5JR1H 2AXGB 3S36X 3V4UH 1FCGA 4RMQA 1NCNA 3QDJE 2YSSA 1HHIA 5ETUB 3NCYS 1JRHI 35C8L 4X4XA 1QLEL 4G3YL 5C0AA 2XPGB 1UC6A 4Q6IB 4JPIB 1NMBL 5CCKH 1W72L 1CDHA 4PB0L 4AEHL 1KGCD 5HVFB 4QRUA 1QFPA 4YGVB 1L0XA 3FB5B 5JZ7C 3NVQA 4JG1H 1MVUA 3WJLC 5BVPH 2ZZUT 3UPCA 1YEJL 4OZGB 3TWCL 2CIIB 4YFEA 2IQAA 2YRPA 1CXIA 4WRLA 2L7UA 4KUZH 4BH7B 1U8PA 4KK8C 3L5HA 1DL7L 3EYQD 4F9PA 4LSSL 3PWNB 3V6OC 2I9LB 4PJFB 3CPLA 3QWOB 5K9JL 2BDNH 3TO4B 3MQIA 5D7IB 4WFED 4WIQA 5DT1H 1NFKA 1JWUB 5H35B 5IFAH 2DKSA 2J5LC 6FABH 1A7QH 5J6HA 1JV5B 1FO0L 3OPZL 5FK9A 3RTQC 4JDZB 3ULUE 4G9FA 3BDYL 1DN0A 3S98A 4GXVH 4Y4HB 1KLGB 1S7TA 4ODBD 5DJYA 1CDGA 1F3JA 3TIDB 4MQSB 1DBAH 4G6JL 1HZHH 2IPKA 4H25B 1QG3A 4U1HB 1CE6A 1G7HA 3Q6GH 2BOCA 3VFSA 2BOBB 2EYTB 4HMCA 3ROLB 1ORSB 2DQEH 3K4AA 5I74C 4H88L 4PY7B 2QEJA 4BQ6A 1T7XA 1N2RB 5GZNC 4XP6H 3GBLA 4WUUE 4PJ8C 5GGRY 4LMQE 1KJVB 2NY0C 5F8QC 4N68A 3WXVH 4I0PC 5IKCB 3SKJL 1AQKL 2Z0BA 4M5ZL 2Y4SA 1Q94A 3P0YL 5ITBL 1KCVH 3SDXA 3OKMB 5DMKA 1FORL 4XPGL 1BVLB 3IDXH 1B88A 1JN6B 4M8QA 2XQYK 4P9ML 2XTJB 3VXPA 3C60D 5LCVL 2DJ4A 3IFNH 4KROB 3RKPA 1C1EL 4CVZB 2P5WA 5DEFB 1C8PA 1YEGH 1J1XL 2JB5L 4GBXC 4ALAL 1HXYA 2I25N 4M5YH 1NC2B 3JZ7A 2E27H 4P99A 4CW1B 4FFYH 4HGWB 4GUPB 5CJXC 5HHMD 1PYWB 2H41A 2YPLB 2GTWA 3ZT7A 5BJTB 4LPWA 4ETQB 5FUOH 3T0EA 1FPTL 1NCDH 1QSED 1G6RB 4PGJA 2ADFL 3KPNA 1QYGL 5AD0A 4XPTL 5MERA 5EZJA 3QPXL 1DQML 1CLZH 4AL8L 4EXKA 2PO6B 3C87A 1WT5C 1MJ8H 2VAAA 4QT5A 3TV3H 2FX8H 4WTXA 4XB7A 3X3GH 3QQ4B 2KUTA 4QRRA 4Z5RB 5IW1A 3IU4L 1TQCC 2AJUH 2AEIT 4AG4L 2LFGA 4LSRH 3EHBC 4LSPH 2D7OA 4WO4C 3VXUA 4PB9L 2R23A 4V1DB 1QEWB 1JK8A 3J8F7 4RIRA 4PJBB 3VFMB 5I1DB 2W9DH 5CBAB 4F7TA 4U6VH 4HXBL 2EH7L 3R0MA 2IPUK 3HFML 3BW9A 3QIUA 5HVWA 4G8IB 4WI5A 4UIMB 5CUSH 5TQ0H 1B2WL 4EN3C 5A2KH 1OTUD 2NZ9C 1CTOA 3MV8A 5DC4B 1NMAH 4IOFC 2MPAL 4BZ2L 3KYNB 5EUOF 3QUYA 1A7PL 3O8XA 3NFPA 3DLQR 4HBQA 1MREL 4LCYA 4F3FA 3VA2C 3DUSB 3F5WA 3TBVB 3GO1H 5C3TA 3ARQA 4PP1D 5BS0E 1QLRA 4WY7L 3QEQE 5CJOH 3DUUA 4GSDL 3WHE0 2W1NA 3BJ91 4CNIB 3KYKH 4KV5F 5EDXA 3O2DH 2VUYA 2P44B 1KFAH 4OD2B 4EUPB 5E24E 3LKNB 4ZQKA 3DROB 4OLUL 1NMCC 5KVFH 4K3JH 4P2RE 4PV9A 2X2YA 4NQVA 1U42A 5CHNA 1P84K 4FQ2L 1CFTB 2P5EE 3RAJH 1X5HA 1ZE3C 1TETL 4F80A 1J18A 4PJCA 3UYRL 4WWKD 4RNRA 2HLAB 5D1QD 2H6PB 1LEGA 4R97C 4DOHE 5DQDH 5HHQA 4A6YL 5KVGH 3NPSC 4UINH 1F42A 2G2RA 1ULVA 3GKWH 5FDWA 3T0VA 1Z9OA 2X4RB 4OSUL 5BXFA 4P2QD 1U92B 2AJXH 1SVZA 1XGTA 4QHUB 3BYTA 1FV1A 3KYMA 43CAB 3OHXB 4LSTL 3RWEB 3UBXB 2W07A 5GS0C 4YBQC 4JFFA 2NY1C 3I3EA 1RSFA 2ZCKL 1KPRA 3H7LA 2BSRA 3ZDZE 2AEQL 4Z6AT 4NZTH 2NQCA 2CK0H 5J12C 5L9DH 2A73A 3VI4F 5F9AC 4I2XA 2NXYC 4NM8H 1S7UB 4UU9B 5L2KA 3UX9B 2ZSVB 4G6KH 4MD0A 4I18C 5DS8B 4YR6B 5CSZA 3PGFH 4XWGH 1MJUL 5HHOE 1XF1A 1UJ3C 1FAKT 1UGNA 2ZKHH 2PR4L 1IT9L 5CP3H 1E0OB 1JWSA 2YHGA 1FFOB 1AIFA 4JM2F 3DJ9A 3QXAB 3TO4D 4WCYL 1IGTA 4NQDA 4XHJD 1LP9E 1A6TB 1S7RA 3ARGA 1F90L 3I6KA 4K94C 2EH8H 5GRUH 1F58L 5IQ9B 4I1NB 3L3OA 4OIAA 4R7DB 3Q5YA 4QY8A 3C9NB 4Y4FB 4Y4HD 2VDMH 3BUYB 4ORGB 1JJUA 4ZUSB 3C09B 4RX4A 5F7LB 4XMPH 1IQDB 5I15L 1M7IB 1T21A 1R24A 1TZIB 1JNHB 3CK0L 4KGJA 4IDJH 4PJ9B 1DTUA 5SV3A 3NN8B 5TE6H 3L9RA 5DUML 3QZWG 2MMXA 1E4KC 3C5SA 1XF3A 5FO8B 4DK3A 1QA9A 3E6HA 4YUEL 5T1MA 3HC0A 12E8L 4XNUH 1JHTB 3V95A 1FIEA 1KC5L 4CUCA 4KK9D 2R2HB 3TBWA 3BKML 4N1CA 1BIIA 4MVBD 1GOHA 2G5BA 2UZIH 4I3RL 1E6JL 4UZGA 5DWUH 1SQ2N 1PFCA 2FJHB 1IC7H 1MCBA 3RWGA 3OR7A 3FT3B 3LS4H 4I4WB 1WIPA 2HJLA 3O11B 2XTJD 5IR1B 1MHHA 3V0VB 2R15A 3G6JB 3EYUH 2ZUWA 1EIBA 5B38B 3LCYA 5FGBA 5KSVA 3HC3H 2H9GA 4HIEA 3B5TA 4AH2B 5TDPB 3QNXA 1R3KA 5F71A 1NC2D 3BPLB 2EDOA 1F97A 4U7KA 3HNSL 2YPLD 3BP4A 4X5WA 1A64A 4R4BB 4D9LH 5FECB 2UWEA 4MJIA 3T3PE 4DCQB 2I24N 3O2DA 4F7MA 1TIUA 4JQVA 4QKXB 2PO6D 3TCLB 2FEDD 4QWWD 2EYRB 5D7LE 1G7PA 2DLHA 3IS1X 3RZWA 2X44D 4U05A 3ARTA 2J8UA 3NFSH 5DO2D 1RIVL 3BIAX 1PEWA 2DKMA 4Z9KB 4MXVF 2WIIB 3S9DB 3QEUB 4JGJA 4TVPL 3RA7L 4E41B 1TZHB 3V7MA 1WWCA 3BO8A 2A6DB 5A2JH 1WBYA 4S1SL 2CDFA 3ALPA 4V1DD 1EX0A 3T2NL 4BSWB 2EDEA 4RFOL 1MLBA 3IFLH 5JQHC 4KI1A 3G08B 1ZWIA 3GM0A 3EOBB 5F7MC 1JGDB 4PJEF 4C56E 2XZAH 4QTIH 3L3JA 1QBBA 1HQ4B 4TPRH 3W0WB 4JO3L 1FRGL 3BXNA 4OB5H 2N56A 1I1FB 5ALBH 3CUPA 5I2IA 5E8OA 3QIBC 3FB7B 4UQ2A 5KSAA 3KWWB 5I6XC 1GAFL 4JZNB 3HI6H 1CDCA 1LNUA 3K2UH 4B7LA 5C0NC 3MBEC 5DVNA 2JB6B 2DQCL 4XH2B 4JDVB 5F1IB 4X7TB 2DQJH 7FABL 1EBPA 5SV4A 3OB8A 2AS5M 1QFOA 3TT3H 1B0RA 3LRSB 3GI9H 4O58H 4IRSD 2X4PA 3VD9A 3CFKB 3O9WB 1A0QL 3BQUD 1BQUA 3RWHA 4MNGA 3TN0A 4LHUD 1PAMA 1ZA6A 3IDNB 4OZ4A 5CP3A 1NGQL 2P8PB 4YFDB 1J1OH 3GGWA 3VRJB 2ERJC 4QHMA 5EFIB 1X5XA 1XGYL 2R4SH 3QG6A 5LBSH 5I8CA 2ENYA 1A2YA 2ZG3A 3NCCB 1JHKL 2K9UA 1YUHA 1A6VL 4G6AC 1UVQA 4JREB 1LHZA 1S9VB 3L3HB 4QYOB 4XPBL 2GFBB 2ILLA 2Z93B 4UIKL 5HDQH 3LQAC 3QCTH 3MRIA 2W9EL 2X1XR 2EYSB 4I8DA 1I1YB 4QTHA 2EEDA 3LKQA 1KCLA 1C12A 3DX8B 3IDJB 3CVHB 4JFOA 1BM3H 3FAWA 4RA0C 4KAQL 5CBEA 5IVXA 1KEGL 4ZUTB 4G9DA 1P4LA 3C5JA 3L7EA 5B8CC 2VLJB 3SOBL 3V5KA 1CD8A 5C0CE 4Z7WB 4JR9L 1MF2L 1GGBL 3MRJA 1S9YB 1S5HB 3P9LB 4L1DA 1MJJB 1FFNB 2CIKB 3MR9A 2AKRA 5JR1L 2XG5A 3H2WA 2R2BA 4L3CB 3DECA 1C5CH 1S7XB 3V4UL 4YIQB 4UTAH 4UT6H 3HR5B 2HJKB 5D96C 2VXUH 2BY3A 1VGKB 3RNQA 5TF1H 1RAMA 5CCKL 4JVUA 1KIUA 4M7JH 3P40A 2PYEB 3PHQA 2FZ3B 3NA4A 5CEXA 4J3VA 5F70A 3EZJB 2VXVH 5JDJA 1H8NA 2CDGA 2PTTB 1V05A 1Q9OB 2NY5C 4N90D 4D9QE 2YZ1A 5MEPA 4YQXL 5BVPL 2ED8A 3I3BA 3NIDF 4Y4FD 5EZIH 1CD9B 3FRPG 3S3JA 3SJVA 3WN5A 4BUHA 1S7SA 3BHBA 5FHAL 3HG1E 2EIEA 1CN4A 2IAMC 5IESH 4OIBA 4OZIE 3VXRB 4KJYA 3S4SG 5HJ3A 1OD9A 1W0YT 1EDQA 1OQOA 1U8HB 2NR6D 3LKRA 3QEGH 1FSKB 1JNJA 5DT1L 5IFAL 2FHBA 1RZKH 6FABL 1A7QL 1CCZA 5D7JD 5GGSA 3TFKD 4HKBA 2OZ4L 3IT8D 4HUXA 4Z77A 3Q6FA 3WNNA 4XWOD 4GXVL 4PJAA 3DV4A 2V5RA 3EDDA 3WJLA 5ELIA 3RZCB 3WL9B 1DBAL 3VRLE 1NPUA 2YC1B 1HZHL 1RUPL 2BSTA 4WI2A 2CR3A 4HAGA 3T77A 3Q6GL 3P77B 4PYHA 2JIXB 4JZOB 4MS8C 2B1AH 3S5LG 2DQEL 4ELMA 3V0WH 3CCHA 2I9TA 3V6OA 3V6FB 4UNUA 5F96H 3IKKA 2AJZB 5KSBA 4JRXA 5I8EA 1EVUA 1BGXL 5IW6B 5D7SH 1F11A 5JO5A 3QUKA 2A1WL 3WXVL 5HGBA 1HXMA 4PRHB 3ZZ1A 4V2BA 2FIKA 3ZYZA 4XCEB 1QSZA 3NA9H 1KCVL 1WCQA 2J8UF 3CSPA 1K8IA 4QXWA 2F53A 3IDXL 5B3JF 3IDIA 4RDQG 3MRFA 4N0FB 1EO7A 5ACLA 3QDGE 2EC9T 3IFNL 4P46B 1A6ZB 2HKFH 4CAGA 5INDA 4PD4J 4M9PA 1KPVB 1AXTL 4NN5C 4XAWH 4XZUA 1YEGL 4O2FB 1GZQA 1MFDL 5DJCA 3MRBB 2E27L 4E41D 4PJ8A 3TF7C 1YY8A 1TNNA 4NRZB 5IIEA 2X89A 4I0PA 5FUOL 3H7BA 2NW2A 4G8FB 3DI3B 5ABDE 2E7LC 1MELA 1NCDL 3RBSA 3V4PL 4HKZA 1T0NA 3LKPB 2Y7QB 4GG6A 3HKFA 1CLZL 2AJVH 1MJ8L 3TV3L 2FX8L 1AI1H 4XCYB 2HP4A 1TTFA 3T65B 4EJ1C 3UPRA 4FQCH 4QGYA 1BPVA 5DRWA 3W0WD 1SEQL 4NJAH 5D1ZC 1G7LA 1QOKA 3HCVA 3UJTH 4LSRL 3UTZA 2QQNH 5CJXA 1X5LA 2Z35B 1M71B 1GC1C 3P30L 5TH2B 5KN5B 2FGZA 4D3CH 5EU7C 2W9DL 3BPOC 4X7FC 4ENED 3ARXA 4Q9CA 4U6VL 4LLDA 4PJDE 1KN2H 2WZPD 1HI6A 1NGYA 4QOKA 4PG9A 3KPOA 3DYPA 1MFNA 5CUSL 5TQ0L 2R29L 5IFHH 1WT5A 1C5BH 3RBGA 2LU7A 5D6CB 1TPXB 1NMAL 1P69B 3HS0B 4JFPA 4WENB 3LS5H 4CMMA 3GSWA 2D31B 3S3SA 3MV7E 1I7TB 3PNWA 5FA3B 4HIIB 1GIGL 4F57L 2CMRH 2LU3A 1SHMA 4NWUH 4P3CH 2VC2L 4V2CB 3GO1L 4EDXB 1C7SA 1TJIH 1YDPA 2M8XA 3KXFB 2FBJH 3T4YB 4WO4A 3VWJB 5CJOL 5BRZB 2IFFH 1W72B 1SJVA 2NTFB 3KYKL 5ICYB 1KFAL 1IAIH 2OR7A 3VXME 5A2LH 5DQJB 4HKJB 5KVFL 1YJDH 3BRGC 3AS1A 1L4IA 4YBLC 3W5NA 3HB3C 4BQBA 1RZ8A 3RAJL 3T0XA 4EN3A 4JKKA 5D72H 2LAAA 2G5RA 1XEDA 2NW3B 3IDGB 4TUOB 2QTEA 3BZDA 4Q2ZB 1VFAA 4HLZG 5K9QG 3U6RA 1KJ2H 5IHUH 1PQZA 3FFCB 5DQDL 2DBJA 5KJRH 4OTXH 3MRPA 3V8OA 4Y16B 1E28B 3RFZC 1N26A 4XVJH 1MRDH 2VLJD 1NCWH 1KB9J 3EJYD 3CDGB 5FYLE 4CVWA 2CLZB 1FO0B 3IXTA 1G9ML 1P6FA 2KBGA 4PBXA 1U3HB 1QHPA 2M2DA 4KI5C 1CQKA 4NQXB 4HPOH 1L7IH 1P53A 3QRFM 4LKXB 1MHEB 1IRAY 4N0UB 4GRWH 1S7QB 5IHZB 5L6YH 2HWZH 5LQBH 1HDMA 1MRCL 2BHZA 1H5BA 4JY5H 5ID1B 1EZVY 5IQ7H 4UDTA 3RKDD 3BD5A 4UDUB 1F4HA 4DVBB 2CK0L 3QULA 5L9DL 2YD6A 3MLSL 4JQIL 3T8XB 3H9HA 5CILL 4NM8L 2IFGA 3TBYB 1D5IL 4G6KL 5HYSB 1EO5A 4HF5H 2HMID 4NNPH 1KLUB 1FG2B 2FO4B 1UYWH 3LQZB 4XWGL 4JJ5A 2EXYD 3B6SB 4R7NB 5E94A 4ZS7H 1NFDE 4IMKC 5E6YA 2ITDB 1OLLA 1LK3H 1HOCB 3HUJB 4PJAF 3VXRD 5ANMA 5JORB 1EHAA 2XRAH 2P7TA 1V3MA 2AV1B 4MAYD 2DLFH 4FFWC 5HYJE 5E9DB 5GRUL 3KLAA 4XRCB 1A6UL 5FF6B 4ELMF 5T3ZH 1ZLSH 5M95B 2WWMC 5HPMB 2YD8A 5GSVB 2H32H 1AQDA 1BF2A 4K8RL 5MI0B 4XMPL 2D2OA 5ADPL 2GJ6E 4I18A 3O6ML 4MCZA 4IDJL 3C6SB 5TE6L 1SBBA 1MWAL 2WUBH 2ORBL 2V7NA 3GNML 2Y36L 4XP1H 4Z7OE 4P2CG 1XGRA 2JIXD 4L29B 4WHTB 3ZHDA 4G6ML 3AUVA 4I5BA 1SEBB 3PJSA 4XNUL 2PF6A 1U8OA 5JOFA 4PR5A 3BP6B 3ME0A 5JMRA 2OTUA 3BDBA 1HSAA 3GSVA 4JO2H 3LVEA 4PRHD 2DWEA 1CLYH 4HGMA 1FYTD 3IKCB 1FHGA 5DWUL 1QBLH 2JK5A 1IC7L 3LQAH 2G60H 3QJHB 3RWDB 1ZLVK 2HAZA 3VFVA 3OX8A 3GBMH 3KPRB 3LS4L 4X9HA 3T0BA 5T1LB 3SE3C 2IH1A 3RGVA 1IAKA 1JMZA 1RK0B 5CD5D 5DJ6B 3MLPA 2VXTL 3ZMRA 5KVEH 2CO6B 5D5ME 2FECL 1JYNA 3ULVF 4G43A 4U1SB 1AHWB 4KMQA 1TVBA 3P73B 5T5NG 3O6LH 4XMLL 2H3NA 3ARDB 3ZO0A 1KJ3L 1O7VA 5JW5B 3GSUB 5IHBA 2QSTA 2R1WB 1FFQA 5GJTH 5HGGS 3TNNA 3UZVB 2CXKA 4I9WE 1JZ8A 2FB4H 2FHFA 2R1YA 3B43A 1T1YA 2OI9B 2XV6B 1ACZA 3TBSB 4YX2H 5MEQA 5BZDA 4DZBB 4LVNB 4K07A 4F33A 1KJ2A 1HKLH 4U1NB 4UB0L 1A1OA 2WLYA 2YXFA 2XKNA 4M9OA 4YO0A 1X6LA 4I0CC 2NY5H 5IOPB 4JFXA 2D7NA 1F3DJ 4GS7B 1PG7X 3QUXB 4UT7H 3IFLL 4A6YB 5E6IB 1MFCH 1K5NB 1FGVH 4NWTH 3GSRB 5CD3A 4PJGA 2PXYB 3EO9H 3N1FC 3RVXD 2RR3A 2XZAL 4QTIL 2YD7A 1XCTA 2NPLX 4OB5L 5ALBL 4H1LB 2GK0A 4OFYA 3CLFH 1W0WB 3F65A 3P4OB 4MYWB 5H2BA 4PLJC 4IMLB 4L8SB 4P59L 4KTDH 3VJ6B 1BFVH 3CFBB 3EKCA 2SEBA 3HI6L 2P49B 3K2UL 3D1MC 4O2CA 1R0AH 1Y18A 2VQ1B 3VGFA 5ENWB 3VWJD 3ZKSD 3QA3B 4E5XA 5LGJA 2DQJL 2FX9H 2V9RA 3MLYH 3O4LE 1I7UA 2KL6A 4ZPTB 5DC0A 3MRMA 4KQ3H 1RK1A 3GI9L 3QUMH 5IROA 4PUBH 1BWMA 1Q0YH 5HXMA 2HRLA 4MA1B 3V5DA 4Z7VE 2VLKB 2V9QA 1L0QA 2HFEB 4KZEH 3EO1A 4RAHA 3TO4C 3FRPA 4WFFD 4XHJC 3B83A 32C2A 1IKFL 3QIBA 4Q6YA 5C2BH 3SKMB 5EC2A 2E8ZA 3S4SA 3VXSD 4S1QH 4L4VA 4Y4HC 2R4SL 4HLZH 4U2ZA 2Z4QA 3MBEA 5LBSL 1QRND 3FO1B 4FTVB 4Y16D 3U4EB 1N6UA 2VE6A 5C09A 4HJGA 2VQUA 5LKNA 4UBDD 1J9CT 1EFXA 3WS3B 4HFWA 5TGBB 2H32A 1CGXA 3BP5B 3QIWC 3GMQB 4NO5A 1E4WH 1VB9A 3SE4C 5HDQL 3JBG7 1A6WH 3QCTL 1UEMA 1YMHA 1HYSD 1GZPB 2JJTA 1RUAH 3VD5A 5T1KA 4YHYB 3D18A 3GMRB 2R9HC 2V2TB 1AE6H 3FHAA 2DDQH 4LSUH 1BM3L 2A6KA 2Q8BL 1U93A 4LLQA 3JV6A 2VLRB 5IBUG 4K71B 1K4CB 3TPKA 4P5TB 2PW2B 2F58L 4WFGD 5J11B 4ZUUA 4NRXB 2C3WA 2ARJQ 2E7MA 2QV2A 3EYVA 3I9GH 3TH4T 1RUKL 2CKBH 2M26A 1X5AA 3Q3GB 3IJHA 4JLRA 1V7NL 3H3PL 1FZJA 1QR4A 5SWZB 2IANE 4KROC 3QDMA 3D2UA 2Q1EA 4R90H 2EDYA 5HTSA 1KGCE 1BFOA 4UT6L 4YXHH 3EW3B 3FO9A 1FFRA 3ARFC 4NIKB 3T3MF 5A3IC 3N50A 4QHKJ 1MHPL 3UROR 3UZEA 1J5OH 2YSSB 4AENA 4P4RB 4X4XB 4TTDC 5EIQA 4ZXBC 5C0AB 4M7JL 1X5FA 1WZ1H 4OCWH 3F6LA 4KPHH 2VOTA 4U1IA 3E3QC 4ZTOH 5E9DD 2VXVL 5T5FL 4NBZB 4QRUB 4EIGB 2YBRA 4QRTA 3ZKMD 5I1GH 3SQBA 1MVUB 4WFEE 4U1KA 2OCFD 3JTTA 2IQAB 4PJ7A 4F58H 3LY6A 1U8PB 3GDBA 1ETZA 2OXHA 4NFDA 3SO3C 3QEGL 3S37X 4JFHD 2EICA 3CPLB 3N06B 1JMXA 4LLYA 1OB1B 1WBZA 3H3KA 3DRQA 1X5IA 1I85A 1X44A 5C7XL 2EDFA 5FV1L 3RL2A 3FFDA 4WW1A 4NOBA 2EC8A 4MCYB 5FK9B 4N8VA 1FL6B 1UCBL 4G9FB 1DN0B 3QO1A 4NKIH 5A2IH 3L3DB 1S7TB 5DJYB 3U4AA 3GJEA 4ODWA 2WQ8A 2IBZX 4KUCD 3AS0A 3F8UB 3GHEH 2MQ0A 2IPKB 1UACH 1KN4H 1LO5A 5FKAA 3KPRD 4KXZH 1CE6B 1G7HB 2B1AL 2IAMA 2BOCB 1XF5A 3VFSB 3V0WL 5T1LD 4OFIA 3MLWH 3ARRA 1RU9H 2PTVA 4GRLC 5CZVH 4DGIL 3WMSA 2X1OA 1HCVA 5D7SL 1ZGLP 2MJWA 1UWXK 1OGAA 1GPOH 2DIJA 3CLEL 5SWSB 3NA9L 1KB9K 4P0DA 3ARDD 4MNHA 3U9UA 5KS9E 3ARZA 2HT4C 3SDXB 4HJ0D 4PJXF 5FYKH 3QUMA 5C07B 1NUDA 5GGTL 5J13C 1ZS8A 1I7ZA 2OXGA 5HHME 3I75A 3VXPB 1G0XA 3IJYA 4LL9A 5GS0L 1V8HA 4XAWL 1QSEE 1QRKA 2C4XA 1CL7H 1DQTA 1HXYB 1OP3H 1H3UA 1AC6A 1QO3B 3CDYA 4NKQB 3MJ7B 2WW8A 1Q1JH 2GTWB 4WU7A 3RVTD 1V5JA 2C3HA 2GI7A 1O7SA 3T0EB 2EE2A 3KPNB 2ICWI 5E6ID 5AD0B 5JNYA 3DGCR 5EZJB 3PHOA 2ID5A 1KNOA 3QP3A 1YNLH 2VAAB 1ZHBB 4QT5B 2BVEA 1PGRB 4FQCL 1CF8H 5E1HB 1JYXA 5HD8C 4QRRB 4H8WL 4NJAL 2QLVB 5HI4C 3REVA 1CU4L 4O4YL 2JJUA 5DMGC 5EBLB 5FDYA 2X05A 4K94L 5DDHA 3I2CH 3FONA 4LVHB 5E8DH 1WAAE 1L9NA 5DEGA 4D3CL 3VXUB 2R23B 5HYEA 1JK8B 5C6PB 2E7LA 4AM0A 4RIRB 3ILQD 4HUKB 1KN2L 4JO1H 4OFPA 4F7TB 5IB3A 3KPSD 3BPNC 2BVQA 3BMVA 3HZMA 3BW9B 3QDHA 3QIUB 1C5BL 3MOAH 2VLKD 4NHCL 4YXLH 1OAUH 1B0GA 5J4MA 3MV8B 2VWEE 2XWJA 3BAEL 3QUYB 2AAVA 2CMRL 1FQ9C 3O8XB 3NFPB 5D1ZA 4NWUL 4P3CL 1A3LH 5AWNH 4O02H 4LCYB 4F3FB 3QH3A 3G5ZA 5D2LE 1I9IH 3BKCH 1U8MA 3F5WB 1R5VA 3EO0A 2FBJL 4LQ1A 4OM0L 2C3VA 2IFFL 1QLRB 1AY1H 2QKIA 4HEME 1ZSDA 2EDBA 2RBLA 3C09C 3FT2A 4FTVD 2WNGA 3DUUB 3QG7L 3LD8C 4HUWA 3STZA 1J8HA 1ZVSA 3WIFA 1IAIL 1NKRA 3LHPH 4ISVA 4ONGH 1KIPA 4PJ9C 3KVQA 5AZEH 5ICZB 4XI5C 4ZQKB 5IVZA 3VFGH 3SGEI 2B2XH 1U58A 2QADB 2BVOA 4PV9B 4M1GH 4NQVB 5D72L 5CHNB 3ZKND 5JHDD 2FGWH 1W0VA 5LG1A 3SKUD 3B5GA 3O3AB 2VUOA 4MDJA 4PJCB 2NY6B 4UUJA 1OAKH 4U1LA 2JJWA 1A3RH 4P2QE 3MJ9H 5FYJH 3MGOB 1JI2A 5KJRL 2E7CA 2VLRD 4OTXL 2APWA 4F7CA 1XZ0A 1MRDL 5HHQB 1NCWL 2BCKA 4S11A 3ABZA 3V9FA 3R8QA 3TJHC 3W39A 1G0DA 5IB1B 2D0GA 1DQJA 2G2RB 4FXKA 1OARH 4J12A 3RWFA 5FDWB 4XCNA 4HPOL 5CINH 3FRUA 3RNKA 3U83A 1K4DA 1L7IL 5BXFB 2F74A 3TNMA 3PGDA 3WSQH 2ZUQB 3F7PC 1XGTB 4LEOB 3ZDXF 4NUGH 4YDJA 1BIHA 3KYMB 5L6YL 5LQBL 1DANT 4JY5L 1RD6A 2RCSL 1LO2H 4WTWA 4PJ7F 1BLNA 4WUUA 1KPRB 3IB4A 2BSRB 3MV9B 2IBBA 4OBSA 3VFTA 2A73B 4NQEA 1DUYA 4PJFE 4I2XB 3UBXG 4HF5L 2FBOJ 4NNPL 5D7IE 5FYLL 5L2KB 1W8OA 2QR0A 2VAJA 4PJHA 3CFCH 1DBBH 4ZS7L 1DEDA 3LPGA 5CSZB 4NC1E 3LH2H 1KYOJ 1XGPA 1N7MH 1Q9KA 3GB7A 2J8HA 3H9YA 1JWSB 3QXUA 2XRAL 3IU3A 2HKHH 2AERT 1AIFB 2VXSH 2DLFL 1IGTB 1AJ7H 5BQ7A 2EDDA 1S7RB 5ESVA 3ARGB 3I6KB 4HK0A 4HC1H 3WLWC 2GSIA 4TVPD 3HNVH 3L3OB 3P9MA 1I8KA 4QY8B 3J7HA 4XP9H 5I1JH 3V6ZB 1J0JA 1T21B 1R24B 3H3BC 2A9NH 4XP1L 5HDBE 5KVDH 4LOUD 1X7QA 4KGLA 3L9RB 4IMKA 4MHHI 3DX9A 3EGSA 4OFVA 1XF3B 3BX7C 4Z78A 4EEEA 2RIKA 1E4JA 3U7YL 1QA9B 2X5PA 3E6HB 4XXDA 3MJ8B 5T1MB 3HC0B 5DRZA 3NCBB 3TYGH 3BP7A 4HGKC 4JO2L 3IJSA 5HI5C 2XTJE 2PN5A 5IM7A 1RURH 4XNZC 4M4PA 1CLYL 1M1SA 3GSXA 3WNLA 5BVJA 4H0GA 3BPCA 1BIIB 3O9WC 4FXGB 4AZ8A 3RIFK 2GSGA 1ERNA 1QBLL 4Q9BA 3LQAL 2G60L 4QNPE 2HRPL 3GBML 4MA3A 4X98B 3RWGB 3OR7B 2BERA 3EDJA 1K2DA 1MSPA 2HLFC 2HJLB 2YPLE 1NUGA 5L8LB 4F2MA 5KVEL 1MHHB 4X7DC 4KRMB 1U8NA 2NY3B 5KSVB 2P5WD 3D3VA 1P7KA 2H9GB 4HIEB 1S9WA 3PWPA 3QNXB 1R3KB 4IRZH 3O6LL 4JVWA 1AGDA 1CFQA 5I1KH 4KK5D 5IK3A 1A6AA 3EJZC 4ZFOA 3BP4B 4X5WB 1R5IA 4ZO6A 3T0ED 3EFDL 4MJIB 4MMXC 4BFIA 3WIIH 3HHRB 4F7MB 4RAVA 2COQA 2BRQA 4HW6A 4JE4B 4CBPA 1GXEA 1S9KC 1ZT1A 1ZT7A 3SE3A 3PP3H 4V1DE 4YX2L 1B3JA 3TM6A 1G7PB 4PJBE 3DX6A 4QRRD 3MJGX 5I73C 2J8UB 5L88H 1HKLL 4GAYA 2W0FB 1G6RH 4OCMC 4KJQD 3BO8B 2NY5L 1WBYB 5EORH 5JW4N 1JYVA 2CDFB 3DI2B 1A21A 2YD9A 4UT7L 4W4OC 3MUY1 4Y5VC 1FNEA 3WHXA 4OGXL 4POYA 5DSCA 2P24A 4NWTL 4LCWB 5E99L 2FH6A 3EO9L 5JLZA 4I13B 2AP2A 1ZWIB 2KPNA 4PRPE 4JANA 3C08H 4YHMH 3P4NA 3K1DA 4PREA 1A9BA 4RISH 1RIUH 3L3JB 4FMKA 4LPCA 3CLFL 3MV8D 4LAQH 1EAJA 3BXNB 1MCHA 5JOPD 5JIIA 3QUYD 3CUPB 4R26L 4OCXH 3O8XD 5I2IB 1BFVL 1T0MA 4NGHL 4UQ2B 5EU3A 1U8KA 4R9HA 1JZ2A 1R0AL 2CGRH 2OQJA 1LNUB 3FQTA 4K55A 2ZUVA 1IMHC 2GW5A 2HMIC 4LPTA 4ZAKC 3MLYL 4OLVH 5EO1B 4KQ3L 1VEOA 1F4XH 1WVZA 5FKPB 4PUBL 3QSKB 1J12A 1Q0YL 4WW2A 3MLVL 4URTB 3TJEH 5HHOA 2OMBA 4XC3L 3ULUF 4UILH 4JCLA 2QADD 3RWHB 1VKXA 4JPIA 4MNGB 3TN0B 3OB0K 4CN4A 1ZA6B 1IL1A 4OZ4B 1EJ6A 5C2BL 4UTBH 2NY6D 2DIAA 3M1BA 4S1QL 3FB5A 2H45A 4QHMB 5F7WC 3NCJH 1FLRH 3RZCC 5I8CB 1CR9H 2CIIA 1A2YB 2IADB 4HC1A 1BQLH 3DVNA 3OG4B 2DM7A 4OZHE 1YUHB 2EKJA 1UVQB 5I75B 1Z3GH 5IBLC 2X9WA 5F7UA 3FB6A 1A6WL 4M48H 3HE6A 5GGSY 3PWNA 4JG0H 4HWEH 3MRIB 3VXTB 1IVLA 1ROWA 5FM5O 4LSUL 2FCBA 4QTHB 5IF0A 5MHSD 1C12B 3F58L 4JFOB 3QCVH 5IGXL 4JFFD 3RWIB 2FR4A 1GGYA 3CFEA 5CBEB 5IVXB 1D5MB 2XACC 2NY7H 3CU7A 4G9DB 1P4LB 5FUZH 3C5JB 3L7EB 3ZYOA 2CKBL 4LDEB 2ADIA 3ARBA 2V5TA 2EECA 3FO2A 3MRJB 2LTQB 3HRZA 4P46C 3QIWA 5GJSH 5L2KD 3QFJB 4KKLD 4R90L 2ZG2A 3SE4A 4P57B 5L2JA 2AKRB 1ORSA 4NFBA 3OG6B 2R2BB 4NRYB 3S35X 5FM5M 2ARWA 3NOIA 2IG2L 1J5OL 4N90E 2D4FA 1LWRA 3RNQB 3LEYH 4XBEH 2F15A 2Q86A 1WZ1L 2K1MA 1AR2A 4KPHL 2DI8A 3I3DA 3P3YA 4NQDD 4ZTOL 1GC1L 3PHQB 4FNLH 4J1UA 3LQMA 5CEXB 5E7BA 3HZVA 2Y06H 3F7QA 3MODH 4IDLA 4XPAL 2CDGB 5FXCH 5I1GL 3GIZH 1Z0MA 4WGVB 1MPAH 5MEPB 3SJVB 2R8SH 3TZVA 1S7SB 3WJJC 4RX4D 1J1PL 1CK0H 3ARFA 2AQ1A 3DYMA 5D7LA 5DVMA 3EOTH 3AAZA 3PXHA 4KJYB 4PGCA 5HJ3B 2VTFA 3VWKA 4F37K 1XFPA 3LKRB 4ZXBA 5AAMA 2DYPA 4YJZL 1I7RA 1NC4A 1AD9A 4ETQA 4K3DH 3C2AH 3U4BL 5GGSB 1G6RA 4HKBB 4HUXB 3BT2H 3Q6FB 1KPUA 1DLFH 4MJ5A 3HTLX 4PJAB 3DV4B 5D93B 5DHYA 2DS4A 1TPXC 4OV5A 2D9QB 3DV6A 3GHEL 3UJIL 4PRAA 3N9GH 4KKAD 1UACL 2BSTB 1KN4L 4AIXA 4Z5RA 3T77B 3RUGE 5BOPA 1MCOH 3HI1A 4ELMB 3CCHB 1RU9L 4POZC 3BEVA 1ZLUH 2I9TB 4BUGA 4FQQA 3DO3A 4JRXB 5I8EB 1GPOL 2HT3D 1F11B 3O6FC 3OAYK 5JO5B 3QUKB 3C5ZC 5I1DA 5HGBB 1HXMB 5JXEA 2DKUA 4Z7QF 3TO2A 3U0TB 3WIHH 2FIKB 5IT2H 5FYKL 3SDYL 4Y1AA 1K8IB 2J8OA 4NQSA 5GGRA 2F53B 4MJID 3IDIB 4GW4A 3MRFB 4E41E 4X6CA 3G9AB 3MUJA 4WHYG 5DI8A 4R96A 3IAGC 5E2UH 1VFOA 5EIIA 5INDB 4DTGH 5I19H 3N85H 4X0KB 5BCAA 5I74B 3V8CA 4GRLA 4XZUB 3CSYA 4U3CA 1CL7L 1GZQB 5HYFA 4OM1L 5DJCB 4EOWH 3AXLA 3AC0A 3RJDA 3SE8H 2F5AH 4QEGA 4P9HC 4RZCA 1N5AA 1Q1JL 3CMOL 4PJ8B 4GAJH 3RY6C 1YY8B 3B9KC 3PV6A 5IIEB 4I0PB 1U3HC 5C0GA 1KB5H 3H7BB 4P2YA 2NW2B 3W0WE 2H2PD 1G0YR 3MLXH 4XC1H 4HKZB 1T0NB 1YC8A 5E5UB 3ZDZF 3WS6C 3PG2A 1P7QA 1YNLL 4OV6F 5GHWH 1R3JA 1KYOK 3JWOC 4RGNC 1WWBX 1CF8L 3AREC 2UZXB 4FQLH 3UPRB 3KYOB 3MROA 1OP9A 4WW2F 5D6DC 5DRWB 2EZ0D 1G7LB 2IH3A 2CRIA 3HCVB 4A2MA 5KSAD 4DN3H 4ZODA 1FZMA 5E8DL 4TTGA 4I48A 2J3SA 3UTZB 1GL4B 4B5EA 3BN9C 1XH3A 3O0RH 2X4RA 1BREA 4JO1L 3E0GA 4R2GC 2MHAA 5FHBH 5CEYA 1NGZA 4Q9QH 1HI6B 1NGYB 2QQLL 4LRIC 4PG9B 5DJXA 3KPOB 4YXLL 3OHXA 3NPZB 4QXGH 3RWEA 4Q0XL 1AR1C 1TTGA 4X6DA 4L8CA 3L5WA 4YDKH 4CMMB 4JFPB 1G1YA 3GSWB 3TN0D 1CS6A 1CBVH 4NNYA 1A3LL 4YDLC 4O02L 4S0SD 3WFZA 1U6AH 1I9IL 3AU1A 3BKCL 2AXJA 4ODSH 5JPNA 3O45A 1RULH 5T1DH 1CVSC 1R5WA 3FAXA 5ALCH 3O2VH 1YDPB 5CZKA 4FP8L 1H8OA 4CKVX 4DJMA 2DL9A 2B20A 5E08H 3LHPL 4LSQL 2BXZA 4ONGL 3WFEL 5AZEL 2DLGA 4KDTC 5J0BA 3D69A 3OKYA 3SO5A 1EJOH 1MCFA 1ZHNB 3JV5A 4OCRL 4HS6B 2KZWA 2VLMD 4RA3A 1DE4A 1RZ8B 2VLJE 4EN3B 1KJMA 2OLDA 4MXWH 4X99A 5SX5H 4Y89A 3VG0H 1OAKL 1MJ7H 3G6AA 1TTUA 1VFAB 3U6RB 1A3RL 5FYJL 3MJ9L 1UM6H 2IGFH 1X4XA 2P45B 1PQZB 1QFWH 1MEXL 3MRPB 2XTLA 4YHZH 1FNSH 4ZUSA 1D9KC 5LXGH 1KBGH 5E4EC 5GXBB 3V5HA 3R1GH 5EOQH 1OARL 1CI5A 3IXTB 5GSRA 3DSFH 5CINL 1IC1A 2HFGL 4HSQA 1F4WH 3WSQL 5MENA 2EC9U 4KDWA 1NMCB 1OTTC 5I1HH 3DETC 1MIEL 1M6OA 4NUGL 2VDQH 1NGWA 4W70A 3NCYP 4XX1E 3BVNA 4NNXA 5D71L 3T3PF 5SWQA 1LO2L 1HDMB 1H5BB 2FECI 2R2HA 5EU6A 4UDTB 3GSOA 4JFEA 3DXAA 3JVGA 3SY0A 4W6WB 3H0TA 3GRWL 1CZ8L 5E5MB 3QULB 1YNKH 3VXRE 1R3LA 3H9HB 3NPSB 3WIHA 4J4PC 1QQDA 2DN7A 4OLWL 4BYHA 3O11A 3SJVD 1DBBL 4N5ED 2OI9C 3LH2L 2XOTA 4JJ5B 1N7ML 3G6JA 1VFUA 5E94B 4DZ8A 4DGVH 4YC2C 3T2PA 4Z7UE 5FUCE 5ANMB 4YFLF 4CRPA 1AD0A 4KWUA 2VXSL 5HYSG 2JJSC 1HSBA 1ZV5A 3V0AC 1AJ7L 3BN3B 1CFNA 4NT6A 2H2SC 3RVTC 2X1WL 3SBWA 5KANI 4ZYKA 3O3UN 3QUXC 3OKNA 4HC1L 3KLAB 4M62L 2VDNH 3DBXA 4KVNH 1EO8H 5CWSB 1A4KA 2B5IB 4M6NH 1OPGH 5LGHH 5J12B 3KYAA 4C54A 2PXYC 1KB5A 5JZ7D 1AQDB 3TT1H 4XP9L 1BBDH 5I1JL 4IHOA 1GGCH 1WZKA 1A5FH 5KVDL 1DDHA 2EYRA 4I18B 4TOYH 3QBTB 4K7PY 4MCZB 1GRWA 2AEWA 2F9BT 2V7NB 5F3BA 4PRHE 4KK8D 1XGRB 4RGOL 4HH8A 1FYTE 1XT5A 4I5BB 3PJSB 2R0WH 1RMFH 5FOJA 1U8OB 5DJAA 1LEIA 3ET9F 5JOFB 4X6CF 4PR5B 3TYGL 4JRXD 3ILQC 4M7ZC 2OTUB 3GUTA 5FGRA 1HSAB 3GSVB 1QFHA 1F8TH 1RJCA 3BWAA 4NHUA 4ODHL 2DQTH 3G5VA 5BZWA 2DWEB 3RTQD 1IAIM 3EOBA 1UKQA 5C08A 1RZIA 2JK5B 4ZUWA 2F53D 3VFVB 1BJ1J 1TVDA 2R2EA 3OX8B 1JZ5A 4R4FH 3NZ8A 4YFLI 2IH1B 3RGVB 3LAFA 1IAKB 4U7MA 2BNQD 1S7WA 5I71C 4G80A 4WHYH 3BH8A 3GSQA 5EO9A 5DYOA 1AO7A 4G43B 2I07A 4IRZL 4UT9L 5GPRA 2AVGA 1TVBB 4X7TA 3RGHA 3PF2A 5E5RB 1EGJL 4MA8H 5GZND 5IEKA 1LE9A 5I1KL 4WFHD 4M3JA 4PJ8D 3OJVC 5IJKC 4I0PD 2A77H 4U3HA 5E56A 4WTZA 3TA3A 3O9WA 4HQQH 3WIIL 4LP5A 4YHYC 4LVOC 3TNNB 4E0RA 2R1YB 3GMPA 1CGTA 2IMMA 1EZVX 1MCPH 1T1YB 3JWDC 1FNFA 4OCNC 4YPGA 1MCWM 5BZDB 5MEQB 3GJFK 4P5TC 4H20H 5L88L 5J11C 4HIJA 4CL7A 5C3LD 5D8JH 4F33B 1G6RL 5ILTH 1KJ2B 4GBXD 4PJXB 1J0HA 5GRVK 1A1OB 5EORL 1JZ3A 2F5BH 3H9SB 4HEPG 2XKNB 4YO0B 4HWZA 2Z8RA 4JFXB 2Y6SC 1F5WA 3MRRA 2NCMA 1KT2A 3QNZA 5IEHA 1RFDH 5CD3B 3O3DB 3C08L 4QOKD 3LB6C 4YHML 1PY4A 4X4MA 1ONQA 4WI7A 4RISL 2XXMB 3IFOA 1DBKH 2GK0B 3QDAA 4OCXL 5H2BB 1C16A 2VIRA 3OAYH 4YHLL 2CGRL 2YUVA 2SEBB 1T2JA 4Z7WA 3D25A 4O2CB 1M05A 1JTOA 1Y18B 4NQCA 3PABA 3C6LA 2J6EH 1S5HA 2IPTH 4WFFE 2ITCB 4WO4D 3EHBD 4NZDA 2VZUA 1F4XL 3QQ3B 4E5XB 4W4OA 5LGJB 4H1LG 4Y5VA 1KOAA 3JUZA 1I7UB 3TP4A 3W9DB 3MRMB 1RK1B 1EEUA 5JMOC 3TJEL 2APFA 1DCLA 3VXSE 1VGKA 3V5DB 3L1OL 4F9PC 4NO3A 1JPSH 2FD6H 4TRPH 1QRNE 1URLA 1CIDA 4WJ5A 3EO1B 2B1HH 4EN3D 1I8LC 2NZ9D 1LDSA 1YPZE 3VRLF 4IOFD 2MOVA 32C2B 1OVZA 5L8KB 3QIBB 1PX3A 2GHWB 3SDAC 2VXQH 2PTTA 2K7PA 5EC2B 3S4SB 3REWA 1VSCA 3NCJL 4L4VB 5GRJH 1F02I 3MBEB 4ZFFA <