4GAJH

Structure of the broadly neutralizing antibody ap33 in complex with its hcv epitope (e2 residues 411-424)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
209
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDTSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTRALIZING ANTIBODY AP33 HEAVY CHAIN
publication title Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 209
sequence length 217
ec nomenclature
pdb deposition date 2012-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gajH02
1MLBB 5HDQH 4NBZB 4X80H 2W91A 5KVEH 4KY1H 2NMSA 4Y5VC 1FZKA 1LO3H 4OV6F 1EO7A 4PYHA 2HKFH 3HG1B 1ZS8B 2EYRA 3GKZA 5ENWB 1S7WA 4P3CH 2YD7A 5E8PB 1Q9LB 1GZQB 1ZT7A 1C5BH 3F7VA 4IOIA 2EXWC 5HHNA 1DFBH 3RWJA 4FA8A 3F12A 3NZHL 5SX4I 1BIIB 3D85D 1V7NH 1GOGA 4LCWB 1G7IB 3IDNA 1MCNA 3SKNA 5I17A 4OF3A 2DL9A 3QWRD 3TJEL 1OGTA 4DAGL 1CN4A 4OF6A 3CZFA 3P9MB 2DF3A 3UYOD 2JCCF 3DRTA 4J12A 4UDUB 5L9DL 1G9ML 4MYWB 2DS4A 4OV5B 3B2UC 3QIBC 3DI3B 1Y18B 2BSSB 3IKCB 5J57B 1FNFA 4G8FA 5HDBE 3PXJA 2OTWA 4ZUSB 3CSYA 2KL6A 2F5AH 3D0LA 2LQRA 3MRRA 1NCCL 1OAXH 3MRDB 3ROLA 3O6FA 3MCKA 5BQ7A 4PLKD 2PTTA 4MDIA 1DR9A 2ICWI 3SJVE 1QR1B 4HD9A 1YNTB 2F53D 4LPXA 2FLBT 3AU1B 4I0PD 5DTFA 5KOMC 4JKWA 1S7XA 2ADGB 4OZFH 2QKIA 2NW3B 4EN3A 4DKAA 4NKMB 1W0VA 3MO1A 4X7CC 1NFDF 3UTPE 3DSFH 1R24A 4CU6A 5AAWA 1RHFA 4L3EA 1OD9A 4PRIE 3CXHJ 4OM1H 1CFSA 1DTUA 1BEYL 4U1KA 2A9NL 2PUQT 3P40A 2HLFC 2ZKHL 3T8XB 4Y5VA 2DJ4A 4OLVH 4NO0A 1JHLL 4LPTA 3T4AA 5CIPB 5ADPH 5JQ6L 1MCWM 4I18C 5HI3C 4JFFD 5JHDB 1J86A 1I1AC 1U92B 4PJ5D 4YXLH 5SWZA 5HVHB 1IM9D 4XVUC 1JN6A 4LPYA 2FL5B 3QDGA 4LOUD 4NUGH 1Q1JL 4LLDA 4M4RA 2OM5A 1ZE3C 3HE6D 4KC3B 4LLYA 3F8UB 4YIQA 1GGCL 3CX2A 3FB8B 1JZ6A 4LHJB 4QY8B 1J0ZA 1EXUA 3E6FB 5C0EB 5KSBF 3V95A 4PGJA 2Z93B 5EPMB 2R4SH 1RY7B 3STZB 2UZYB 1SMAA 1XGYH 3KPMA 3V7MA 1P4BH 3QUXA 3RWIB 1K85A 3WV0A 3GNMH 2BP3A 3SOBL 5D5MA 1XGRA 1L9MA 3RVXC 3JVGC 4XP9H 2NY7L 4JO4H 1BREA 5DK0B 4C4KO 2J4WH 1UZ8B 4PLOB 5CCKL 1BQHB 3CXDH 2Z92B 3PWPD 1ZA6B 3BPOB 3QUMB 4W6XB 5F7MC 5BRZE 4Q6IC 1UVQA 3O2DL 3SN6N 3ARFC 4ZAKC 3MC0A 5EU4B 1UM5H 1WWCA 5IJVB 3VXMA 3QIWB 1MJUH 3TBWA 4NRXB 4JFDD 3ZDZF 3QNYB 4CRPA 3CZJA 5IEKB 5ISZE 1J8HB 1DDHB 1U8HA 2DKUA 4FQIL 1KNOB 2WLYA 2GK0A 1WCBB 3ABZA 1NQBA 5D1XB 5CJQL 3DX7B 5E2JA 2XWJA 5DJ6A 5KW9L 3Q3GA 5DQJA 5J11B 3S36H 5ETUA 4AT6A 4DZBA 1CD0A 1F6LL 3P30H 4G7YL 1K3ZA 4NN6B 4FABH 2JIXD 4ZPVB 5HYQA 3U7AA 3DVNA 4GW4B 1DCLA 2PR4L 3BE1H 1HH6A 3VRIA 5CEZH 1I4FB 3DOSA 1FAIH 4G42A 4I18A 4IRJB 2BSED 3MZTA 1YY8B 4PV9B 1RV6X 1L0QA 1MRFL 4KK9D 2AQ3A 3NIFF 4K23H 5GJTH 1I1FA 5EBMA 2UYLB 1VPOH 4X7SL 3UC0L 4HZLA 3UJJH 5BO1H 4RFEB 1B4JL 1XH3A 2DWDB 4G9FB 1T6VN 3ESVF 1DQJB 5A3IC 2W60B 3ILQC 4MNQA 2F19L 1LO2L 1AD9B 1XF2A 1D5BA 4KJPD 2YEZA 5IT2H 2WUCH 5D8JL 1SHMA 3QRFM 2VZTA 1YEFL 3CFCL 1WFTA 4L4TE 3MLYL 5C9KA 1BM3H 4LNRB 1KEML 5AZEL 1TDQA 1J0KA 1RI8A 4RNRA 4XNXH 4BZ1H 2VKWA 4YAQA 1KEGL 4Q6IA 5F44A 3ARFA 4ZAKA 4ZPTB 4FQXD 2AEWA 3HFML 3EYUH 4Z7WA 3BWAA 5IW1A 2VZUA 1CL7H 5JUEL 2BOBA 5KSAD 4JPWH 3QT2A 4QHKJ 3KPRB 5TQ0L 1YYMH 2M8XA 5B4MD 5A1AA 4KZDH 4NZUH 3BP4B 4X6BA 4YHPA 4FQQA 5TE6H 4N8VB 1B6DA 3T0EE 43C9B 4EI5B 1RZJC 1YEDB 2HAZA 2ZOKB 7FABL 1REIA 2GCYA 4LSPH 1XCQB 4S1DD 5E56A 3TBTB 3LD8B 5D7IA 3WLBB 5GRJH 1Z5LB 2GAZA 4NO3B 2VDOL 2A1WH 3TO4C 4JO2H 4GUPA 1FYTD 1P7KB 1KXQE 1FPTL 4QRRB 3NPSC 3CK0L 5DFVD 2GT9B 4FTVA 1DVFC 1HHKB 4OD3L 1OAYL 4MWFA 5E00A 1ZLUH 1G7HA 1MIEH 3VFGL 1NKRA 3QEGL 1IGYB 5L2JA 1WLHA 2JK5B 3U0WH 1T03L 4MQ7A 4C58B 5DS8B 3ZKNC 3IDIA 3SDYL 3CPLB 4LQ1A 2W9LA 3VFWB 4GKNA 1IT9L 3MRCB 4Y5XC 5E8OA 4PV8B 4HK3N 4OUUB 1DZBA 3VXUE 3UX9B 3DV4A 4H1LH 3UYPA 1XR9A 3TT3L 1FFPA 3LKPA 1GGIL 2EDBA 4D3CH 3QR2A 4KKCD 3GFUA 2J88L 4I3RH 5EC1B 1FLRL 3WFCH 2R29H 1EBAA 4HC1L 4R4FH 1EUUA 3S35X 3H7BA 1KB5H 5T3XD 1H5BC 2HJLB 4XNYH 1MF2H 4HJGB 5TJWK 1ZOXA 2V2WA 2IQ9H 5TF1H 3EFFA 1VADA 5CZXD 1LO0L 4FP8L 4K8RH 1JHKL 1CDBA 1FRGL 3LKRA 4JG1H 2WQRA 5SWQA 2YPLE 4U3XA 4M5YH 4JRYB 2H8PA 1OP9A 5EIQA 3ZSTA 4EUPG 3WMSA 4JFED 4Z6AT 1TQCC 3EKCA 5EDXA 4D9RD 4XPGL 3PWJB 4HUXA 3EOAB 5E6YA 4J3VA 4ZNCD 1RZJL 4LEOB 3VFNB 4TNVF 3G5XA 3MV7A 1Z6JT 4JRXB 1KIUA 2DWEA 5D71H 1AP2B 4K7FA 1NEZG 2UZXB 1CVSC 3MV01 5C0CD 3OQ3B 1XF4B 4GW5A 4XHQA 1QRKA 4PJ9D 1BOGA 1W72A 4XC1L 1XCTB 4NIKB 3PWLB 1TJIL 3PGCB 5J6GA 1J1OH 5F7DA 1MCSA 4PJDF 1T21B 1F3JB 2EDKA 4LGPB 1A6WL 3VRJB 2GJ6A 3H0TA 4ZNEE 2RFXA 3TO4A 3HZMA 1F3DJ 3VI4F 4LPVA 1JMZA 1GOHA 4HWBH 5CJXC 3RWCA 1YNLL 2A6IB 3MJ9A 3O0RL 4MD0B 3BDBA 2XACC 2VAJA 1KXVC 2DI7A 1EVUA 2VIRB 3GSNL 2AEPH 1FAKT 3EDKA 5JXAL 4EOWH 4HH8A 2ICEA 2VR4A 5E8NB 4LCUB 5F6IB 2X10A 2AK4E 5C71A 2FJFA 4ODUA 2ATPA 4FQ2H 1NL0L 1M7DA 3MJGX 3LN5A 4HWEL 4WWKD 4L8DA 2CLRA 3C6LD 1XIWD 2XZQL 3WS3A 4KRMB 4OB5L 4NQEB 2IBGA 1NGPH 2IGFH 1OTUD 3D2UD 4R2GD 4QXGH 4J8RB 2CKBL 4U0QB 2CK0H 2AK1H 1T04B 3OGCA 3UPRB 5DXWA 4LARL 3OKNB 2Z91A 3WSQH 2GYSA 1JNHB 5BV7L 4QHUA 3VWJD 2ZZUT 4JY5H 1AIFB 3MFFA 4ZDHA 4JGMA 4WFFE 3TZVB 3QDMB 2CKBA 2UZIH 4LLVB 1RJYB 4HEPG 4NPYA 1UXSB 3MLPA 2YK1H 3D39D 4FQJL 3L3DB 1DUZB 4H88H 4RAUA 1N3NB 3TVMD 1ORSA 4BKLB 3EYSL 3FL7A 1NDMB 3EDFA 3QH3B 1ROWA 1ZMYA 1WBZB 3FB5B 4UT7H 1VGKB 1PG7L 4OZGA 4X6DB 5FXCH 3BPNB 3ARRA 1K9TA 2XG5A 1OD7A 2AV1A 1JTOA 4LU5L 3R1GH 1G6RA 4MAYB 4NBYB 1GH7A 5C0AD 4BM7A 1JPGA 2ESVB 1KCSH 5KSAC 3OGOE 4XXDB 4OZHE 2WQ8A 3W0WA 2AS5M 5DJ2B 1MWAL 4XHJD 5D6DC 5CJXA 1FZOB 4YLQT 5DD0H 8FABA 5GRVL 1OQOA 4WHTB 3FFCB 4X6EB 4Y88A 3WIHH 4V1DD 5JDJA 5TFSL 2DM4A 1UEYA 1JV5A 2KBGA 4HG4K 2A6KA 5L88L 4S1SH 2WZPD 3SGJA 2JE8A 4P48A 5TDNA 1MWAA 2D7MA 1YMMB 2P5EA 1FL3B 1OM3L 2VC2L 4XZUB 3THMH 2BJMH 2AV7B 2BVQA 2EDTA 5D72H 3WXWH 4P9MH 1MFBH 1BFVH 3N1GC 5C0NC 1UWEL 5SX4H 4G6ML 3CX5J 5DHXB 5IW6B 3R0MA 1QBMH 4P4KD 1U91A 2NXYB 1MRCH 5C08D 2Z8SA 4GAGL 2CO7B 4OD1L 4JFZL 4A6YH 4WCYL 3EBAA 1A3RH 2HVJA 4OZIE 3LVEA 5FCUH 1UZ6E 1ZVSA 5EO0B 5JTWA 1U8PB 2R2EA 1WGOA 2H1PL 3MXWH 5GJSH 4JLRA 5KVDL 1D9KD 1PKQE 4NKOA 1BPVA 2EKSB 4ONGL 1EDQA 2I07B 4UNTA 4P2QB 1FHGA 5C0FB 1T89A 3F5WB 5TDOB 1MI5A 2R69H 3IGAA 4LVNB 2OX5A 5B38B 2Y7QA 1OSPL 2HG5A 3VFOA 1JGVL 3JUYA 1EHAA 4PUBH 5IQ9A 1YDPB 1BVZA 2ZCLH 2DLTA 2ZSWA 2GFBA 4LVEA 4QOKE 2GSIB 2D7NA 1BWWA 1FVEB 3TNNB 2Q3ZA 4IM8A 5BZDA 5CGTA 4B0MM 1SYSB 3HS0A 1X7QB 3RRQA 2XN9B 3AMKA 3CLFL 3FAWA 1EHXA 3UTSB 3F7RA 5HDOA 2FBJH 4E42A 4EQ3A 5DD3H 5DJ8B 5D6DA 5J9PB 1CFQA 2Q6WB 4IHOA 4Z9KB 2NX5D 3TGXA 4JR9H 1BAFL 4M6ML 3S3SA 2CXKA 4NQCE 3ULUD 2DLHA 2HFGH 4ONFL 1SEBA 1XZ0B 4P23A 3RKDC 1T22A 4WEMB 1WZKA 4GXUM 2H2SD 4JANA 4DGIL 4RIRB 3D3VA 3RBGA 4CAGA 3UTQB 2X4SA 3CD4A 4G80B 5BW7A 3KPSA 3AREB 4M48L 1WVZA 3WJLA 4U3HA 5GRYA 3I6KA 4LHUD 2VLME 1DLFL 2AJ3A 2AJSH 4CMMA 4ZFZA 1X3DA 1I3UA 1SM3L 2EIZA 2F9BT 3T0VA 4WUKL 2WW8A 4HWNA 1IC4L 2F54D 4KK5D 5T3XL 5GGSY 1Z0MA 2EICA 1B3JA 3IF1A 2DQCL 3NACL 3IDUA 4K94H 3TFKD 1WZLA 3DX8A 2E7LA 4LP5A 4G7VL 4WWKC 3VGHA 4NWUH 3BGFB 4XP1H 1FFNA 4JM2C 5HYSG 3MGTB 1XIWC 5CEZE 4MA3A 1HKLH 1MIML 1DBML 5IVXE 1J1PH 2XRAL 3ECBA 2AXGA 1CICD 4RAVA 4DKEH 4NNYA 4DFIA 1AHWC 3HI5L 5IQ7H 3NA9H 3BRDA 4ZOCA 2CRZA 1O7SA 4PRPD 2VAAB 5F1NB 5HGHB 1E6OH 2ZNWA 1JYVA 3FMGL 3HZVA 3MA9L 3O4OB 1EERB 5CILL 1CGYA 3K80A 4JPVL 5CHNB 2CSPA 5IVNA 3C60B 4Z7UB 3GMLA 1A1MA 4KTDH 2MQCA 1BLNB 2X4NB 4POZD 5LQBL 4EDWL 1A6TB 3ZT6A 3E8UL 1TVHB 5CD3A 3HCVB 5EOQH 4YHML 3VGDA 4XBEL 5T33L 1P7QB 1G7MA 1IVLA 5HDLA 1IKFL 3IJYB 5JDSA 5CLWA 3RU8H 1NC2D 2VERN 3FO1A 1JUFB 4OCYL 4KMLB 3T0XA 1A1NA 3BSZL 5IMMB 1U8OA 2XTLA 4I9WD 2A6DB 5FECB 3JSSA 2NY2D 5IB3B 2FEDD 3IU4L 5B8CB 2LU4A 1HIMH 1YYLL 2NXZD 3AS0A 4HBCH 1VEPA 4R3SB 1LHZA 5I16A 3BD3A 2EDYA 1LE5A 1ODAA 3ZT5A 2JJTC 1RUQL 3QJFA 3B2VH 3NH7H 3SDDC 1TPXB 5I18L 2QQLH 4ZFOB 4RA0C 3RIAF 1XF1A 2XZAH 2J8HA 4MD4B 3ETBF 4X4YB 1PX3A 2HJFA 4XNQA 2OMNA 1A1OB 2YBRB 3ARDB 5DWUL 2XTJB 2ZUYA 5D5MF 4JM2A 1K8IB 1RUKL 5I1GL 5KJRH 4JREB 7CGTA 2XXMB 3OKKB 1IAIH 5IB5A 2NY4B 5F9JA 4WW2C 1R5VB 3BRGC 1CLZL 2EE3A 2UY6A 1VFBA 4U0RB 2ADIB 5EIIA 1F4XL 4OF8A 2P44B 5MERA 1WFOA 1RIUH 3M1BB 4K3DL 5EZIL 3ES6A 1D9KC 4NN5B 1BIHA 4O58L 1R5WB 3CJJA 5DZLA 4CNIA 3KLAA 2AXHA 5E2VH 3QG7L 5E2TH 1DLHA 3B83A 4M1DL 4MQTB 4DQOL 3V79C 4L29A 2VDNL 1I7RB 5FK9A 4LLAA 1YEGL 4Z7QF 2BOCA 3QEQB 4I0CC 4OGXH 3VD3A 4DOHB 1ZSDA 2OP4L 4C54A 5GXBB 4XWOD 3MRJA 4LQFH 4ZFFA 4CMHB 4Q58C 3QSKB 1LO4H 4DWHA 4QXUH 1Q0XL 3WUWA 1BVKB 3OHXB 4WY7L 5SWSB 4V2BA 2FD6H 1X5GA 3IFLL 3KWWB 1UQSB 2VDPL 2C5DC 5FUZL 3IRZA 3RY4A 4X7FC 3ULUC 4YXHH 4G8GB 2XQYK 4JAMA 1TCRB 2A73B 3MRLB 4MD5A 3HUJE 2H2SC 4PRNB 2IAMC 2O61B 1JF1A 1FGVL 1KJVB 2B1HL 3H3BC 2IG2L 4NP4L 1JBJA 1JI2A 2PW2B 3L5JA 3QCVH 3PE9A 3IDXL 3HG1D 2C7UA 3U2SA 1ES0A 4M4PA 5AEAA 5I1DB 1LK2A 2EEBA 2IMNA 3VGGA 2L7UA 3O8XB 3WIIL 3RIFF 2X89A 1CXLA 2ADJB 2ID5A 4CW1A 1EMTH 3DGGB 2C1OB 1HQRA 2R4RH 1K4CA 5ALCL 3QPQD 3DUUA 2VITA 1A7PH 3FFDB 4WW2A 3OB0K 3QXVA 3O45A 4X5XB 3SE4A 4G3YL 4DW2H 1CDJA 1A3LL 5C0DA 4XH2B 3UTTA 1CCZA 4DEPC 4KI1A 4U1MB 4Z7WF 2BCKB 4N8CL 1I1YA 3QI9C 4PYGA 2YD8A 3QQ4A 2P48B 2R23A 1RULH 4GH7B 4IDLA 5D7LB 3QUXD 2H6PA 4L8SC 4UILL 1I9RH 3RUGF 4KVCH 5C92A 1T20A 5I8CA 3T4YA 2VL4A 4PTUB 4CADB 4MSWB 2ZUTA 1C08B 2FZ3B 2HWZL 3ULVF 3I2CH 1ADQL 3VG9B 1IARB 1HZHH 4MNGA 1CGXA 1U8NB 1NCBL 3HRZA 1QHPA 4JFQA 3X3GH 1KB9K 2BVOA 1EFXA 3MOBL 5DQDH 2ZCHH 3VD7A 4LDOB 3ULUL 2OZ4A 4Q9CA 3MLRL 5DI8B 3SHSA 4FQHB 2LAGB 1JZ7A 3T77A 4P3WA 4JKMA 2WAHA 1ED3A 1ADQA 4C56A 3WD5H 1AGFB 4IIQB 2VL5B 3TBVB 3OSKA 4JKPL 1UJ3C 4NHUA 3CU1A 1IC5H 3LRSA 1U8JB 4AMKH 1AGBA 3E2HC 1U42A 1QEWB 4FXLA 3NAAL 4NQDB 4UV7H 4YFLI 5DJXA 4GG6A 4WJ5B 4LLWA 4TYUA 4XBGB 2V7HB 3MRKB 3NTCL 1NGWB 3NFSH 3ARGC 4PR5B 2E5EA 2LU3A 4DVBB 2X7LA 3EFDH 5IG7B 2NY2C 2NPLX 5DT1L 1HI6B 4Z7OE 2V2TB 3BUYA 3A0OA 5AYUH 2J8UA 4PJFA 5JHDD 4HHAB 2WBJB 4M6OL 1K3IA 1KPRA 2NXZC 1Q72H 4PJEB 3I3BA 3CFBB 1NBZB 3VXPA 3UZVB 1KENL 1V5JA 1TVDA 3D18B 3IXTA 4PJGF 4AEHL 4XRCB 4M9PA 4Y19E 5EZOH 4TUKL 5ICXB 5JLZB 5E2UL 1BQLL 4PRBA 1YC8A 1RIVL 5FYJL 1P4LA 5J12B 3V6FA 4NRYA 3V5HA 4NNXB 5JMRA 3ARQA 3PP3K 4FXKA 4YBQC 3X11B 1RZ7L 1JYNA 3OXSB 1NFDE 4HV8A 1FG2B 4RGOL 4NJAL 1JL8A 3MA7A 5E8DH 3MV9E 5I15L 4ODTH 4YDLC 5DJAA 3TLRA 5I9QC 3G6JA 4WVRA 2A83A 4F7MA 2FH6A 1OP3K 5F3BB 4NQUA 3GJFH 4Y4KB 4ETQA 3EO9H 2FO4B 1HHGB 2CDEB 1J8HD 3AS1A 2DQFB 4OTXH 4APQC 2BHZA 5T3ZD 4JO3H 5D7KE 2Z31D 4L4VA 1D6EB 5D1QA 4AJ0A 5D1XD 3MUGA 3B6SB 1XF3B 2CRMA 5F1KC 3EOBB 3HNSL 1UACL 1KELL 5E99H 5K9OA 2APWA 4DCQA 1FSKC 4XWOC 5IGXL 3CH1A 2A6JA 3VD5A 3LQZB 3HNTL 5ELIA 1WBYA 2P46B 3FQWB 3P9LB 2XKNA 3G08B 1UJTA 4ZTPL 2Y06H 1OT1A 3UROR 2M26A 5DJDA 1P2CB 2PTVA 5I1CL 2MPAL 3MQIA 4IRJD 4FTVD 3I75B 4O9HL 1ZA3A 4Z0XB 3B9EA 2BXZA 4XPHL 3B3IB 3HMXH 3CVHB 4NFCA 3MROA 5EU6A 5ICYB 4NC0B 2CGRH 1NGYA 5FA3A 4B7LA 3HC0A 3ZE1F 1QVOA 3MBEA 4P2OD 1P5VA 4U7MA 1U8MB 3BIKA 3BT2L 3UMTA 1WIUA 1CFNB 3GKWL 3ZDZE 4DKDC 4O00A 3W2DH 4POYA 4YQXL 1OHQA 3FB6A 3P0YH 4XVTH 4G9FD 1YUHB 1QD0A 1QRND 4KXZI 3A6CL 5M7QA 4YC2B 4XB8A 3BDYH 5D2LE 1YJDH 5KAQF 1FNLA 3H3PL 4PJ8D 2JB6A 4PJHA 5HHPB 1UGNA 4OZGF 2WNGA 4U1JB 3S98A 2A77H 2WWKO 1DQML 4G5ZL 2R1XB 5E9DA 3L95A 1PSKH 5IFAH 3LDBB 3B5HA 5L2KE 4NZTL 3PWVB 3M17A 2OJEB 3C08H 4NO5B 2DQTL 4OQTL 2Q8BH 3DTXB 4JQIL 4RCAA 1AI1H 1MHCB 1GGUA 4JRWA 4M8QA 3IFPA 4BQ8A 4ESKA 2HT4D 3BI9X 2AEQL 1M7XA 3A6OA 3TV3H 5EA0H 2WLZA 4QWWD 3NIFE 4Q74A 3VCLA 5JW3L 4LCCA 3RZCB 5C8JA 4OQTA 3WL9B 1I3RA 5GZOC 4NQSB 4QRTB 35C8L 3S3PA 2VLJE 4K9EH 2W07A 5ID1A 5DRWA 3VXRA 4EUPB 4HG4J 1TETL 5M95B 3GMOA 4QRRD 1I7TB 4XAKE 2QV2A 4ACPA 1MREL 2WWMD 3CC5B 4JFHD 2X1OA 2MHAB 1J1XL 1C5DA 3LB6C 5DC9B 4XCFL 2VLRE 1T1XA 1N6VA 3MRBB 3S5LB 4OJFL 4HBQA 4R0LB 5D70L 5FUCC 1NEZB 2YXMA 2DM2A 2EDWA 2BNQB 1OGAE 3CFDB 1DL7H 4I48B 1INQB 2RIKA 4X8XA 3UXFA 1IGIH 3BIBX 5ENWA 2CMRH 1R3IH 4HWUA 3IT8D 4JHWH 1BZ7A 5FUOH 5E8PA 1UT9A 2R0ZH 4G6KH 5HVHC 1S9WA 1FJ1B 1ACYL 3A6BL 4O51A 4QRSB 2BFVH 1OTSC 3SJVB 2EXYC 3L3IA 5JHLL 1BQSA 2BRRH 3S6CA 3BXNA 3UEZA 4ERSL 3PNWA 1ZGLB 1Q38A 1T7YA 1N5YL 3GSQA 2NNAA 2EDOA 2PW1B 4JRYD 4JHAH 2DQGH 2YMXL 3OKMB 4WFED 1ZEAL 2LU7A 5DJZB 1F58H 1CTOA 2AJZA 4XMLL 43CAB 4M9OA 1NCDL 1T1WB 2BVTA 3QFJE 3B9AA 2YN5A 5H2BB 4K2UL 4LIQH 1IAOA 1I7ZB 4XCYB 4RGNB 2YC1B 2VR5A 1BP3B 1Y18A 3T1FA 3C6SA 3NFNA 4GXVH 3SOBH 2AI0L 1UA6H 5JW4N 4R96B 4UUJA 2P8LA 5T1KB 2VDMH 1SY6L 2ZUQB 4Y16D 3BPOC 2NY7H 2EE2A 4H20H 3L3JA 3MRDA 5CCKH 4TTDD 3PP4H 3ARBD 4X4XA 2ITDB 1SVZA 2X4RB 3QIWC 3UBXI 3VW3H 1AQKL 4L8CA 2E6JA 3ZE2F 5I30H 1NGQL 3W0WD 2QHRL 4HS6B 4LAQL 5DMYA 5HBBA 5D1XC 2A38A 2HT2C 2D7PA 4DZ8B 1FFRA 3GSOB 2NW3A 3U0TB 5B3NA 4R7DA 4P9HH 4NKMA 3JV6B 3QDJB 1MCKA 3HTLX 3GEWB 5J11C 3VH8A 1CQYA 2YD6A 4I77L 4NN6C 3T2QA 2GSGB 3D9AL 5IIEB 3C5JB 5IBTL 1KLGA 2BNUA 3OAUH 3T8XA 1ETZA 4J3XA 4MMZC 4MQSB 5BRZB 3S8WA 2XPGA 1H8OA 4IRJC 2VZOA 4G8EA 1F3RB 3BEVA 4XPAL 5DLML 4MLSA 4MQXC 2BNRD 3ZKQD 2EIDA 2MSPA 2KZ1B 1KCVH 3KS0J 1X4XA 4PJDE 4GJTB 1FGNH 3EYVB 4I5BA 1ZTXH 2Z93A 5EPMA 3LEVL 4OKVA 3Q48A 4PRIA 3VI4E 1G7JB 1I9JL 5JOPD 4KZEL 3MRMA 2FGZA 4M3JA 3QUML 3TZVD 3QDMD 1FORL 2UVFA 3L5HA 3QA3A 1RU9L 4KI5D 3UC0H 2VWEC 4Z0BH 5DFWH 2B20A 1A2YA 5SV3A 1NMBH 3DURB 1MI5D 5I76B 5LAXB 2YPVL 4ONHB 5GSVA 1BD2D 4R9HA 4HDIA 4XNUL 1XR8A 1UZ8A 3O2VH 3PHOB 1MLCB 2Z92A 4YXKL 1Z9OA 5D8JH 1KACB 4ZUTB 2X4PB 2H3NA 3MLVH 4D9LH 1NAMA 4Z7NF 1AH1A 3WFHA 1FP5A 5T3ZH 3CFCH 1H8SA 2VDRH 4O2FB 5IJVA 3RWHA 2YA1A 4MAYD 3QIWA 1BBJA 2P42B 5I8OH 2ESVD 3WHXB 5D2NC 2R9HC 5KSVA 3TT1L 5IEKA 3IVKB 3B4NA 2NY1B 4ZO9A 1J0JA 3ULVH 5JUEH 4YO0A 2G2RB 4CJ1A 3FO9A 3P0VL 5T1LB 1A0QL 1QNZL 4ODHH 4O4YH 4UT6H 1S7TB 4EI5C 2VABB 3MUJA 4QT5B 1EK3A 5DEFB 3RVTD 3ESUF 5F1IB 3HNVH 4ZPVA 4L4TB 3GI9L 4NQTA 3OF6D 5AG9A 4I13B 1QTYT 3X17A 2UWEE 4ZSOA 1HXYA 1I4FA 5D6CA 2MMXA 5FHAH 2E9BA 2MKLC 3CK0H 5ISZA 1YY8A 5HXMA 4ZS6D 2D03L 2FRGP 4PV9A 4XTRC 1X44A 4K07A 3QCUL 1YEJL 4GBXD 5K59E 1RK1B 5J1AB 1E28A 3T0EB 3X3FH 4N0CC 1GZPB 3MREB 4RFEA 3TH2T 4I3SH 1FNSL 1LD9B 4NYLA 4P2QD 2R1WB 1DQJA 4XCEB 3WXVL 4HKZB 3N1QC 4P5KB 5F9DC 3TWCL 2OBGA 5HJ3B 1SJHB 5FCSH 3DVFA 2B1AH 1IILE 2EE9A 1RUML 4FP8H 1A7RL 1YMHA 1NCTA 1IMHC 5I1JL 3BEWB 3UTZB 3C5SA 5HHXH 1EHLL 2HT3C 3BD5A 2Q76A 4HKXA 3W11D 2FGWL 3AC0A 5D2NA 3VXUB 2F58L 1W72H 4LSRH 5C09E 2FSEB 5FOBB 5DUMH 5HYSB 4P46A 2DI8A 3BP4A 4G9DA 1V05A 1RMFH 1F90L 3GMNB 5GS0C 4NWTH 4TTDC 3OXRA 3I02B 2ZOKA 2EDXA 3MYJA 4HAGA 3K81A 3ROOB 3CSGA 3MJ9H 1SBSH 4HXAH 2PXYD 2YPLB 3AGVA 1Z5LA 2CIIB 2V9QA 1P84K 4CN1A 3K8LA 5IB1A 4YDIL 4OAWB 5ESQA 1TITA 5GISH 4JN1L 2V7NB 1EAPB 3GMRB 4YWGL 4ODVL 4PJAE 4ISVB 1C1EL 3FQNA 3G04B 3LEYL 5E03A 5EOTA 1IGYA 4BZYA 1QSFE 3O0RH 2Z35A 3U83A 5CZKA 5I71B 4YK4C 3CPLA 1ZANH 3P11L 3DV6B 4TTGA 2XFXB 1KTLA 2IANA 4GMSL 5F6IC 5J56B 3VXSE 1F6AA 2CIKA 3OZ9H 4L9LA 2VZVA 5DRZB 3SKOB 4UTBH 4LVOC 3RP1A 1MAKA 5EC1A 5JORB 2DOCA 5T5FH 3VXQB 3WUZA 2JB5L 3MUY1 4PJCA 3DIFB 4FHBD 4KRLB 4HJGA 4N0YH 5I6XB 4MJ5B 4YX2H 1JWUB 3MOAL 5C07D 1U8LB 4PJBB 4WFHD 2YUXA 1IGMH 4IRSC 1TZHA 4OB5H 1JK8A 4IRZH 3EGSB 1E4JA 2CKBH 1QQDB 3UJIL 1GC1H 3JZ7A 2YA0A 5AD0A 4OI9A 1CLYL 5J6HB 3TN0A 1MCEA 1N8ZB 2MTPA 2NY3B 5GIRB 5BV7H 2ARJQ 3TJHD 1S9YB 3MXVL 3EOAA 4PGCA 4TVPL 5GS0L 3VFNA 2AK4B 3MV8B 4XCCL 3B43A 4BQCA 3MLZL 4XC3L 4JRXA 1ZLWK 2ORBL 5E1AB 4GAYB 1AP2A 4JCLA 1G1YA 1BFOA 3S35L 4FQJH 1A14L 1DE4B 1P7QD 4GG6F 1G6RH 4NM4H 3ZL4H 1MJJB 1DQLH 1KJ3L 5C7XH 4D0DA 1F45A 5DDHB 4OGYL 2DM3A 1XGPB 3BPNC 1ZWIA 2EZ0D 1MEXL 1T21A 2BHYA 4MHHI 5FHBL 1NGXA 2BSRB 3VRJA 2EDHA 2J8UF 4PJFF 4H0GA 1DSFL 4JVUA 3GBLA 3CFEA 3V8OA 2LVCA 1YEIH 5EG6C 1G9NL 4LFHD 3E0GA 1I9IH 3LS4L 3K4AA 2VIRA 4RWYL 1AQDB 3O3DA 5I8EA 1A9EA 4NKQB 3RGVD 4RDQF 4TQEL 3JV4B 5MEND 3HLAB 3OAYH 5H35B 5CJOH 2HRPH 2PNDA 3FB7B 1DBKH 4N68A 1HHJB 1QLRA 2V5YA 1RJZB 5MEPA 2XXCB 3IDMB 2R2BB 5F7FA 3O6KL 4U1NB 4M43L 3Q0HA 4LEXL 3HI1A 4P2YA 1G7PA 4X9GA 4K3JL 1YNKH 3V6ZB 2VC2H 3I6GA 1X4ZA 4NQEA 4L3EE 2X89D 1BVLA 3KPQB 1ZLVH 4AEIH 1XGTA 2NXYC 3GMPB 4MX7B 4IRSA 4Y4FB 5DK3A 3G6JF 1TZGL 3OKNA 4FFYL 5E8EB 1A7NL 5DHVH 5F7YC 1JNHA 4NBXB 4NSKA 3QJHA 3Q5YA 2VUYA 1YN7A 4D0BB 1C12A 4HMDA 2DDQL 5SWZE 3VDAA 3BP6A 4KRPD 4MJ6B 3F7YA 5KVDH 4F33B 3QDGE 5FYKD 4LVNC 3GGWB 4S1QL 3LIZH 1N3NA 2VQUA 4BKLA 1E4XH 1NDMA 3DBXB 2AJXL 4Z95H 2FATH 3MLUL 4W4NA 4TULH 5EB9A 3G6DL 1JGVH 5LCVH 3FONA 3G6AB 5JPNB 4M7KH 4EXPX 2RAMA 3L3OB 1MSPA 4OZFB 2VZ1A 2WM0A 1RIHL 1JFQH 4EVNB 1CTNA 1EFXD 5BOPA 3MRHA 4YUEL 4OZIB 5C0BA 1TMCB 3OKLB 4M62L 4XXDA 2P8PB 1YQVL 4UU9A 4PY8I 2BC4A 2RCSL 3SQOH 4H8WC 5SWSD 5EU7C 1NCNA 4JM4H 3FFCA 1F11B 1CLOH 2PO6A 4X6CE 3V6OC 4DTGL 4EI6A 4F7PB 2E27L 2XWTA 3KPNB 4WO4B 3WFBL 2D31A 1N64L 3VXME 4HJ0D 3BOVA 4HZAA 4R4NC 2OTUA 3TIEB 3GSXB 4E41B 4ONFH 4U05A 3C87A 5SX5K 3A67L 3RTQB 1R0AH 3FTGA 1LNUA 3DUSB 3AREC 4P0DA 4RMQA 3B9VA 4R26L 1W0YT 4C83A 3HR6A 3UJTL 1X5AA 2DMKA 4M48H 3PWUB 1QFUH 4YDJB 3VXNB 2C3VB 3VFMB 3KXFB 4OLUL 2PETA 2RB8A 2ZPKL 4Z7QE 5B21A 3QZWG 1GRWA 2OXGA 3QAZB 4HJJL 4HT1L 4NGHL 4N1HB 1A4KA 1JTTA 3DMMB 4K7PY 2MCPL 3KGRA 3PWNA 1T6WA 5EO0A 2DQEL 5KN5B 1U8PA 4NQCB 2DQCH 4YDKL 1T5XB 3NACH 2H32A 3BGFC 4L9DA 5D7LD 1FQ9C 1KJ2L 5F1SA 5DO2D 3EYFB 1EEZA 1PBYA 2X70B 3RVUC 3KJ6H 4GQ9H 3S34L 2HJKA 3BQUB 4Y1AD 1MIMH 1INDL 4NQXB 4JFXB 3WKMH 5C2BH 4Q0XH 4JN2A 1HQ4B 4BSVA 1KGCE 4ODXA 1KJ2A 3C8KB 3HI5H 4E5XB 1S8DA 3GIZL 3DX6B 3VMPA 4BZ2H 4QHLA 3O4OC 1QKZH 1EJOL 3O3BA 4NDMA 4MNQE 1MAML 3X13A 2VDKH 3BGAA 4LSTL 3C60C 3UTSA 2A74B 4P5TB 5EBWA 4PJ7E 4ELMA 5CINL 2IQAA 1R5IB 5C9JB 4OFYA 3VXOB 2Q6WA 5GGTL 5LQBH 1S7RB 5D1QD 1F02I 3NIDF 3E8UH 3MJ8B 2UUDK 2W65B 1U41A 4NQDD 1FO0L 1ZHLA 4UIMA 2HFEA 2OLDA 2VOTA 1AKJA 1MPAL 4Z7WE 1EZVX 4S2SB 4HIEA 4ZOBA 4AM0B 4Z8FL 4YHNB 4G80A 4NO2A 5JIHA 4M00A 2IPKB 3AREA 2X6MA 5GGTA 4PREA 4HIIA 5I2IA 5CJBA 4HF5L 5IVZB 5B8CC 4JZJB 1FO0A 3INUL 1UXWA 5DHYB 3HB3D 3B8YA 3KR3H 3SDCB 3ULVE 2ATKA 4LCIH 3ALWA 5CWSA 3BZFA 5I1IH 3MRNB 3QBTB 2X4OB 3U46B 1MUJA 1L7IL 5D7IE 1N6UA 3IDGA 2DB8A 1VDGA 2JELH 1TPXC 4L8BA 3U4EA 4P2RE 5EORH 3TYFA 5IESL 4FNLL 4M7LT 1LK3L 4FTVE 2IBBA 4NKDA 5I18H 5DZNA 2V5TA 3QISA 2DD8L 3ARDC 3D1MC 1NMAL 2XTJC 32C2A 3L3GB 1LWRA 5HHOA 4RMSA 4JREC 3LPGA 2BDNH 2YD9A 3REVB 3OJVC 1OAUL 2NY4C 4L5FL 2H26A 4NRZB 4U0RC 4AYFA 3BW9A 4KKAD 2EKJA 3H2WA 4FZEL 4K3EH 3QPXL 5BS0E 1MJ7H 2GUOB 5F1NA 4NN5C 2O5YH 1U3HA 2W0FB 2X09A 4OLWH 5F96H 4IOSD 4K3DH 1F42A 5EZIH 1A6AB 4GO6B 3D6GA 5HGBB 2RBLA 4U2YA 5BOZG 5LGHL 5DD6A 1OTTC 1RHHB 1ORQB 2ZSVA 5TH2B 2P5WD 3RI5K 1TVHA 4TUOB 2AXFB 1RD6A 1S7UB 1GIGH 5HDBF 2BXYA 3QNXB 4UV4L 3FQXB 3GRWA 2VLLA 1JNLL 1JUFA 4DQOH 5IVXA 2IALB 2B2XL 3LN9A 3WN5B 5KZCB 1DQDH 3L7FA 3ZHDA 4CMHC 5IMMA 3MV7E 4FMFA 2SEBA 4K3HA 3ZTJH 1RK0B 3VXRD 2YRLA 1MAJA 5F9OH 3DJ9A 4OT1H 4ZFOL 1FBIL 4TSAL 3RHWF 3ZLQC 2VB5A 4H1LB 4U1SA 3D25B 3WFDH 4PJIB 4WY7H 5CSZA 3UDWC 3D85B 3HAEH 2KPNA 5IMOA 5HHVL 4HJ0C 5IM7B 5C0RL 2GJ6E 2E7CA 5IROC 2MOVA 1Z9SA 4ZFOA 3MR9B 5GS1A 1FH5L 1CFTB 1MVUB 3OAZK 1AGCB 3X12A 3RAJH 2O5ZH 1UM6L 2RGSA 3ARDA 1LMKA 2AJUH 3PDOB 3O8XC 2X1XR 3V0VB 3IDXH 3RL1B 3QCTL 4AH2B 1U8QB 5AWNL 3CAFA 4QXTB 5F8QC 3DXAE 2DTSA 4MVBD 3FZUC 5FYKL 5DD5L 1YQ2A 1EH9A 5IVOA 3O4LA 4YGVB 1B0RA 1A7QL 3DYPA 5MHSE 1XF5B 4G3YH 1ULVA 2B0SL 5CD5C 4NN7C 1OY3B 3HUJB 4ZTOH 1R5WA 1A21A 4MZ3A 3MJ7B 4ORZC 3ARTA 4PGEA 1N6QH 2GTZB 1YC7A 2J6EL 1MRDL 5GGRB 4HPOL 2P24A 3ZMRA 4YNYA 2I9LA 4I0PB 3E1F1 3CMGA 3HZYB 3KYMB 5DO2C 5JXED 1RZ8B 1JRHH 1AFVH 4UILH 3PABB 4GAJL 3WLWD 5HI5C 1OSZB 2B5IB 2ZUWA 1NFIA 3VG9C 5IK3B 1ND0B 5JOFB 3ZE1E 2OZ4H 5FO8A 4KK6D 4M6NH 3U48A 3RZCD 1HSBB 1EV2E 4F8TA 5IFJA 2J6EA 2V2XB 5I66A 1NCBH 1QFWI 2NZ9D 3GBNL 4JDVA 1NAKH 1RZGA 1T5WB 4JFFB 2NLJB 5IJKC 4IIQC 4UOJA 1BF2A 1CE6A 1IM9B 3OHXA 4IS6B 1D6VH 4D9QE 2HVKA 2OL3L 4JHBA 3KWWA 1WISA 1UQSA 5AZ2L 4DN3L 1IC7L 4OZGE 4FQ1L 5DQ9A 1CXIA 4YZFE 3HE6B 4JKPH 1XGUB 1DUYA 4G8GA 3AY4C 4UT9H 1SYVA 4X5WA 4UQ3B 2A73A 1X6NA 3B5TA 1JWMB 1OW0C 3G5YA 1I85C 2XQBH 5IROA 1KJVA 1HXMA 2A0LD 4LSDA 2OL3A 4KHTL 4U1LA 4UINL 4YHIA 3S4SB 2WBJC 2GTWB 2XZZA 2FX9H 3O8XA 5FM8A 1MFCL 2F5BL 1QYGH 1WWWX 1NANI 1TZIA 4HCRL 3SJVD 5KBNC 5I75B 3RWFB 2C1PA 2XNAA 4X5XA 1KENH 2P5EE 3KNBB 4UQ2A 5LWYL 2VSCA 5TGBA 4N0UB 4I3GA 3UTPD 5J12C 1RUPH 4J4PA 3PQYA 1T83C 4KMQA 2XA8L 1R3LA 5IB2B 5EU5B 3REWB 4PRID 1BQLH 5E2UH 4HCRA 4YH6A 1WZMA 4ZXBA 2JCCB 2VLKA 4D0CB 2APFA 4MCZA 1B4RA 1Q9OB 4UBDD 3HZKB 1IEAA 2YA2A 3L1OL 5T1KD 5E5UB 5IUSA 3D48R 4AENA 2AGJL 3KLDA 5INCB 4KAQL 4Y5YA 3SO3B 2NYYD 5I15H 3WKNA 4LBEB 4MAUH 3MRIA 4Y4KC 3MLXH 1MQKL 2R2HB 3DVIA 2VXUL 1X5ZA 4FQHA 5DI8A 3FJTA 2IPUG 3W82A 4Z5RB 4I0KA 5IJKA 3DROB 2Y23A 1P84J 1T1ZA 4F37F 5F88A 5I1AA 4AY0A 3EHBD 3MNZB 1U8JA 4X9IA 1WT5C 4YEFA 4HS3B 1QFHA 1T66D 5GRUH 3UTOA 3O9WA 4YBLB 3AY4A 2WUBH 4F9PA 1NFDB 5I1EH 1FL5A 4HUMB 5EUKA 5JIKA 1WWAX 1ACZA 1OAZL 2X05A 1ZT4A 3MV9B 4PR5A 3SEPA 4YHZL 4HKBB 2KUTA 4DVBA 3S97C 5BRZD 4PJCF 5IG7A 3MCLL 4A6YB 4U6YA 3FQUB 1IAKB 3WNKA 3MBXH 5CKGA 2WBJA 3SDAA 1F4YL 3EYOB 3L3KB 4MXWL 5ISZD 1EGJA 4U49A 3QHZL 4PIRF 2VNCA 4XPHH 2I26N 3P9WB 4E0RB 3D3VE 3BGMB 4XRCA 4HIHB 1K2DB 5IR1B 4XPBL 2IBZX 2WINA 3KPSE 1LDPH 4RWHA 1H9VA 1QFPA 4OGAD 2QQKL 5DC4B 5TPWL 4KUZH 1NPUA 4FQXB 1T83A 2DMCA 2CPCA 3DRQB 4LF3A 4O02L 3ZE2E 1J7VR 5KSBB 5F93C 1Q94B 2DQUH 3GKWH 1MFAH 1FN4B 2E7BA 2OQJB 3X11A 2VXQH 4LVHB 3CFIC 1TIUA 4ZO7A 1UENA 2ICWB 3FOMA 4U6HB 1FG2A 4MVBC 3TNMB 4XPFL 4LPWA 4H26B 4C59B 4Z7VA 2CKNA 3H3PH 1J0HA 3D0VB 3DVGA 3QXAB 5F72S 1S78D 1IQDA 1KCRL 1VACA 1AO7A 1D5ZA 3C8HA 3QNZB 4ZYKA 5B39B 5HHME 1OAKL 5K9QG 1CF8H 5GSRA 4DVRL 3DO7A 2X9XA 5L7XL 4IOFD 5J8OA 2DQFA 3HC3H 3BWUC 5JXEC 3LQMA 1OCWL 2FJHA 4MJIA 2XWBB 5HGDB 1NGZA 2Y07H 3CXHK 1D6EA 3KYAA 1P69B 3B6SA 1WT5A 4P46D 1V3MA 1UM4H 4MDJB 4KK6C 2DAVA 3RZCC 4L3CB 4KPHL 4Q7DA 1T3FB 2EO9A 3CFJA 1NFKA 4QRPA 4FFVD 3PGDA 5ITBH 3CVHL 4EJ1C 5E2WL 4P3DA 4L4TD 2NZ9C 3TBYA 4DK6A 2ZOLA 4QKXB 3VA6A 4OCXH 4F7TB 1Y0LA 5L2KB 1HHIB 1L7TH 1ZVHA 3SKJH 2BK8A 2V6HA 2C3XA 4Y0GA 2DYPD 3I75A 3M8OL 1VFAB 3Q5OA 1JGUL 4TUJB 1WBXA 4Q2ZA 4QTHB 4R0LC 5ICYA 1NCWH 4Z7NE 3RDTD 5GGVL 2NTFA 3RX5A 3NCJL 3V4PL 4JFEB 3QUZB 2A0LC 2R0WL 3T0ED 12E8H 3VWKA 1E4WL 3LS5L 4PTTB 3BZEB 3AAZA 4GW1A 1QSEA 5E0QA 1K5NB 3LZFL 5J89A 2VLJB 3KLHD 1WCQA 2B7DT 4YHKL 1CU4H 5C0CB 3C9NB 4PRAB 1ZLUK 4XT1C 4OLZH 1YECL 1WSST 1MCOH 3TA3D 1RFDL 4PJ9B 5EBLB 2WIIB 5IOPA 2ADFH 2ZNXA 1YPZA 5EBGA 1I7UB 3FOLB 4XXCC 1FV1B 3PWVA 4L1HA 3L7EA 4HUUA 1RZKC 5F89B 5D93B 4XMLH 3O41A 3VXUD 1L6XA 5CMAA 4ELKB 1MHCA 4GRLA 4JFOA 1UB5A 2MWCA 5F6HJ 4U6TA 5CGYC 3RNKB 4RGNC 4J23A 3GHEH 2ZUQC 5DEGB 4PRDA 3ZKMC 3ZTNL 4Y2DA 5FF6B 3WL9A 1KIRB 4NQSA 4JGJA 2P7TA 2YPLD 4DGVL 2EDRA 4L3AA 1RJLB 4N5ED 4QTIH 3JV5A 3VFPB 2G5BA 4OZHF 3V52L 5KAQG 3EHBC 4R2GB 3W9DA 5K9KA 2DQIH 6CGTA 1ZV5A 3S5LA 4R0LA 4Z78B 1PLGL 3BAEL 3BPCA 4AG4H 4F3FA 1WEJH 1HOCA 2Z8WC 3NZ8B 3P4OA 4PGDA 2EH7H 3VWJB 4I48A 5ACLA 4RX4A 3GIVB 3DNKA 2DBJA 3IDJA 5BMFL 3RL2B 4UTAH 3VFSA 3D39B 4YPGB 3U7YH 3U36B 3TVMB 4JDZA 2FEEI 2QQQA 4QRSA 2G9HB 2IH3A 1IAIM 3PGFL 1TENA 1RZKL 4JDTH 4QLRA 4ZG1A 3G5ZA 1NSNH 3EO1B 2PW1A 2VLRA 5D4QA 1CZ8H 5K9JH 3JWDC 3KPOA 3OKMA 2FWOA 3PHQA 4OGAC 5IMKA 2M1KA 5DA0B 2NY3D 4XXCA 4HGKC 2F8VA 4NZRL 2CXGA 2FIKA 4X0KA 1UWXH 4XVJH 4BUHA 2QLVB 3LEVH 4ELMF 2AK4D 4XMKH 1NAMH 5D7SH 3SKMA 2VQ1B 3QYCA 1QBLH 1FZMB 4V1DB 3UTTE 1A6ZB 4LSQL 3LEXB 4MA8H 4CDGC 2E7HA 1FFOA 5T1DH 2X4RA 4PJDB 2W9DL 3O3EA 3P4LA 4LRNL 3ZDYF 1HH9B 4IOFC 2NY1C 4OIIL 2JF1A 1DN0A 3BN9D 1JNNH 4KV5E 4WFFD 2CDGA 4MNGE 1AC0A 3QFJA 2G75B 4KHXH 1UYWL 3JV6A 3B9KA 1NBVH 2PO6D 3AM8C 3P0VH 5C08B 3ZYIA 2YWZA 3LCYA 5EZJB 1QNZH 5DD1L 2O5XL 3IJHB 1EHNA 2COQA 2ENYA 4YHLL 5J06A 1JPFB 4C56E 4IDJL 4QCIB 4X6FB 2DKSA 1P6AB 3GUTB 3VFUB 4BELD 4PY7A 1H3PH 5BVJB 3CNKA 5DJYB 4GG6E 5IMLB 3SCMA 1UCBH 2X5PA 1D5XA 1CBVL 3VGAB 5E6ID 4LP4A 4Y4FD 3DX9B 4XB7A 4NCC1 4ODWA 3QCUH 4PJXA 2NR6C 3S9DB 1F8TL 5D7JB 2J8UE 2QSCL 1G7JA 5F21B 3DWTA 5FB8B 2V17H 5D1ZB 2FYYA 4M1GH 5DMKB 1CL7I 3GK8H 5HYJE 3KLHC 4M5ZL 3JWOC 1AR1C 5LAXA 3VFRB 4F57H 2NX5B 2CH8A 3TWCH 1SQ2N 3EAKA 4F7CA 3QO0B 4WU5B 5IVXF 1NJ9B 4LK4A 4OUOA 2X4PA 3BZ4B 5IEHA 3V5DB 2YS4A 3P73B 5L6YH 4N1EA 3BP7B 1OPGL 1CLCA 5AUMA 1N59A 5TE7H 4WUUE 1IKNC 1KV3A 3ZZ1A 4N0FB 1CXKA 3GMMA 3TPUA 5INDB 5FYJE 2FGWH 4NKIL 5C6TL 1KULA 1NLDL 2EYTB 1T0MB 4AZ8A 2BMKB 2K7PA 4XCNA 1B2WL 1T7XA 5EULV 1BJ1J 4HX1A 2F54B 2D0FA 3N1MC 4HXBL 3Q6GH 4QT5A 1OQXA 5DEFA 2F74B 5EO9B 1YY9D 3Q1SL 1AKJD 1MHEB 1KTKE 4HFUL 2VE6A 1QSZA 1E4KC 5ALBH 3HC4L 2CLZA 4OLXL 3N9GH 2QTEA 4N5EC 4QOKD 4LRIC 6FABH 4L4VE 2DBLH 2ZUSA 3O3AB 2BHUA 1SEQL 4YDIH 1DN2A 4GRMA 4OLYH 4YWGH 4D8PB 1CICB 1MFDL 4JFYA 5I71C 5C09B 1V3KA 4QRUA 3LEYH 3DYMA 2R1YB 4LKXA 3DMMD 1PQZB 2HLAB 2FJGB 1S5IL 2VZ3A 4NQCD 3P4MB 3MREA 4OGZA 5ADOH 4OCSH 1Z3GL 3QUYB 3U1SH 1RZFH 4IMKC 2KDGA 5EU6E 4KKBC 4XCEA 5HYIA 5I6XC 4OFIA 5HJ3A 1JI1A 5KG9B 4K7PH 3GJFB 2CJUH 3V9FA 2NY5H 1NBYA 2VLMD 4M61A 3L3HB 3LAFA 3SY0A 1NC2B 3MODH 2H2PD 1HINL 3LQAC 3WO3B 1QLFA 1QSFB 1X5FA 3TF7C 1BGXL 4DKFH 1CLYH 3KPPB 2HTKC 4OKDA 2QJDA 3FT2B 4XI5D 4PJHE 3S3JA 3CUPB 4ZFGH 3ULSA 5C0GB 4P99A 3BHBA 1QFOA 1AXTL 3QRGH 5E9DE 4NM8L 4PRHA 2HA1A 3RA7L 4GMTL 5CEZD 2Q20A 4LASH 3LMJL 1A14H 2CD0A 5GGUB 3DETD 2D7TL 2JTDA 3ROOA 2Y25A 2EO1A 4XP6H 1FZKB 4RFOH 1MEXH 3CX5K 3CLEL 1MHPH 2EYRB 1S7WB 5C70A 3JTTA 2L0DA 2Y6SC 3GMRA 3MOQA 3QHFH 3F7VB 4ISVA 1CD1A 3SDCD 4HS8L 3F12B 5E1HB 1G9NH 3V0WL 5F70A 3IDNB 5I17B 2VXSH 3HE7A 4ZODA 4MNHA 2P43B 1CK0H 4TQEH 3UAJC 1IGCH 3CZFB 4GSDH 2I5YL 1K4DB 3FKUS 3D69A 5ILTL 4KWUA 3DRTB 3LQAL 2GIYA 1CGSL 2PCPA 3WJJC 3PUCA 4LAJH 3OBAA 4EKXA 1RZIA 3BMWA 3NIDE 1JWUA 2HH0H 1C8PA 3AMLA 4PJBA 1JPTL 1MCPL 4Y4FC 3T0DA 2OTWB 4PJAA 3EGSA 4KQ4L 4M6AA 1QQDA 5GQBA 1IM3A 4Y4HA 1HWHB 3MRRB 5I1KL 5J6HA 1YEEL 1TZGH 4FFYH 4ZOAA 1C5CH 3ROLB 2WSKA 3O6FB 4ZS7H 1ZHNA 5BQ7B 5E4IA 5FKAA 3LY6A 3LKOA 1BFTA 2KZWA 1JTPA 4H5SA 5FGBC 3MV8A 2FX8H 5E1AA 4GAYA 3VG0L 4PB0L 2PYEA 4LCWE 5DTFB 1S7XB 1A7OH 2QKIB 4PB9L 4EN3B 3OB0H 1W0VB 2BY1A 3MO1B 3WE6B 5HDQL 1AGDA 1R24B 4X80L 5DDHA 1YZZA 4KY1L 5KVEL 4HIXH 5KZCD 5F71A 1CFSB 1LO3L 4U1KB 3BIAX 2DQJH 4FZ8H 1D5IH 4PLJD 2BSRA 4P3CL 4Y5VB 4NO0B 3FO0H 1RIHH 1C5BL 2EH8H 2ITCA 3T4AB 4X7TB 5A2FA 1DFBL 5SWZB 4RISH 1JN6B 1V7NL 3HI6L 1CS6A 3QDGB 4WO4C 4LLDB 4U4BA 4CKVX 3MV11 2XZCH 4P5MA 2E27H 3DHJA 2FB4L 5H35A 1YEKH 2QBWA 3IETA 5H94B 1EXUB 3RTQC 1IFHH 3IFNH 4K8RD 4HFWB 4KQ3H 5JA8B 1A22B 4OCNC 2Q8AH 3KPMB 1TNMA 3QUXB 1KC5H 4R26H 4W81A 5CZVH 1LEGA 4Z7OF 5D5MB 3WJJA 1XGRB 3KPQA 5FUCE 4CVXB 4Z7VF 3GMPA 2F5AL 4MX7A 1OAXL 1I8MA 3VJ6A 3QAZC 2H32H 2DQDH 1M6OB 4XWGL 4BFIB 4LHQB 4HJJH 4X7EC 1UVQB 3BKJH 4HQQH 4WV1A 4J4PD 5FYLL 2X4QA 2ZP0T 1P9MC 3W5NA 1IL1A 1TTUA 3BO8A 3QIUA 3TBWB 2CLVB 4YDKH 4GS7B 1GPOH 5ANMB 1U8HB 2OR8A 3BVNA 4NCDA 3R8BB 5ERWA 4R4BA 1KJ2H 2GK0B 3DSFL 3H9SA 3H42H 1X5JA 3BQUC 4RDQG 1HHHB 2XWJB 2E3VA 5DJ6B 4OM1L 4XAWH 3Q3GB 5DQJB 5HGGS 3AS3A 5EUOA 5ETUB 4GFTB 4AT6B 4Q97A 3RVWD 1LP9A 5I8KL 4FFWD 4OLVL 1JHTA 3H9YA 4F80A 2EIBA 3RJQB 5HYQB 2ARJA 4JHZA 2R15A 3BKYH 3OKLA 4BSWB 4P5TC 3LH2H 4YXLL 3M45A 1GGBH 3PP3H 3BZDA 3MZGB 1E6JH 4OZ4B 1EO5A 4G42B 2AJVH 4I18B 4NUGL 3SPVA 1KLUB 1U8IB 5EC2B 3L6FB 1WIPA 3LRGA 3PJSA 4YE4H 1F11A 2M2DA 4RQQA 1N4XH 4WO4A 4UB0H 4KVNH 2BVPB 1QO3B 3O9WD 1MFNA 3EOTL 2R4SL 4QEGA 2OSLA 4E41A 1I1FB 1CDCA 1FO0H 1XGYL 5EBMB 1OP3H 2R0KH 2YOCA 4TSBH 1P4BL 4HULB 3GNML 4Z8FH 2AEIT 4PP2A 4JZJC 3PWUA 1OF2A 3QIBA 4JO4L 4MNQB 5CEYA 3U9PH 2J4WL 3SDAD 4HF5H 3SDCC 1U58B 1G1CA 1D5BB 4DK3A 3INUH 5F9AC 2AABL 1KBGH 1YPZF 1CXEA 1CDYA 1UM5L 4X6CA 4ZSOE 5KN5A 4YAQB 5EOCH 3ARFB 4Z7WB 3BWAB 4WHDA 5F7EH 3FRUA 4NOBA 1BHGA 2BOBB 2H41A 3TBSA 3D5OF 1WUNT 1NMAH 2Z31B 3O6MH 3KYOA 3O2DA 1BF8A 1UH2A 4AIXA 3KAAA 2JJUA 3RUGB 3S36L 4YHPB 4FQQB 5D2LF 4C55A 3P30L 5CGMA 3V4VH 4NQXA 1MCFA 2FBOJ 4FABL 4JFXA 1AE6H 5I0ZA 3T65A 2GCYB 1KCLA 5DZOA 4E5XA 4Y19D 3BE1L 2VWEE 2V9TA 4JY6A 3CVIH 4YFEA 1I8KA 2GAZB 1FAIL 4GUPB 5LGJA 3RWGA 1T7VA 1P7HL 1AD0B 4P5TA 3L9RA 2CRYA 3W9EA 4CU7A 1QLEL 2FH8A 1E27A 3GRWH 4FTVB 1I1AA 1DEDA 1R5IA 3WS6C 4MWFB 4FQLH 5E00B 3RWEA 1S7RA 1LE9B 5L2JB 3F58H 3N50A 4MQ7B 2VISB 4K23L 1RSFA 3QEUB 5GJTL 3KLSA 4KK8D 4GKNB 3N1FC 2ED9A 3WN5C 1SJEA 1VPOL 4P2OB 4S2SA 5E8OB 4UV4H 1GHFH 5BO1L 3ME0A 5D2NE 4TNWK 1WZ1H 4AM0A 3MV9D 1XR9B 1FFPB 3LKPB 3KPRE 2Z4QA 1AGEB 1H0DA 4MXVF 1Q9KA 1II4E 2PTUA 5IVZA 4PG2C 1QRNB 3P4NA 2GITA 2WUCL 5IT2L 4JY4A 2DLFH 3CMOH 1NDGB 3EO0B 1UFUA 3C8DA 1FBIH 3EFFB 3GO1L 3JVGA 4PJ7A 3KYNB 4PJ8B 5CUSH 1IAII 2FX7L 2LAAA 1UWGH 3LKRB 3U46A 4XNXL 5D7KD 1MCHA 4BZ1L 5SWQB 1MNUH 2H8PB 4PJGB 3MRGA 5T5NG 5CEXA 1EFQA 1CE1H 1ZHKB 2CK2A 3EYUL 1CDHA 4JPWL 4HUXB 1FH5H 3L3GA 2NY0D 3G5XB 1YYML 3MV7B 1EUTA 1FC2D 1UM6H 2DWEB 3NCYP 4KZDL 5IV2A 4NZUL 5DMIH 5TE6L 4K7FB 2I9TA 5I73B 3REVA 3G5VB 2IANE 3QCTH 2HRLA 5CAYB 5AWNH 4NRZA 2LVEA 1NUNB 1RURH 4LL9A 2QEJA 4LSPL 1EIBA 1FNAA 1W72B 3OJDA 1NUFA 5J6GB 5GRJL 3OX8A 4QRQA 3BMVA 1CG9B 2VXTH 1WJ3A 4PLKC 4JO2L 4TRPH 4PJCE 3MLSH 5HPMA 1BX2B 3H0TB 1A6AA 2A2QT 1B0GA 2RFXB 3CDGA 4P2RA 3SKUD 4QGTA 4M7JH 1MIEL 1I8IA 1RHHA 1HDMA 4I0PC 3HN3A 4GRLD 3RWCB 1GJIA 4ENED 3WIFB 3U0WL 2FLRT 2J6EH 3AXLB 1JJUA 2B5IC 4TUOA 1FIGH 3CU7A 2AXFA 2CDFA 1DQQA 3H3KA 4KMTH 4GAJH 2N7AA 2ICEB 3RVWC 4Y2DD 3T0BA 3U9UA 4D3CL 3H6JA 3WFCL 3WYRA 2R29L 4N90E 2FJFB 4R4FL 4JRXE 1KB5L 4XNYL 5BS0A 5I74B 1MF2L 5EN2A 1M7DB 3LN5B 5L2KD 5TF1L 4J1UB 2CLRB 3EIFA 3GBNH 3LKQB 2J2ZA 3WS3B 5IBLD 1ZAGA 1F4WL 4LOUC 4JG1L 5F3HB 3D25A 4TVPE 3HE6C 4PJIA 3D85A 2OL3H 2IWGA 4PBWD 1Y6KR 5AZ2H 1KB5A 1IC7H 5IM7A 3QWRA 4HC1A 4PJXF 4NNPH 5GGSB 3QUZD 3NFPA 1QA9A 4QHUB 3MFFB 1BZ9A 4KH2A 4B7IA 4ZDHB 4RMUA 3CGTA 2IADB 4P49A 5EZLA 1KJMB 5D71L 2CKBB 4NPYB 5J13B 3QXDA 3IXAA 4Q9RH 1R3JB 3V0VA 2VLJD 4KHTH 4JPKH 4AH2A 4RAUB 4PPTA 5JW5A 3VH8G 4QXTA 1ORSB 1A5FH 4XP5H 4YFDB 5BV7B 4XAKD 1MFCH 2F5BH 4N9OB 5JPMB 5I75C 3FN3A 2XT1B 4Y16B 1XMWA 1J1OL 1SMOA 2FR4B 3IS1X 1PG7W 2VLRD 4YGVA 1CQKA 4OZGB 3ARBB 3QQ9D 4JO1H 3QWOA 3OKEA 1CFBA 2AV1B 4QHMB 1G6RB 3R0NA 3ARWA 4NQEE 1JPGB 4LLQB 1OGAD 3W0WB 2F53A 4NFDA 1H15A 4JEGB 1DVFA 2CR6A 4X4MA 4XP4H 3NIGE 2HFFA 3LKSB 3FN9A 3PABA 1OSZA 4EOWL 3DXAA 3SBWC 1INEL 3RIAK 1JV5B 4Y5XA 3UO1H 3OR7A 4FQ2L 3H8NA 4OM0H 3ET9F 5TDNB 2X1QA 4EBQH 3ZO0A 2P5EB 4KROB 3LKNA 4EDXB 1AY1H 5BZWA 5TQ2L 5DVOA 2YSSA 3GSNA 5FO9A 2Q87A 2BVQB 1NGPL 1H5BA 1ZVYA 2IGFL 4PJ5A 4IS6A 5CJ8A 4QXGL 5DVLA 2CK0L 2OR9L 2AK1L 2ICWJ 3QFJD 2BNRB 4KK9C 3WSQL 4NCC2 4YBLC 1U91B 5FO7A 3QXWA 1JGDA 1MJ8L 4JY5L 3CFKB 5DURD 5C0BE 1WV7T 1ZVSB 2V9RA 2DI9A 1PW3A 3MACL 2UZIL 4HUKB 4NKOB 1EGJH 2UWEF 4H88L 5DHVB 3MMEB 3S4SA 3FFCE 2GTWA 4LDLB 1UB6B 1MI5B 4KJPC 3IGAB 3TP4A 4RAHA 2Y7QB 1BD2B 3GBMH 3U4BH 4UT7L 3SCMD 3VFOB 4ZUVA 2IFFH 2ZCKL 3RWFA 3HPJA 5IQ9B 3SE8H 3PWPA 4MXWH 2BSTB 1YMME 3U0PA 2ZSWB 4HIJA 2GFBB 5DGRA 1HSAA 3R1GL 4KJWD 5K59F 5BZDB 1W0WA 1N7MH 3BFOA 4FQXC 4XPBH 3NABL 1KCSL 3C5ZD 3HS0B 1GYAA 5EU5A 5TPWH 3REWA 3FCTA 1ZT1A 4JFDA 3TO2A 1GAFH 2I27N 3QEHA 4E42B 5DD0L 2JCCA 2PN5A 4LVHC 1JCKA 5GPRA 3WIHL 5B4MC 1CFQB 5DYOA 1Q9OA 4BH8A 4U1HA 4U6XA 1CGVA 2AERT 3FHAA 4S1SL 3EJYD 1T4KA 2WK2A 3PDDA 1SEBB 4P23B 1T22B 2X40A 2VZSA 4I2XB 2XYCA 4S1DC 2JIXA 3D3VB 4NC1C 3S96A 5E4EB 3THML 1OB1B 2BJML 1GXEA 3KPSB 1UADC 5JOEA 5D72L 5LBSH 3WXWL 4P9ML 5DFVC 1MFBL 3RIFK 1O5DT 3I6KB 1OAKH 3X14A 4DVRH 4ZFZB 5L7XH 1QBML 2Y36H 2MJWA 1MRCL 3QFDA 4RFNC 2EIZB 3RI5F 2ZJSL 4KTEL 1J5OH 4GBXB 5DRNA 1KF9B 3MXWL 5CBEA 4YHOH 5GJSL 3UTSE 1PFCA 4KKCC 4HKBA 4ELME 3TCLA 5EU7E 1U8KA 2R69L 4AEEA 1FFNB 1IAKA 1URLA 1E0OB 2APBA 4N8VG 3T0AA 4MA3B 4KJYB 4K94C 5CZXC 3L3KA 4PUBL 4BQ6A 4PJAF 1NC4A 3WHE1 1J0YA 2ZCLL 4U1IB 3VDBA 3ECBB 3BGMA 4RAVB 4NNYB 4LMQE 5J1TC 3QUZC 3OG6B 5AYQA 3LPWA 4NUJA 3S88L 4JJ5A 1Y6MR 2X42A 5D7JD 3ZDYE 1J05B 2FBJL 1ERNA 1KCUH 3HZVB 5KSBA 2R0WH 5D1ZD 5TF0A 5DD3L 5KSAA 2FO1A 4WI6A 3IU3A 4WI7A 3GMLB 1A1MB 3IFOB 5MI0B 1FN4A 3UBXB 5ESAB 4RGMB 4R8WH 3RPIA 4JR9L 3C2AH 4IJ3B 3TYGH 5CD3B 1KN4H 2ICWA 2HFGL 4U6HA 4ZUWA 4PS4L 4PJ9C 1JZ5A 1Z2KA 1ZK9A 5JDSB 1L9NA 4PG9B 3MRQA 5GGQH 3FO1B 4WW1A 4UDTB 1ITBB 3NCBB 2G5RA 4HSQA 1A1NB 2PXYB 5HHOE 3BKCH 2GKIA 1U8OB 1VERA 4LLMB 5A2LH 5B39A 5D93C 1FYTA 2AJSL 2E8ZA 3ZSSA 4MS8D 4K3GA 2YKLL 4YGAB 4UAOB 1C7SA 1A6VH 5I16B 3PL6D 4MDJA 4DFHA 4L3CA 4J3TA 2QQNH 5E08L 5JZ7D 3QJFB 3PIQB 2W0KA 4K94L 4FQCL 25C8L 3NN8B 3ZTNH 5A2JH 3IAQA 4XPTH 4NWUL 4J6RH 1QG3A 5DR5H 5KVMC 1WIOA 1DQTA 1FE8H 1EPFA 3C6LC 2HJFB 4XNQB 5IWLC 1ZLWH 5J7CC 1AJ7H 4CJ0A 3VE0A 1J1PL 3V5KB 2J1KA 1OTUC 4R2GC 3V52H 5C07B 3BKMH 4P57B 4TUJA 1WC7A 2D9CA 5ACZA 5F9JB 5C09D 5IQ7L 2W38A 1I9EA 1VFBB 3NA9L 2VYRE 1TJGH 5EIIB 3AFLA 2BVUA 4FQPA 3VWJC 3J7HA 1E6OL 5MERB 3ES6B 3GJEA 4HH9A 4KTDL 1K5NA 3QUYD 3GB7A 4MA1B 1KXTB 4CNIB 3KLAB 4MA7L 5EOQL 3TVMC 3GMQB 4NZDA 3QDHA 5C0CA 2ZUXA 3C9NA 3KG5A 5DUBA 4PRAA 3RU8L 3N06B 4OFPA 5EUOF 1EO8H 1TJHH 1GL4B 4PJ9A 5EBLA 3ZE0E 1LP9F 3ALXA 2Q86B 1DBAH 5HY9B 1G7LB 2BOCB 4Y4HD 5C2UB 1QSFD 1ITCA 1U6AH 1I7UA 2CRIA 2XTJE 4KUCF 4WHCA 3TIDA 4GKZA 4FXGA 4NFBA 4ZFFB 4WFGE 2NY6D 1U36A 4OSUH 3DPBA 3VXSD 4F58H 3SDXA 4G8IA 1HIML 4XHJC 4D2NA 4ZQKB 5DUPH 4NZRH 5DJ0A 4HBCL 3WUWB 4AL8H 4JE4B 5C0IA 4TPRH 3O4LE 1GVIA 5IB4A 5ABDE 1KCKA 3R06A 5FV1L 2IH1B 2VDQH 3B2VL 1IBGH 3L5WB 3NH7L 3RGVB 3KPLB 4JAMB 2QQLL 2XQYG 5MENB 3DARA 1KPUB 5FF6A 4MD5B 5KS9A 3MSPA 2XZAL 3GSWA 1JF1B 4GQPH 2DQHH 5BVPH 1T1YB 4KDWA 4W4OC 4M7LH 3HAEB 4WWKA 2C7UB 1ES0B 1NCAH 3VFPA 3C6LA 1XIWA 3PV7A 1J12A 1S5HA 1IAIL 3CSBA 3AS2A 3GHBH 2KH2B 2OCFD 4OIIH 5E6ZA 2NW2B 3BD4A 3D2UA 3DO3A 3QEQE 1HN1A 3QUKA 4P4KC 5JO5B 1A4JB 1D3CA 1HQRB 1IGFH 3DUUB 2VITB 4X6CF 4YR6A 1RIUL 4LKCA 3S37X 2EYSA 1OAQL 1AHWA 1Q8MA 2RR3A 4PGZA 1FL6A 3VFTA 3VWJA 5C0DB 3EDEA 1I3GL 3UTTB 2APVA 5J3HD 1I1YB 4HLZG 4KRPB 3QQ4B 3QXTA 2R23B 4ORGB 5FIEA 5E2VL 3D39A 2ZG2A 2H6PB 5E2TL 3U36A 4G8GE 4KGLA 4GLRH 3LSOA 1ZXQA 1T20B 5I8CB 3T4YB 2H9GA 5L8KB 3VGAC 3J8F7 4OGXL 4XMPH 4TSCH 1PYWA 5FOJA 4MNGB 5C0JA 4LQFL 3BYTA 5SX5H 4BH7A 3HRZB 2W0PA 1CT8A 4JFQB 2P45B 5D7JC 2BVOB 3O6FD 1EFXB 1LO4L 3RVVD 4WTZA 3BH8A 5FDWB 5C0AA 4QXUL 5EFIA 3T77B 4JZNB 2ZWLT 3QIUD 3SGEH 2FD6L 1ED3B 4WHYG 3MLTA 2EE6A 5K93A 1U3YA 1U93B 2QSQA 4YXHL 4NHUB 2IBZY 4EN3D 4F7EA 4HWZA 4V1DA 3H9SD 4M5ZH 1VHPA 1A6ZA 3PQYE 4GG6B 2OI9B 5DJXB 4L3ED 3E6HB 5EU3B 2JJTA 2X4UA 3SDDA 2VRAA 4G6JH 3QCVL 3U6RB 4FG6D 5DSCA 3NVQA 1M71A 3NA4A 2VLKE 2AJYH 5E7FA 5I1HH 4NO0D 2X7LB 1ZGLP 1HH9A 1QR4A 4TOYL 3BP5A 3BUYB 1QSVA 1EMTL 2J8UB 4PJFB 5SWZD 2R4RL 2B4CH 1KPRB 3UPAA 5A2IH 4PJ7F 2EXWD 3H9HA 2R0LH 3QDGD 4O2EA 4KK5C 4P4KA 3IXTB 1Q9WA 3Q6FB 4HW6A 1CFVH 5EZJA 5F1OB 2AW2A 3EDJA 2EC9T 1IC1A 1MHHA 4XVSL 3TFKC 1JPFA 1P4LB 1D9KA 3V6FB 4F15C 4QCIA 4NRYB 4JG0H 4DGYH 5K9QI 4WEBH 2VXVL 4OLXH 1I9RL 3FQTA 2H45A 4Q9QH 3HR5A 4KVCL 3V5HB 1KIPB 1M7IA 4FXKB 4OF0A 3QIBD 1SEQH 3I2CL 5IMLA 4IMLB 2GQHA 4HV8B 1CICC 1HZHL 1YN6B 2G60H 2UUDH 4M93B 4CVZA 5FM5O 4Y1AB 3FT3B 2PF6A 3MLWL 3OKOA 5DJAB 3AROA 2E7MA 2VH5H 2YHGA 2Z9TA 3G6JB 5D7IF 2ZCHL 5DQDL 4BQBA 2Y5TA 1F4HA 2A83B 4N1CA 3VXMD 4PJEE 3QUYC 1S5IH 3WD5L 5L0QB 4POZC 1N5AA 1ZHBA 2X4TB 1B6UA 1IC5L 4AMKL 3VD9A 2E6PA 4KDTC 4L4VB 3VFRA 3ZT7A 5D1QB 5IHUH 4UV7L 3MUGB 4KRNA 1A47A 1JGEB 5JR1H 5ICZA 5IF0A 3UPCA 3NFSL 2IAMA 1QBBA 2A6JB 3EFDL 5E94A 2HLFD 1WBYB 1Q0YL 3T2PA 1Q72L 2FEDC 4LHUA 5INDA 4N9GB 5DJDB 5TDPA 2O93L 4JZOA 1V7ML 5HI3D 1ZA3B 1I1AD 3Q2CA 4Z7VE 2GK2A 2BMKA 4XVUD 2XKSA 3WFEH 3EYQD 5HYJA 3WO4B 3MROB 5EU6B 4QNPE 1AO7E 1BBDH 4P4RA 3PV6A 1KT2A 5FA3B 3HC0B 2K1MA 5EO9A 1MHEA 3MBEB 4S1RL 3LMJH 3L5XH 4ZMAT 3SGKC 3BIKB 2OXHA 4KU1A 5MP6H 3QI9A 1DBBH 4QHKI 4MJIE 1KGCD 1AXSA 1EAJA 1OWRM 3FB6B 4YJZL 1HILA 4L8SA 4WUUA 2GJZA 4MNQD 4NJ9H 1WICA 3OKYA 5E8DL 2F8OA 4QRPE 1CICA 3VDCA 2JB6B 3MCG1 4HS8H 5EO1A 5B22A 2R1YA 1A02N 3EZJB 3NCYS 5T1MA 1XGQA 1X5YA 5E9DB 4YDLB 3L95B 3QQ3A 1YJDC 3EO9L 4PRPA 4WU7A 1F00I 3ARFD 3P4MA 4ZAKD 4HGWA 4RZCA 3M17B 3JTSA 4OTXL 3CDCA 1DBJH 2I5YH 2JJVA 4JO3L 3WNOA 3KJ4B 1KTDA 2P5WB 4QHNA 4M8QB 2OR7A 3IFPB 3O6LH 5IW3A 5ILTH 5IKCA 1UJ3A 1KG0A 1CGSH 3U7WL 2JJSC 1BZQK 4OCMC 1VGEH 4MCYA 5FYJU 5E99L 3VCLB 4LCCB 1ONQA 1JPTH 5C8JB 5GHWL 4RMVA 3ULVD 1MCPH 3BJ91 4X8JA 1BOYA 1QSEE 4KTYA 2W9EH 3RWDB 1I3RB 1HYRC 3OAZH 4BK4A 2WANA 2Y06L 3ARGA 4RSVA 5DRWB 3VXRB 4P2RD 2VDLH 3HMXL 1P1ZA 4ODBD 4QGYA 2OS7A 4K9EC 1C5DB 4EN3C 2CGRL 3VG0H 4PB0H 1T1XB 1KFAH 5KTEH 4AEFA 1YPZE 4NQVA 2ERJB 5E5MA 4BJLA 3T08A 1HNGA 1H3XA 4PB9H 4HUWA 5GGUA 1KSRA 5F97E 3N85L 4Z76B 3HMXA 1JPSL 3W2DL 4FG6C 4JVPA 3SGKA 1JWSA 3P0YL 4XVTL 5FKPA 3SE3C 5BS0D 3PG2A 2YPKA 1BZ7B 5IHZA 3QDAA 1C16B 1S9WB 3BDYL 1UH4A 1YJDL 3VI3E 3R4DA 4O51B 5A3ID 3ILQD 3P77A 3QPQC 2A77L 3L3IB 3BXNB 5JMOC 1J87A 2MFNA 3PNWB 4YZFF 5GZND 1PSKL 3GSQB 3HI6H 5IFAL 3NZHH 2NNAB 3OKDA 4UNUA 4NOFA 4X99A 3C08L 1MH5A 2AJZB 3TJEH 4DAGH 4HKJA 2Q8BL 3KDMA 4RBPH 2FB4H 1K4DA 5CKAA 1AI1L 3GSRA 3QUXC 1YEHL 3IB4A 1BJMA 3MV7D 3KVQA 1AXIB 4APQA 2IEPA 3TV3L 4F8QA 5L9DH 1G9MH 1IAOB 2MCG1 5FFLA 5EA0L 3T1FB 3C6SB 3NFNB 1E4XI 4UUJB 2JJSA 2BNQE 2P8LB 1WTLA 2X1WL 3K4ZA 3LN4B 4UIKL 3W39A 3L3JB 4K9EL 2VN4A 4X4XB 1S7QA 1NCCH 2E9WA 5BJTA 4XWGH 2QR0B 4BFEA 2X41A 1MCWW 3NOIA 2GJ6D 4X7DC 4MXVE 3TO4D 4L8CB 1RQ5A 5FYLH 4GS7C 1N0XL 4OD2A 1NCUA 1O7VA 1T7ZA 3ARZA 1DVFD 4U3CA 1MCIA 1U2HA 2MKWA 4R7DB 3K46A 1MLBA 3MRPB 3WE6A 2UVEA 3VH8B 3ZKND 3DXAD 1DL7L 3ARYA 2XI9A 1IGIL 4G6FD 4P9HC 1KLGB 2BNUB 5E95B 4DJMA 2CMRL 1R3IL 5HHQB 1BEYH 2A9NH 4JHWL 2R56L 5I8KH 5FUOL 2R0ZL 3HG1A 1ETZB 1ZS8A 4G6KL 4RGNE 3SE3A 4UNVA 2ZKHH 5MHSD 2XPGB 4R7NB 4U7SA 4X7TA 1Q9LA 1GZQA 1JHLH 2BFVL 2FECI 3CCHB 5JQ6H 4PGBB 2BRRL 2NCMA 4G8EB 2ILLA 3BEVB 3EYQC 4KJQD 1BIIA 4JHAL 2DQGL 4LCWA 2AP2A 1G7IA 1Q1JH 2O26U 1F58L 1RAMA 3I50L 3P9MA 4I5BB 1GGCH 4GKSB 5H94A 4MHHG 3EOTH 4HFWA 4OKVB 4PRIB 3MRMB 1ZGLM 4LIQL 4UDUA 1HWGB 2RHEA 3QA3B 4OV5A 4GXVL 1A2YB 3QDJE 1UA6L 2BSSA 3IKCA 3T3ME 2VDML 1K8DB 1DEEB 4RRPA 4CVXA 5GSVB 3MTRA 4H20L 4HDIB 1XR8B 4ZUSA 3PP4L 3DHMA 4D9QD 1M6OA 5FA4B 3ALPA 1OARL 2H3NB 4BFIA 1NAMB 2AABH 3VW3L 3WFHB 4GRWF 1WAAA 1XT5A 4H25B 3RWHB 5I30L 3OB8A 3UZQA 2HYMA 3O2DH 5JA9A 1BBJB 2DLIA 1H3VA 3I3EA 1QR1A 1SY6A 2CLVA 5KSVB 1YNTA 5ANMA 5D9SB 3AU1A 2Z31C 1H3TA 4P9HL 4YO0B 2ADGA 3FO9B 3K7UA 4FQIH 2WP3T 3FO2B 1HHHA 4PJXE 1WWBX 8CGTA 5CJQH 5F7NC 3ULVC 4HMCA 3RGHA 5KW9H 3OAUL 2J12B 3C09B 4G7YH 2P5ED 4KROD 4ZSOB 3I6LE 4BSWA 3ZDXF 1HXYB 5CIPA 3RJDA 4RMRA 2PR4H 5JHDA 1U92A 4OZ4A 5D6CB 3NBNA 1KLUA 4JB9L 1U8IA 5EC2A 2FL5A 3L6FA 1QLEH 5ISZB 5ESVB 1KCVL 3VXTB 2C4FT 1FGNL 5IP4A 1N2RB 2BVPA 1QO3A 1ZTXL 3FB8A 1GGTA 4P2OC 3TESA 4QY8A 1MRFH 1IZJA 3E6FA 4FFZL 4CU8A 5E5RB 5C0EA 1E28B 3STZA 1CD8A 2BERA 4Z0BL 1NMBL 3HPLB 3RWIA 4X7SH 3WNNA 4NYLB 1B4JH 4CDHA 5JIIA 4FN0A 4GXUN 3O2VL 1U58A 4PJ8C 2F19H 5DK0A 2J3SA 1LO2H 1NC4D 5DRXB 1BQHA 2DJUA 3MLVL 4D9LL 5GZNC 3AB0B 5T3ZL 1ZA6A 3GO1H 3QUMA 2VDRL 4U31A 4FOMA 1YMHB 2FX7H 2Y4SA 1YEFH 3MLYH 2VJXA 3C5SB 5EU4A 5I8OL 2LTQB 3QP3A 1KEMH 5AZEH 2Q76B 3SDXF 1KEGH 4HKXB 4NRXA 2NTSP 5ITFB 3QNYA 3ULVL 1J8HA 3HFMH 5D2NB 1DDHA 2HT4C 1KNOA 4ODHL 4O4YL 2Z31A 4UT6L 1WCBA 5I73C 3G9AB 3I84A 5D1XA 3DX7A 4PLNC 3RUGA 4QWWC 4P46B 5TQ0H 4G9DB 4F2MB 4R97B 5KS9F 4P23D 3HNVL 5GS2H 1FG9C 3OXRB 2Q1EA 1QUNA 1QFWM 3LD8C 3MYJB 3D3VD 4OQ1A 1PZ5B 1FLTX 4GW4A 4K71B 7FABH 1SJVA 4K7PX 1VEMA 3KPSD 4JM2F 5IB1B 1T80A 5ESQB 1AD0A 5FHAL 5DVNA 2VDOH 2GJJA 4IRJA 2WWMC 4UMGA 2DYPB 1FPTH 3I9GL 5C0ND 4OD3H 3FQNB 1OAYH 3OPZL 5EOTB 1LE9A 2VISA 2Z35B 3VFGH 3QEUA 1CWVA 3QEGH 3BN3B 4EXKA 1T03H 3RDTB 3X3FL 1KTLB 1LEKB 2IANB 4P2OA 3SDYH 2UYLA 1F6AB 3EDDA 2CIKB 3HMWL 1IT9H 4L9LB 3BPLB 4I3SL 5J1SC 5I74C 2DWDA 3TT3H 1AGEA 3OL2A 4S10A 1GGIH 4G9FA 2AQ1A 2NQCA 2J88H 1FLRH 2W60A 1QRNA 4HC1H 4PJCB 4PRHE 5HHMD 3K0WA 1EBPA 4HLJA 1AD9A 4LSSL 5DJCB 1NDGA 3EO0A 4KJQC 5E7BA 2B1AL 1JZ3A 3KYNA 4PJ8A 1F4WH 1TZHB 3TA3B 1JK8B 4WI4A 1LO0H 1JHKH 5HHXL 1FRGH 4LNRA 4PJGA 4BYHA 3V8CA 5AD0B 1ZHKA 2Q7NA 5D96B 3TN0B 1FDLL 4ZPTA 1Z9LA 2KQNA 1W72L 4PGCB 5J13C 4LSRL 1GC1C 4XPGH 4ALAL 5CSGA 1RZJH 3S5LG 2L7JA 3KPRA 5DUML 4WGVB 1OP5K 4Z77B 5BV7C 5JW4Q 3G5VA 1BFOB 1RMFL 1W8NA 2I60L 4N8VA 1X6LA 1JRHI 4NWTL 4Y16C 43C9A 4EI5A 3KYKL 4D0DB 1YEDA 3FT4B 3MJ9L 1SBSL 3ARBC 4HXAL 3RKDD 1XCQA 1CG9A 1ZWIB 4XC1H 5DMJB 3TBTA 1TJIH 1PKOA 1T7WA 1NGXB 3WLBA 3IJSB 4NO3A 1BX2A 3JUZA 5GISL 1P7KA 4QRRA 1A6WH 2GT9A 1HHKA 4PJBE 1AC6A 3WIFA 3CFEB 3AXLA 4WW2F 1YNLH 2JK5A 1ZANL 5DS8A 3O3DB 5I8EB 1A9EB 3VFWA 5LKNA 4LDEB 3MRCA 3OZ9L 4YK4B 4PV8A 4OUUA 3FRPA 3GSNH 3SGJC 4UTBL 5JXAH 1M1SA 1INEH 3MV8E 4WI3A 1QLRB 4KROC 5T5FL 5MEPB 4LVOB 2PYEE 4N0YL 2HJLA 3HI1B 1NL0H 4J1UA 1G7PB 4JM2D 4YX2L 4HWEH 3LKQA 4FS0A 3I6GB 5TQ2H 1RUAL 1IGML 5F3HA 2EC9U 5I19L 4IRZL 1MY7A 2XZQH 4OBSA 4KV5F 1BVLB 1XGTB 1GC1L 2OR9H 4M1CD 2EDLA 4IRSB 4JRYA 4NSKB 4LARH 5GGSA 3QJHB 3ILPB 1MJ8H 1YN7B 1C12B 3ZKXB 3TZVC 1VESA 2IADA 3PWJA 3BP6B 2XA3A 4KI5C 1KJMA 3MACH 4LEOA 3JXAA 3F7YB 1T89C 1R3JA 3U30B 1I1CA 1XFPA 3VA2C 3U82B 1G6RL 4NM4L 3ZL4L 2KKQA 3ULUF 1NMCB 1DQLL 1XF4A 4KKNA 5C7XL 5JPMA 3EYSH 4Y16A 1J10A 3K8MA 4WI5A 2FR4A 1XCTA 3PWLA 2C9AA 3PGCA 3FONB 2ZCKH 1FNEB 3ARBA 1F3JA 3GDBA 1PG7H 4MAYC 1TTFA 3WBDA 4QHMA 3MRHB 3RHWK 5C0BB 4LLQA 3NABH 4JFPB 4LU5H