4GALA

Crystal structure of human galectin-7 in complex with lactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 30
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4galA00
4YGCA 3OY8A 1KDKA 2ZGUA 1V6LA 4YZ2A 1F5FA 4LBQB 2ZGPA 3POSA 2AGSA 4BQ1A 2ARBA 1JXNA 2ZGOA 5T5JA 3A0KA 4UW4A 1W6QA 1SBFA 1GSLA 4XJ8A 1MS8A 1WD4A 1OFSA 4Q27A 1N1TA 5HCAA 2E6VA 4AWDA 5GLUA 4Q26A 2AENA 3GNEA 1H30A 4FPKA 1GZWB 5CAZA 5KXEA 2A6VA 3NV3A 3WCRA 1GZ9A 2ZGNA 3FBYA 4RA0A 5CA6A 3ASIA 2C9AA 4AVTA 5H9PA 4LBOA 3N3HA 1SACA 1BKZA 3DGTA 3WVJA 1FAYA 1GZWA 1GYKA 2GNBA 3VKMA 1LULA 4R9AA 3KM5A 4XDQA 4HANA 1AVBA 2GNMA 4YFZA 3PVEA 1SBDA 3D6EA 1D0HA 1APNA 3TAYA 2OUJA 2OW4A 1QDOA 3BODA 3HR9A 1CVNA 1LHVA 4XIKA 4YW5A 1F9KA 2AREA 1QMJA 1FNZA 1WBFA 2E53A 4R9CA 3UK9A 3NV2A 5JOWA 1YYNA 1ULFA 1DZQA 1LU2A 1Q56A 2ZZJA 1N3PA 2R49A 2D6KA 3B01A 3ENRA 4YW4A 1LHUA 3JUUA 4M01A 2YXSA 2D6PA 2WT0A 5IT6A 2PHTA 4XJ9A 1AZDA 4BM8A 1VIWB 5JVVA 2GN7A 2ZHNA 1MZ6A 1S0BA 3QCWA 4AVVA 1S0GA 1IOAA 1LOEA 2V5YA 5DG1A 4ZXKA 3M3EA 1Q8PA 4LBMA 3VKNA 1UZZA 3AP6A 1WW7A 4CRQA 2EIGA 1DBNA 1G9BA 2CL2A 1DQ2A 3WG1A 1V6OA 1JN2P 1LODA 3AFKA 1I3HA 3D5OA 4C1WA 4FPJA 4Z8BA 4M3CE 1W6PB 5EWSA 1IKPA 1Z78A 2H0BA 2XB6C 2ZGTA 3INAA 3UL2A 3O5SA 3N7KA 3O12A 4GKYA 2A70A 1QDCA 2A6ZA 4FOYA 4XJWA 4FPGA 1C4RA 1KQRA 4YW2A 3R4SA 2GALA 5L73A 2A75A 1I1EA 1V6MA 2W39A 1MZ5A 1N1YA 2GMMA 2AH2A 2SBAA 3N7MA 3NWKA 1G8WA 2GNDA 1W6PA 2UU8A 2A3YA 2NN8A 3R4UA 2UURA 1VLNA 5EXOA 3SH3A 2EXIA 3V65A 5DZGA 4Q8KA 3U4XA 1O4ZA 3O0WA 4XBQA 3ZVXA 4BMEA 1G9FA 1LU1A 1WUVA 2VW1A 4YG0A 2BQPA 4BLJA 4I30A 1AF9A 3AYEA 1MS0A 3B9CA 1S0EA 4LBKA 4UW6A 1LESA 2WT2A 2VU9A 4FPLA 1V6NA 3PMEA 2D3RA 3MPPG 2R0FA 1X50A 2R1DA 2R16A 5HCFA 5JOZA 1AJKA 1LOFC 1A78A 4YG3A 1VALA 2UWBA 4L8QA 1G9CA 3AZYA 2AUYA 1MR5A 2GMPA 4YZ3A 5DZFA 1YI7A 3VKLA 1NLSA 1AX2A 3WCSA 3POYA 1G7YA 3AX4A 3MEPA 4FVVA 2DVAA 2NM1A 1Q8VA 2ZGQA 3OJBA 5DUWA 2NMOA 1G86A 4XZPA 3WG2A 1SLBA 1KRIA 1ZM1A 1QKQA 3AZZA 3QLQA 2DUOA 3AXDA 1JYCA 5DXDA 3SH5A 2ENRA 1QU0A 1TEIA 3AP4A 1ULDA 2I2SA 4R9BA 5IUQA 5DZEA 2DV9A 4Y22B 1HQLA 3HN1A 3OY8B 5JDBA 4YZ5A 3USUB 1YRZA 4FPCA 4ZKTB 4YLZA 4YZ4A 5BYNA 1LOCA 3WDTA 4Y22A 1NXD1 2DVFA 1FNYA 1W6QB 2Q5TA 4YM1A 1UPSA 3USUA 1A3KA 4WVWA 4YGDA 4ISQA 4H55A 1UMZA 2VY0A 3VUOA 4YFWA 2JE9A 2DURA 2P3JA 2WT1A 1IS6A 3JU9A 5T5PA 2WLQA 3WUDA 1CESA 4YZ1A 1AXKA 3KQRA 2JECA 4YGBA 1IS3A 2YZ4A 5EYYA 3OGGA 2V73A 1CPMA 5JLVA 1UX6A 3WDUA 5HCBA 3H0OA 3WNXA 2DVGA 1OKQA 3AP5A 1S0FA 1Q8OA 3AZWA 1MS3A 1YXWA 2ZBJA 1DYPA 4AGVA 1CR7A 3NV4A 4YG6A 3V0BB 1GKBA 1ENQA 1BZWA 1GNZA 2D3SA 2JKBA 4XTPA 4U2AA 1G9AA 1UZYA 2VW2A 3ZSKA 3ZXFA 1QF3A 1MS1A 5KXBA 2CWSA 1SCRA 2NZ9A 3V0BA 1JUIA 1DYKA 1PZ9A 1GZCA 2ZHKA 1H9WA 4NO4A 3MW4A 4DFSA 4M00A 1LTEA 4LBQD 2P2KA 3ATGA 1LOAA 3PVNA 1IS4A 2E7QA 3W59A 1YIFA 3W58A 3ZPYA 5IK8A 3UJQA 1W6MA 3FFZA 4C1XA 4DS0A 4DRRA 1LEMA 4YGEA 4W65A 4XHXA 2AR6A 5JMCA 5IK7A 2CY6A 3I8TA 5SV8A 4K20A 2PELA 3L2YA 3LSEA 1ONAA 2FMDA 1LEDA 3NV1A 1DHKB 4XMIA 2ES3A 1GV9A 3B00A 4P9XA 5F9TA 4U36A 1Q8SA 2D7FA 1N1VA 1LGCA 4FP3A 2VUAA 5T5OA 1ULEA 3LCPA 1B09A 1F31A 1WBLA 2DUQA 2EXJA 2LALA 3PVOA 5GZGA 1JOJA 1QNYA 4YW3A 2DU0A 2ZGKA 1PZ8A 4DRVA 2VXRA 1DQ0A 4UW5A 2GNTA 1Q8QA 1QGLA 1SLLA 2G4IA 1CQ9A 4WVVA 3AJZA 1CN1A 1V6KA 2D6MA 3AP9A 2WNEA 1GBGA 2GN3A 2CTVA 1H9PA 3GALA 3WV6A 3N35A 4M3CF 2D6OX 4PCRA 1PZ7A 1ULGA 2W68A 3A4UA 2D44A 4XE9A 4FPOB 2A3XA 2ZKNA 2HYKA 2WQZC 1KITA 1WLWA 2YMZA 4XTMA 3AZXA 1R1ZA 1WW6A 5CBLA 5GZCA 5FRAA 1RITA 3OBRA 3ZXLA 1EPWA 3MW3A 1GLHA 1W0OA 4FQZA 1V6JA 3RQ0A 1S0JA 2LTNA 4XXPA 1DLLA 4D69A 5CNAA 2DWRA 4P9WA 5LK5A 3IN9A 1CJPA 1BYHA 1QOTA 1C57A 2DVBA 4K1YA 2CYFA 3SH4A 5GM0A 3WOGA 4Y20A 1N3QA 2ERFA 2XG3A 4GWMA 2E7TA 4M3CB 2YY1A 2ZMKA 4GA9A 3B3QE 1W6OB 4Y1YA 2EAKA 1BXHA 4ITCA 3WDVA 2JD4A 2P34A 3WLUA 1S0DA 1GICA 4HL0A 5T55A 4M3CA 3AJYA 4RL7A 2A5ZA 1DFQA 2DTWA 5GLVA 4ASMB 3ZXEA 3T1LA 1UKGA 1W6OA 3SISA 3Q9OA 4XIOA 1S0CA 4P9YA 5DG2A 1BJQA 3OPZA 1FV2A 1UL9A 4CZSA 2EALA 1C1FA 2WKKA 1ZA4A 3RRDA 3WUCA 3HMYA 2ZA9A 1MACA 3ILNA 4OZXA 3OYWA 2EXKA 2R1BA 3M3CA 2E51A 2D6LX 3M3QA 4K1ZA 1MS4A 1DQ1A 1W0PA 1DQ5A 2ZHLA 4P14A 2UWCA 3RG0A 1D2SA 1VAMA 1WLCA 4Y1XA 1JW6A 2A6YA 5FREA 3ZYRA 2VH9A 2WSVA 4Q1RA 3WDWA 3IM0A 1GANA 2A6XA 2DVDA 2R0HA 5H9SA 2GDFA 4ATFA 1A8DA 2JE7A 3ZXKA 4Y1UA 1LCLA 4LBJA 1WCSA 1QOOA 4F83A 1HQWA 3I4IA 2ZABA 5H9QA 4MYEA 4AGGA 1LGBA 1V6IA 3M2MA 4AGRA 5T5LA 1AX0A 4YW1A 1RINA 4GXLA 4XXAA 3C2UA 4YM2A 1S1AA 4KBBA 1VAVA 2DUPA 3AP7A 3DUIA 1JHNA 1DGLA 4LBQA 3RSJA 3V0AB 2ZAAA 1WLDA 4YM0A 3M3OA 4ISRA 5GZFA 1W6MB 2ZGRA 4JCKA 4Y26A 2GMEA 2YV8A 3ZXJA 2A71A 2PHFA 2W08A 1DIWA 4PF5A 3V0AA 1DQ6A 4BMBA 2EF6A 4CTEA 3APBA 3SNMA 5GZDA 3M1HA 3IKWA 1WD3A 5E8AA 5H9RA 3AZVA 4FPFA 5DUUA 1AXYA 2CNAA 3O0XA 3WHUA 1KJRA 5IK4A 3IPVB 2A3WA 2WJSA 3ZSMA 3ZSJA 5DUXA 3MW2A 1MS9A 2AYHA 2ARXA 2DYCA 4LBNA 1W6NB 1CONA 2OVUA 2PHXA 1CPNA 1IKQA 2P3IA 1OQ1A 4Y1ZA 5T54A 3RS6A 3RMXA 1AXZA 1LHWA 5T50A 1LENA 1BQPA 3IPVA 4JRAA 1Y7BA 2OUHA 1YO8A 3FUOA 1LGNA 2ZMNA 1N1SA 3FLRA 3CNAA 4Q8LA 2P3KA 1MS5A 2NYYA 4DPNA 1W6NA 1SLTA 1HLCA 5AVAA 4DQAA 4JC1A 4Y24A 3TB0A 5GZEA 1RIRA 2ZMLA 3OBTA 5T52A 1LECA 3ILFA 1IS5A 1SLCA 2JDZA 4XJZA 3VV1A 1UAIA 2YROA 2JJ6A 5GLTA 2CWMA 4LBLA 4PBOA 4PQ9A 5E89A 3WDXA 1N47A 4FPYA 5IK5A 1JYIA 1LJ7A 1SLIA 1XQNA 2C5DA 3A0NA 4R9DA 4XYXA 1SCSA 1ULCA 3ZSLA 5KXCA 3FLPA 4Q2FA 2FHRA 2PHUA 3WG4A 3O0VA 2PHWA 5DUVA 4SLIA 5E88A 4Q1PA 4UW3A 4XMAA 1C1LA 1UN1A 2EXHA 3RMYA 1N3OA 1FYUA 4BOWA 4AYUA 4YM3A 5JOYA 2DTYA 4NOTA 4Y20B 3T2TA 1U0AA 3BOPA 2KM2A 3B69A 1FATA 4GALA 4GWNA 3FLTA 5CB7A 3WHTA 4ATEA 1G9DA 4XHBA 2W52A 3ZYPA 3PJQA 1DQ4A 5F5QA 1LOGA 1AJOA 4FOVA 1HDKA 4IQPA 2NMNA 4BPZA 1SLAA 3VKOA 3WG3A 2DU1A 4FQ4A 2PHRA 3AK0A 5GALA 5GLWA 2D3PA 4FOWA 1KDMA 3FUQA 3UJOA 3WDYA 3N7JA 1ENSA 4WV8A 3WZ1A 3SITA 3AYDA 4XOGA 4PBPA 3V64A 1Z0HA 3POWA 2D43A 2D6NA 2ZGSA 3AYCA 3N7LA 4XBLA 3ILRA 1SBEA 3AYAA 4XJAA 3SLIA 5GJ6A 2RHPA 3T1MA 5EYXA 2ZGLA 4XBNA 4FP2A 1JBCA 1AX1A 1LHNA 3LSDA 4Y1VA 1URXA 1LOBA 1QNWA 1J1TA 1V00A 3D4KA 3N36A 3OYWB 4K21A 4TYSA 4BLIA 3BIWE 5KXDA 4FOQA 1MVQA 2TEPA 1S0IA 1FX5A 4WZFA 1MVEA 1HKDA 4AVSA 1WW4A 1QOSA 2A6WA 4XILA 4GKXA 2A7AA 2ZGMA 3VKFC 4FPEA 2P37A 4XJUA 2SLIA 3BTAA 2B7YA 1ENRA 1FV3A 1LOFA 1WW5A 5GLZA 3R05A 2UWAA 2WSUA 2ZHMA 2ZACA 3AXEA 1LHOA 4TZDA 3IMNA 1SFYA 1GNHA 2NP0A 1CIWA 2Z42A 1KJLA 2VW0A 5JOXA 1O4YA 4FPHA
chains in the Genus database with same CATH superfamily
1VBC3 3OTFA 1QXPA 3ZIWA 3ZSEA 2VBDA 3DYMA 1DZTA 1PMHX 2WZR2 5I0SA 2VE1A 3IAQA 5T5JA 1H2NA 1SBFA 2PA7A 5JI9A 2J1TA 1MS8A 5EZWA 1WD4A 5HCAA 1N1TA 1JZ7A 4AWDA 5A7QA 5LATA 4Q26A 2AENA 2FDIA 3CEWA 1H30A 2E32A 5KXEA 1WA6X 2O8OA 3ACHA 5BXXA 5FXWA 2ZGNA 3FBYA 2VZ1A 4RA0A 2YU2A 4JGYB 2W2IA 2R6QA 1COV1 1UF2C 5CEHA 3ASIA 2C9AA 1IQDC 1W8UA 2J42A 2ZTNA 3PUAA 1SACA 2WNUB 1AYM3 1BKZA 3MIFA 3WVJA 4J1WA 3UNPA 3C7GA 3GDBA 2X5IB 3JD72 4E4DX 3MLJA 1V70A 2QE3A 2DFBA 4W8JA 5IVFA 2XDVA 1H4HA 1AVBA 2BWAA 3DKWA 1LAJA 4W6YA 2WNUA 2ADEA 3PVEA 1SBDA 1D0HA 2MEV2 4RGGA 3BODA 2X5IA 4Q5OA 5JMOA 3ZFEB 1F9KA 3O1TA 1QMJA 5ACA3 2LS6A 1YIPA 1YNAA 4R9CA 4UXAA 4NRMA 3UK9A 1PO22 1XYOA 4Q4W2 3OEBA 2Q1MA 4PF1A 3VDCA 2C1FA 1DG6A 1FOD1 3ZFEA 2O1QA 5CU1A 3JUUA 4OI4A 1J84A 1DGWA 2WT0A 2PHTA 3FHQA 1EY2A 1SZBA 1PM4A 4AZZA 3PURA 2GN7A 5JVVA 3WNMA 3BKZA 1MZ6A 3U75A 3M3EA 1Q8PA 3WP6A 3J8F2 3AP6A 1J58A 4XQ4A 4OVEA 2Z79A 2RDQA 4OI2A 4Q4X3 4CRQA 1OLRA 4CPBA 4I01A 1BEV2 3TN91 3WG1A 4IERA 3AFKA 4RQPC 1X33A 4M3CE 5A70A 1IKPA 3OG2A 4MH0E 5FV3A 3WNXA 3K51A 2FCTA 3N7KA 1KEXA 4GKYA 2A70A 3ZX7A 3ZR5A 4BA6A 4FOYA 2DFCA 2WAOA 4XJWA 3WP4A 3KV9A 4B29A 1KQRA 4YW2A 3HQXA 5L73A 3U07A 2A75A 3O14A 4DNYA 2W39A 3EO6A 2SBAA 5FYSA 1J1LA 2VQTA 2UU8A 2Q8EA 4MXVA 2NN8A 1DZRA 3R4UA 2UURA 1CAWB 3GHMA 5EXOA 1UCXA 3TRSB 3SH3A 5IVCA 3ZKUA 3ZVXA 3JXSA 3MIBA 3NAPC 4HMZA 1RUI2 2VW1A 4YWAA 1X7NA 3T4HB 2XJPA 4AVCA 4BLJA 4CUAA 5HPOA 3AYEA 2LROA 1CAWA 1ND2C 2B9VA 1DYOA 4I09A 5EQUA 4YARA 4H3WA 5A3PA 5C5UA 1JZ8A 1S0EA 4OUSA 4UW6A 4XF1A 2VU9A 4M0NA 3MPPG 3AMHA 2WA3A 5JOZA 2VCAA 3PLQA 1A78A 3IIIA 4NR1A 4YG3A 3WD5A 4L8QA 1G9CA 3SC7X 3W5MA 2GMPA 2AUYA 1COV3 2BVBA 4HG6B 4YZ3A 4CDQB 1VB4A 4COUA 3AX4A 5K9YA 4FVVA 4LMFA 3OJBA 5DUWA 4AAPA 4XVHA 1RC6A 2G9GA 3AM2A 3FE5A 1SLBA 4PDWC 4LIVA 5ISLA 1VBB1 2VQUA 4CDQA 2ENRA 1ULDA 5FPVA 1IGOA 1W8HA 5IUQA 2XKOA 4CA9A 2FDJA 5LRSA 5F2WA 3RZMA 2H6BA 3KGZA 3OY8B 2QQVA 3MIDA 1YRZA 4ZKTB 4YW6A 4CDUC 1NG0A 2BU9A 1J83A 1NCRC 4YVWC 5CFCB 1OHFA 2DVFA 5KHGA 1FOD3 1QQP1 1UPSA 2Q5TA 4DXRA 4UFJA 1VJ2A 3ACIA 2JWPA 4O9GA 4ISQA 4H55A 4WVWA 2WAAA 1ZX5A 4YGDA 3VB9A 3VUOA 3I2FA 4NIDA 1PGW1 3I2KA 4OHVA 4GH4B 1NUKA 4IE7A 2VMGA 3MPBA 2W9XA 4C91A 1KFUL 1CESA 2BRTA 5IVBA 4AI1A 2K46A 3CF6E 1AXKA 5FMCA 2HYXA 1IS3A 2XVLA 1VR3A 3WW1A 1W2UA 2B8MA 4GH4A 3TN93 2XUEA 2E26A 2V73A 3E5XA 3AMPA 3A21A 1OURA 3H0OA 2YBSA 3J4UH 5HCBA 1OKQA 1Q8OA 2X10A 1OH4A 3AZWA 5FMOS 5J98B 3M3IA 4J1XA 3S5QA 2W5FA 3ES1A 4DO0A 4EYUA 1GKBA 5FYMA 1ENQA 2YYOA 2OXBA 1BZWA 1E5HA 3H3LA 1POV1 4AFDA 4N9IA 5FYZA 1QXJA 4EQVA 3T09A 5GKAC 4UOJA 1UZYA 2VW2A 2I74A 5FO7B 3VZLA 4HK9A 3SXWA 5KXBA 1LNSA 1OSGA 2PAMA 1DYKA 1GZCA 2B46X 5LCWL 1RUE2 3PUIA 3VDAA 1K5MC 2BGPA 2I45A 2DCKA 1SEFA 3ZFFC 3HQRA 1VMJA 3PVNA 4GMP0 1IHMA 2CDPA 4LITA 1ZBA3 5A7NA 1UYPA 2BGCA 1VB2A 1W6MA 3FFZA 4C1XA 4AHYA 4DRRA 1YCIA 5I0DA 3ZO0B 2QQKA 4W65A 4XW3A 4XHXA 3ZMNA 1CGPA 3NW4A 1VBC2 3RJ2X 4LO8A 1PK6C 1IQAA 2XBO3 4SBVA 3NV1A 1W9SA 4XMIA 1YLLA 2ES3A 3ZXDA 1GV9A 2VTFA 5LWBA 3I2HA 4H14A 4RGKA 1VBB3 3EJKA 4KWJA 2D7FA 1D0GA 4JTNA 2QQOA 2RR11 2VUAA 5KC6A 2LM3A 4CCCA 1E5SA 1Y9MA 4IEQA 3S6PA 4L99A 4BYYA 5IVJA 2LALA 2ARCA 1QNYA 1UU4A 4JDNA 2DU0A 1PZ8A 4NHXA 3VBSB 5C70A 4NRPA 2VO5A 3DEMA 3ZN5A 3TNPB 1WMEA 1QGLA 1SLLA 1AYM2 2G4IA 1CQ9A 2FZ1A 3OB8A 2XLAA 4DMIA 4F8AA 3AKQA 5JIAA 4FXKB 1QQP3 4HSJA 2CTVA 4R8HA 1PGL1 4LA3A 4XF9A 4PCRA 4F7ZA 1BVP1 1HRV1 4AFBA 4I3PA 4BZ4A 2W68A 2A3XA 3E97A 2WQZC 1KITA 3L9JT 4XTMA 1R1ZA 1WW6A 5CBLA 5ACA2 5FP7A 3ZXLA 1KXGA 5JAXA 3HJRA 1V6JA 3D0JA 4CXWA 2DWRA 4P9WA 4Q0PA 2BOJA 3IN9A 2DVBA 5LK5A 1UZWA 2VMFA 2CYFA 4EZ4A 4TXWA 4Y20A 5FZOA 1RUC1 4BJ0A 3MZHA 2XG3A 1IPSA 5J3UA 5FWEA 3GJAA 1H2KA 1ZRFA 2XJQA 3FL7A 1OA4A 5F3EA 2EIDA 1POV3 4D8MA 4Z2WA 2VOKA 2FCUA 4D6SA 3POFA 2EAKA 4GJYA 3VBUC 2JD4A 2P34A 5FUNA 1S0DA 5A7WB 1ND2B 5T55A 4Q4X2 3AJYA 4RL7A 4ASMB 5F1RA 2IXCA 3QACA 3ZIXA 1BBT1 1QJY1 1UY2A 2WN3A 5FIXA 1RTVA 1TMF1 3LEGA 3NAPA 4P9YA 2GC0A 2YHJA 3OD0A 3GBGA 4CDXB 3THDA 2Y38A 5A3UA 3OPZA 1UL9A 4HONA 5A7WA 4CZSA 3PTYA 1ND2A 2WKKA 3AVRA 2IFWA 1UZVA 1F4HA 1OA2A 1C5IA 4XFFA 3T0AA 2EXKA 2R1BA 1BK0A 2RJ2A 4O65A 2VZTA 4ARYA 4QX8A 1DQ1A 1QJU1 1DQ5A 2RM22 2ZHLA 3U37A 4DIQA 1OF4A 2GZWA 3E6BA 4JTOA 1JW6A 2A6YA 2Y6JA 2HEVF 3KF5A 4R4ZA 4Y1XA 4HZFA 4AVAA 2VH9A 3VBRC 3IM0A 1GANA 1TNFA 2MPFA 4P9GA 4R4XA 2W0XA 4W50A 2CGPA 3A22A 4PDWA 4ATFA 1A8DA 2HWF1 3MYXA 2ZX3A 3ZYBA 2RR13 3BTZA 2RS51 1GQHA 3RI8A 4QQPA 4DB5A 1Y3TA 2ZABA 4MYEA 1NCRB 4AGRA 3VD7A 5T5LA 1YJLA 4YVWB 4ONUA 3P3PA 2VUJA 4BK4A 1RINA 4GIQA 1COV2 2J7MA 4MADA 1QH7A 4A4AA 1OC1A 3DXTA 1S1AA 5IW0A 1YQ5A 1VAVA 2DUPA 3HPNA 3MIEA 1NCRA 3AP7A 1UW8A 2HWD1 3OGSA 4HKOA 4IEZA 4YVWA 3RSJA 2ZAAA 3V0AB 1FPN1 1RXGA 5I93A 4HPKB 3NJZA 1HRV3 2BEOA 4JCKA 1TVGA 4QKDA 4D3WA 2GMEA 2RV9A 3ZXJA 2PHFA 3V0AA 4PF5A 3NKGA 2YDEA 1MEC1 4BMBA 2PQSA 2OX0A 1O59A 1GP5A 1CIYA 3APBA 3I3QA 4ZU4A 3I97A 1WD3A 2QNKA 5E8AA 3BYWA 3AZVA 5DUUA 4AFCA 1AXYA 5K4LA 4BHPA 1KJRA 1H8VA 1OQEA 2A3WA 5FY5A 5L9RA 3VZOA 1FOD2 4QDSA 5KC5A 1WCQA 1ASJ1 3H3ZA 1RUC3 3PVBB 2ARXA 1NE4A 3ACFA 4P9LA 4Y1ZA 1ENXA 1OQ1A 1W03A 1HV0A 2P3IA 2WRAA 4PLNA 1AXZA 3JB8A 4RYDA 1LENA 4JRAA 2OUHA 1DDLA 3UKNA 1LGNA 1RUD3 2PHLA 4X8NA 4K9SA 3B02A 3I2DA 2NYYA 1MS5A 2CGNA 2VZVA 4B1LA 1STMA 1BBT3 1QJY3 2QKDA 2VZSA 3MIHA 4JC1A 3TN92 4PLMA 1TMF3 3BI3A 1RIRA 1OFNA 2BERA 4S2GA 1W8FA 1LECA 3AL5A 1PIV1 4NHLA 3VV1A 1IPJA 1IG3A 1UAIA 2YROA 2ZX1A 2JJ6A 4W6XA 4OMCA 5GLTA 4PQ9A 3ZFFA 3FN9A 3LEIA 4RS5C 4CUBA 5FZ9A 3ZPOA 2XJVA 3PHMA 1LJ7A 1XQNA 4R9DA 2DBNA 5CZKA 4B4QA 1ULCA 2CU5A 3ZSLA 4UI9L 5FO9B 2EICA 4WM8C 5E88A 5HV0A 4SLIA 1QJU3 4Q1PA 1MQTC 4UW3A 1C1LA 3NJYA 1ZYBA 4D7YA 3AL6A 1PK6A 4CPBD 4WM7B 4PI2A 4AI2A 2VCCA 3BOPA 4KGGA 1U5IA 3FLTA 5CB7A 4ATEA 4LHNA 3KWVA 1G9DA 2VMEA 3PJQA 2HWF3 3MDPA 4BPZA 2RS53 4IQPA 1ZBA2 2NMNA 4ASKA 2NPIA 5FY1A 1ZRIA 2V5DA 1NZCA 4HVOA 4NPLA 2PHRA 3VZKA 5GALA 2JG8C 2Y26A 3ZDVA 5KBFA 1ENSA 2OKXA 1XE8A 5LA0A 4XOGA 4A41A 1JZ6A 2XBO2 1JU4A 1Q43A 2D6NA 2ZGSA 2VZRA 4FCAA 3JB4C 4KU7A 2HWD3 4EROA 4Y4RA 5EYXA 1FPN3 1OUXA 1VBB2 1JYVA 1AYN1 3VHNA 5F37A 3WW2A 5FZ7A 1JZ3A 2Q1ZB 5B4XA 2PQQA 3VN4A 3EMRA 3N9LA 4XAEA 5BUVA 3D4KA 3OYWB 4Q0UA 4FOQA 3ITQA 5FZGA 1S0IA 2JEMA 1MEC3 3H8XA 2ZEXA 1F5JA 3RGBA 5A1LA 2A7AA 2ZGMA 1FI2A 3FMGA 5IWFA 4NIAA 5I0TA 3BTAA 1LOFA 1OVPA 2BFUL 1F35A 1WW5A 4NE9A 1Y43B 2ZXQA 5GLZA 1W2OA 3NNFA 3R05A 2YBKA 2VOVA 1ASJ3 3K2OA 4CU7A 1W2AX 3AXEA 5LBBA 2JIGA 1EPZA 2YPJA 1JH5A 3EBRA 2DCJA 1PGW2 1F15A 2ID4A 3IMNA 4ES9A 1K45A 1SFYA 4ORFA 1BMV1 5FZHA 2VTXA 2ZGUA 4EE2A 2JDKA 3VBUA 1F5FA 4D94A 3Q8CA 4EN7B 2AGSA 1ZBE1 2HKXA 4QHBA 3OUIA 3UKTA 2ZGOA 3KVAA 3A0KA 4CCKA 3S5AA 1H1AA 1UMHA 4XJ8A 1OFSA 3O1VA 2F4LA 2E6VA 5K0UC 2YUEA 5GLUA 2XVKA 3GNEA 4LLOA 5IVYA 3N9PA 5CAZA 5BY5A 1PNGA 2A6VA 2JDYA 4XUPA 3VBRB 3ZM8A 4OHYA 1U5ZA 5A7PA 2BNNA 4BQ5A 5JI7A 1AL0G 2RJLA 4LE4A 3TOJA 3NRUA 4E2SA 2HEYF 3DGTA 4X6RB 1D7PM 5DPNA 1GYKA 1W05A 4BQ4A 5FYTA 2BBVA 5EHDA 1LULA 3KM5A 3VBRA 3O1OA 4AQSA 4AEMA 2XJTA 4CVUA 1O3QA 2GNMA 4YFZA 5EFUA 4Q4V1 1PVC1 1APNA 1EUUA 3TAYA 5JXHA 2OUJA 3T30A 2OW4A 1QDOA 2BZDA 2X8KA 1CVNA 3C8XA 1JODA 1FNZA 2EVXA 2ZX2A 1VRH1 4QX3A 2Y33A 2VNRA 3H1YA 5ABJC 1YYNA 3K3NA 2D98A 4DINB 1LU2A 1UYXA 4QU2A 3ZKYA 3B01A 2ZZJA 4DUWA 4LKEA 2C0ZA 4XFAA 2VNGA 3ENRA 2W1QA 2FCVA 2PN5A 4I0WB 3HT1A 5DAPA 1AYN3 4QX2A 1VP6A 5CISA 3HIFA 1SFNA 2RR12 4Z07A 4PLOA 2RE9A 2UYAA 2ZHNA 4YW7A 3K4DA 5DDJ3 3VDBA 3R6SA 4CCOA 2UY8A 4GWJA 4OHWA 1UZZA 4KG0A 4HVQA 5IATA 3UESA 2EIGA 4UFMA 1DBNA 5IFPA 1G9BA 2CL2A 5F7UA 3VD3A 1I5ZA 1JN2P 5LB6A 2J1AA 1I3HA 4P02B 2E9QA 3MUY1 4QPIC 2W91A 5CKMA 3NKTA 4Z8BA 1Z78A 3INAA 2X05A 2VR4A 2JG9C 3O5SA 1US3A 3IDEA 1QDCA 2VZOA 2A6ZA 1HRV2 1C4RA 4MGKE 3R4SA 2LW8A 2YC4A 1V6MA 4XQWA 2GMMA 2AH2A 4XCBA 1XRUA 1G8WA 2GNDA 4NJ4A 5JXJA 3UGGA 5F6LB 4ES8A 5IFTA 3C7OA 2ZKLA 4K6BA 4XPVA 3OPTA 4BWOA 5LY1A 1T6GC 1HIXA 3T4VA 3O1PA 4Q8KA 2W1UA 1WCUA 3CHXA 1QWRA 1K5JA 1ZBE3 1WUVA 1XSQA 2HWC1 3OPWA 2OQ6A 1RUF1 4XF4A 4MG2A 4I30A 2DBIA 4CCMA 1RUC2 2VQ0A 5AC91 4MGSA 4WM8B 4S2DA 1EUTA 2XJSA 2R30A 3AKRA 4YVSC 4L11A 1X50A 2R1DA 4RS5A 1TNRA 3LOBA 1WKYA 1AJKA 4ZHNA 5FZCA 5L36A 1HB4A 1RUD2 1VALA 1CJDA 3WCSA 5DZFA 4L0PA 1YI7A 5FPLA 1UXZA 4WM8A 5FLIA 3CJIB 2IVIB 1ZA7A 2DVAA 1MQTA 1Q8VA 1BBT2 1QJY2 2NM1A 1ODMA 2NMOA 2VNVA 3B94A 5EV7A 1JOBA 1TMF2 3IDAA 1KRIA 1RXFA 1QKQA 1ZM1A 2HEWF 2YU1A 1SQ4A 3AZZA 2JG8B 1JYCA 3MGUA 4OZOA 3ZOIA 4ZZ8A 1TEIA 3I3BA 4PI0A 2D40A 4Q4V3 4R9BA 3ELNA 1PVC3 1IZ3A 2ZOEB 1NA1B 2GU9A 5DZEA 4OYUA 3WNPA 4E2QA 3HOBA 1OMIA 1O6UA 1VBD3 3EHKA 3RZZA 1S2EA 2OQ7A 2JG8A 3ST7A 1VRH3 3BOWA 4ZZ5A 2O8QA 1QJU2 2TNFA 1VBA1 5LK7B 4LJHA 3TNQA 3VBFC 4BQWA 2WZ8A 1I9RA 4QPWA 1X9TA 1VBE1 4QHZA 2WYFA 1NXD1 4JDMA 4YM1A 4YSFA 3PUQA 3G6JB 4Q0QA 2HWF2 1CAXB 1HW5A 1XJAA 2RS52 2VY0A 4PQQA 5CKQA 4TLGA 2R061 4LKFA 4X8PA 4Z92B 4OHZA 3VLBB 3JU9A 4NHKA 2Y0IA 1UU5A 4RFRB 2JDHA 3NJXA 1CAXA 3FBMA 4A7KA 2Y6LA 5LRRA 4MO3M 5FBJA 3OGGA 4RGAA 5J1XA 4CYDA 3LA7A 3OBZA 2F17A 4CSWA 3MFAA 2DVGA 2HWD2 3AP5A 3TYJA 1S0FA 1B35B 2VZPA 2I07B 3LFMA 2WWSA 4BQ3A 4AEDC 3NV4A 4YG6A 5JPNB 3V0BB 1J3PA 3ZYFA 1GZTA 4IV1B 4OCTA 3AMNA 4BIOA 1GNZA 2JKBA 4XTPA 3VZNA 1XSRA 1B35A 1MEC2 2DCZA 2QQPA 3R0RA 1XNKA 1CZVA 3KV4A 2CGOA 5LBEA 3V0BA 1VRBA 3WP5A 3RPQA 4IV1A 1UOFA 5JCTA 2Q1FA 3LF7A 2WFPA 3VBOC 5K0UB 4LKDA 2HWC3 1H9WA 3FX3A 4NO4A 5D8AC 4DFSA 1RUF3 2RDNA 2VOTA 1LTEA 3OSDA 4M00A 2P2KA 3H7JA 4OULA 4W4ZA 1ASJ2 3ATGA 4A6OA 1W9TA 5AC93 2C24A 2BGOA 1CD3G 4KL1A 5F2SA 4V1PA 2E7QA 2IFRA 3W59A 4CEWC 4XURA 3W58A 5K0UA 4AE2A 2E63A 1GQGA 4GULA 1NKGA 2GH8A 2JDNA 1OPMA 3E5UA 1MZEA 4O7XA 5IAVA 4B7KA 4N8MA 5LA2A 1W8ZA 2CY6A 2VMIA 2BTVC 3BCWA 3U10A 4BE3A 2PELA 3ZYHA 1ONAA 3LIHA 5FMOL 3S7EA 2H0VA 2WLPA 3WW3A 3B00A 4P9XA 4A3XA 3SKVA 3CJXA 3OEAA 1Q8SA 2VD7A 2VMDA 1N1VA 1LGCA 2B4KA 5FZMA 4AR2A 2JKXA 3ACGA 5FY9A 1A34A 1B09A 3K3OA 5FLHA 1W8WA 2DUQA 5GZGA 3PVOA 4XFCA 4GAZA 4QGNA 4YW3A 3FFQA 4NMIA 2ZGKA 4HVRA 5CADA 5FXZA 4A42A 1VMHA 2RJKA 4C90A 1Z7S1 3NNLA 1VBA3 1D4M1 2GNTA 4UW5A 4N7IA 2J22A 5C3RA 4WVVA 2XMLA 1VBE3 5FTTC 2IXJA 2VM9A 4AI0A 3N35A 4M3CF 5FOBB 2IWGB 5BNNC 2DCTA 1AR71 1ULGA 4PHZA 4H7LA 1OLQA 3BN6A 4MV2A 2D44A 4XE9A 3MFCA 4WBBA 3ZMOA 3WNLA 1ZZ9A 1DF0A 5IHRA 2R063 2V4AA 3KMHA 2GC3A 3CZJA 1O8SA 5G05L 3T0BA 2G9FA 5C3SA 4KMQA 5GZCA 4UT5A 2VECA 2FBEA 2JB8A 4LR4A 4QPIB 1RITA 3H8UA 3I3EA 3OBRA 4ZONA 1EPWA 5FRAA 1YFWA 4IEYA 5HBAA 1OD3A 2JG9B 4FQZA 2LTNA 2WNVB 3RJRA 4JGZB 1SMVA 2G1MA 1DLLA 2VXJA 2ET7A 3PU8A 1CJPA 3WOGA 3ZN6A 4BIFA 1OBNA 4QPIA 5D21A 4IXLA 1AYN2 1R082 4N53C 2VAUA 4UBGA 2JG9A 1CX4A 4XACA 4IV3B 2WNVA 2YY1A 4JGZA 5FZ4A 2EIEA 5DDJ2 1C8M1 3MLLA 3KCXA 1W90A 2QDNA 1NXMA 2QQLA 3U4SA 1PGSA 1BXHA 2GAUA 3WDVA 4BK5A 4FAGA 2JDUA 4I02A 4IV3A 1XYNA 3NMBA 1LR5A 3HNYM 5DG2A 1I5PA 5TSWA 1NX9A 3O1RA 2QTWB 5FYIA 4XETA 2EALA 1PX3A 1W04A 3ZLIA 3OUJA 4A45A 2K2SA 2VCBA 3WUCA 2BV4A 3HMYA 1MACA 3ILNA 4S2HA 4EV0A 4I3GA 1BMV2 4PIXA 2E51A 2D6LX 4PT6A 3M3QA 2HLEA 3N9OA 4K1ZA 3BTYA 5I8YA 1D2SA 1VAMA 3Q8AA 1KFXL 5FREA 5B4NA 1CAVB 1ZBE2 2CV6A 3GBWA 2ORXA 4Q1RA 4YPJA 4E4HA 3WDWA 5C8CC 4LNVA 2A6XA 2DVDA 3RZLA 1GOGA 4KNCA 1V9U1 4Y1UA 1QOOA 2MHFA 3CMGA 3JZVA 3I4IA 1DLCA 4F83A 3J7LA 2RG4A 1CAVA 5ANQA 4UAPA 1LGBA 2J1EA 3VBFB 4XUTA 2WFF1 3BU0A 4OI1A 2GSYA 1AX0A 3ZR6A 3N9NA 1QY4A 1Z7S3 3DPRC 1D4M3 3KV6A 1DGWX 3DKQA 1E5RA 3VBFA 1EV11 4CCEA 1I6XA 4LBQA 4XFGA 4NIHA 1UPIA 3WXPA 2P4EA 5F3GA 3BALA 4QB1A 5GZFA 1W6MB 4Q4V2 3AFGA 1PVC2 3Q8FA 1JMUB 3SKJE 1XXNA 4JHZA 5HXMA 2VZQA 2W08A 3FWEA 3USSA 1VBD2 2EF6A 4CTEA 1NT0A 1VRH2 1BCXA 5JZGC 3M1HA 3IKWA 3DYOA 1PO11 5H9RA 5JPMB 2PLV1 4AEDB 3SEEA 3ORJA 1H0BA 1RUJ2 4RN5A 3HNBM 1YJKA 1EYBA 3ZSJA 4LLFA 3DYPA 4E8CA 5A6YA 2QCSB 3RYKA 4KU8A 4P08A 1W6NB 2OVUA 3EYPA 3I2JA 4MHRA 3C3VA 5T54A 3RS6A 4AEDA 4HKLA 3LDBA 1LHWA 1DCSA 4PIZA 3GYDA 2P6HA 1C8M3 5FCCA 5T50A 1Y7BA 4G4FA 4B7EA 5F5AA 4OQ9A 4KGQA 2ZMNA 3I59A 1N1SA 5D8AB 4Q8LA 2P3KA 1NY72 4FO9A 5DAQA 1W6NA 1SLTA 2A73B 1S2BA 3VZMA 2YG0A 1OLMA 4XDOA 4Y24A 2JENA 5GZEA 3W21A 1W9WA 4HOOA 2JIJA 3CBNA 5D8AA 2JDZA 3E5QA 4XJZA 2YB7A 2R041 3M7AA 4JKKA 4CEWA 4E4SA 1WWYA 2P17A 3A0NA 3GCWA 3OGVA 1H8TC 4NAOA 1FXZA 5FYBA 1WMXA 1L7QA 3KSCA 1UWWA 2VNOA 2PHWA 5DUVA 4XMAA 1FYUA 2V72A 2WUHA 4RQPB 4AYUA 1H2MA 1O7FA 4A7ZA 5JOYA 3R4DB 4Y20B 4XFBA 5FZOB 3T2TA 2HWC2 2WL1A 5AFEA 1RB8G 4GWNA 1RUF2 1U5XA 2HBUA 3WHTA 2FDKA 3GCXA 3SCFA 2VVFA 5FZ1A 1U12A 1H2LA 1LOGA 1AJOA 4FOVA 1HDKA 2ORZA 4QXKA 4BISA 3VDDC 4RQPA 3POEA 1PM7A 3WG3A 2EIBA 2Y6GA 4FAHA 1XB9A 4FQ4A 3ZXGA 3AK0A 2D3PA 4C8DA 1RVF1 2WFF3 3UJOA 1E5IA 3WDYA 1AR81 3MIGA 4WV8A 2WO7A 4QKFA 3AYDA 3FHAA 4UFHA 5LBCA 3D3AA 4ARXA 3POWA 3KZ4C 4NVPA 3NAPB 3N7LA 1EV13 2VQAA 2YC2A 3CU7A 5FYUA 1ZNPA 4QB2A 4FFIA 4M4PA 2CAVA 2X53S 4BU2A 2Z2SB 1RMU1 4UFLA 4AF9A 5FPZA 4HXCA 4QKNA 1URXA 3Q8EA 1QNWA 4BLIA 1PNFA 1V00A 5LEJA 2FD8A 2R32A 4FFHA 1O5LA 3BB6A 3NQHA 4LO7A 2TEPA 3ZFGC 3RYPA 1AR91 1LKNA 5EJZB 1MVEA 5AC92 5FPXA 4AVSA 2W47A 1QOSA 1YQ6A 5B2GB 1XYPA 3VKFC 1PO13 1VMFA 1VBA2 2GH2A 5DAWA 2WZEA 2PLV3 3VZJA 5J48A 2B7YA 3B93A 5DN2A 1VBE2 2XR4A 3WF2A 4PDWB 4XQDA 4JHTA 3LEKA 4OUEA 5KHIA 2WSUA 4QQLA 2P6CA 2ZACA 4CP2A 4AXOA 1SDWA 4MZUA 5LW9A 1LHOA 2LRPA 5FZ6A 1GU3A 2WDBA 5A1FA 4NPRA 3CIHA 4Z2AA 4TZDA 2R062 3KF3A 3TEXA 2NP0A 2RS31 2Z42A 2E31A 3K75B 2P3YA 2VW0A 5JOXA 4LO4B 5IVVA 1KDKA 3BU7A 4CDUB 1V6LA 2C6SA 3LDRA 2WWUA 4YZ2A 2JDMA 4MXWB 4LO6B 3POSA 2HJIA 2JB4A 3UYJA 4BQ1A 3ZYIB 4UW4A 5CYYA 1W6QA 4B1MA 2ETEA 4CDUA 4XABA 4Q27A 2R043 1TME1 4MXWA 4AEJA 4WVZA 1JI6A 4FPKA 3VL8A 1GZWB 4CP0A 4D0QA 4QM8A 4QQOA 3LE0A 3WCRA 1GZ9A 1W9YA 4UFKA 2KR2A 4FI9A 2XL7A 5C8CB 3S0MA 1ZRDA 4JX0A 3DN7A 5H9PA 4L2NA 4LBOA 4ZU7A 3N3HA 3OCPA 2XGXA 3RWKX 1FAYA 2WBKA 1GZWA 3VKMA 2XLFA 5A6XA 4R9AA 1OXCA 4QPGC 5C8CA 5IVEA 5DAVA 1OKOA 4YNIA 3D6EA 3LPFA 4L92A 4QDRA 1OVSA 4QB6A 2OZJA 1HRI1 3HR9A 4XIKA 1RVF3 4IGQA 5C4WC 2AREA 2WQ8A 2E53A 2Q30A 4NWWA 1AR83 4OFGA 3NV2A 5FZDA 1XNCA 1G6NA 4N43C 5JOWA 1KJLA 5DABA 1YFXA 3AVSA 1Q56A 1ST8A 1N3PA 1XOYA 2D6KA 2R49A 3BGAA 3CKHA 3GJBA 1K5MB 4LULA 3W20A 4P5YA 3ZFFB 1LHUA 3POGA 1UY3A 4GQ7A 2B39A 2RVAA 2YXSA 4M01A 4CU6A 5CFDC 5IT6A 4XJ9A 5CIRA 1RMU3 1XPWA 4BM8A 2WC2A 3LOIA 1Q3EA 5EPAA 1IOAA 1K5MA 3S7IA 1KGYA 3AKTA 3HT2A 5DG1A 4BXFA 1AR93 1LRHA 4LBMA 1QJX1 1YC61 1WW7A 1PK6B 2BVVA 1Z7S2 5JZGA 4H2AA 4AI8A 4NROA 1LODA 5A6QA 2D93A 4RSUA 2LUWA 5FY7A 4BQ2A 4FPJA 1W6PB 5JXIA 2ZGTA 5FMBA 3UL2A 5BYNA 4Y5Z0 4Z1VA 3UKVA 3H8OA 1HXS1 3VHOA 5JR7B 4FPGA 5FP8A 1O8PA 1I1EA 3KV5A 1MZ5A 4QHOA 3EXUA 5JXGA 2RS33 1W6PA 1R1A1 2A3YA 4PIYA 3UT0A 1OUSA 4P9IA 5C3PA 2VTXJ 1GR3A 3WF1A 2XXZA 4RR3C 1W8TA 2EXIA 3J7NA 4WVMA 4D7SA 3O0WA 1RUH1 3CO2A 1G9FA 3H42B 3JQWA 1ND3C 3PL0A 4YG0A 5CKNA 4DUXA 3QOPA 1MS0A 1YFUA 5ERLA 1C28A 2ZJCA 1H8TB 4LBKA 2AACA 1AR61 4LK7A 1LESA 1TME3 2WT2A 4FPLA 5EJ1B 2R7EB 1V6NA 2CHHA 3IWZA 1CAUB 4CP1A 2WO2A 1C8M2 1X9PA 5HCFA 1T2XA 5C3QA 3KHBA 4EN0A 3AZYA 3VKLA 1MR5A 1M4WA 1H8TA 1NLSA 1AX2A 4E2GA 4FBFA 1OOPC 1QEXA 2OPKA 1CAUA 2ZGQA 1W2TA 4LE3A 1G86A 1SG3A 4JVAA 3SCHA 3WG2A 5JSRA 1JS9A 4QGMA 3T2PA 5F6KA 2DUOA 3AXDA 4Q0SA 1DU3D 3I3DA 3SH5A 1QU0A 3AP4A 2JDPA 1QQP2 3VDDA 3QH7A 3RWNA 1HB2A 1HRI3 2YFUA 3H1WA 3HN1A 4QT6A 4Y22B 1GP4A 1HJGA 3USUB 3VBUB 4CP9B 4D6RA 5LA1A 1W28A 2RMU1 4YLZA 4QDQA 3WEZA 1LOCA 4X6QB 2C4XA 3F2ZA 3K77A 3F95A 2Y60A 4Y22A 2AEYA 1FNYA 1J3RA 4AHXA 3USUA 4CP9A 1QJFA 4AK3A 3IBMA 3B5LB 4MSVA 1WLTA 4M4RA 3DXUA 2QDRA 4QWNA 1D4VB 3THCA 2P3JA 1PIV3 1YWKA 5HXVA 3G7DA 1IS6A 3WUDA 2PXJA 5C3OA 2K9ZA 4ZU5A 4Q0VA 2WFF2 2BBAA 1QJX3 2WO1A 3JCIA 4FSJA 4JGYC 3KQRA 2JECA 4TLFA 4COWA 4YGBA 5C6CA 4LKSA 3SHRA 5A33A 4AQ6A 4QQHA 4FTSA 1CPMA 1EV12 3WDUA 3ZYGA 3GXUA 2NLRA 4K8FA 4OLLA 2X5IC 4CCLA 2ATFA 2E33A 1MS3A 2XHNA 2ZBJA 1HXS3 4Z82A 2Q0AA 4HLTA 3PIJA 4AGVA 3O1SA 1F8VA 3K48A 2K0GA 3I3MA 2HBTA 1NQDA 1CZSA 5KHKA 1QJZA 1G9AA 3A7QA 1R1A3 1ZVFA 3ZXFA 1S2KA 1QF3A 5FZFA 2ZX4A 2CWSA 1SCRA 2NZ9A 2XVGA 5FZEA 1JUIA 4DXZA 1PO12 3LFIA 2P1BA 4NHMA 1PZ9A 2PLV2 1DGRN 1JU3A 1RUH3 2VZ3A 1J59A 3MW4A 3LAGA 2VUDA 1GP6A 4J25A 4LBQD 3LD8A 3KQ4B 4IETA 2XHKA 5D2AA 4JQTA 2PFWA 4G3YC 1AR63 1SDDB 1W8OA 4Y4YA 1W8NA 1X82A 5KHHA 1RUG1 1HQNA 3U1XA 4UFIA 3KCCA 4KWUA 2Q8OA 1RUE1 4QX5A 3HBZA 3RI9A 5JUVA 1NAEA 4A6SA 5JIUA 1T6BX 4IESA 5SV8A 3J26N 4K20A 3KT1A 2FMDA 2BPA2 2WIIB 3TBDA 1O3TA 4CU8A 2PHDA 5F9TA 4U36A 5FYYA 2VJXA 3H9AA 4OUMA 4FP3A 1TQ5A 4QPGA 3LCPA 2R042 4V2WA 4CCJA 3BVCA 2FDFA 2VBPA 2EXJA 1C8NA 4IEUA 3P6BA 1UOJA 5IAXA 1PGL2 2X29A 5EJ3A 1ZRCA 4JRLA 2QQIA 1BVVA 4QGLA 1UD1A 4B4RA 4EWAA 1DQ0A 5KWRA 1UIJA 2RMU3 1R091 3JQXA 4GMP1 4HN0A 2WQ4A 3IDCB 1AL21 1Q8QA 4N7UA 5K7PA 4N43A 4FTEA 2YFZA 4RD7A 2D6MA 3DF0A 5A80A 2V4VA 4LHKA 3MF9A 4G9SB 3WV6A 2D6OX 4XFHA 1NQJA 3NVCA 3A4UA 4RS5B 5CFDA 5JSOA 1UO9A 4FPOB 3MUZ1 1C3HA 3VBHC 1WLWA 2YMZA 4ZPIA 1AYM1 4QX0A 5CG8A 1RVF2 3AZXA 2ZZQA 3POJA 1ZZ7A 1AR82 1GLHA 1MQTB 1D2QA 1W0OA 2WWJA 1V0AA 2TBVA 1F2NA 4NN0A 3WF0A 4CDQC 2VCMA 5C7GA 4XXPA 1H1MA 5CNAA 4B4PA 1JYNA 3VD4A 1BYHA 1QOTA 1IPKA 1C57A 3LA3A 2Y6HA 3RZKA 5GM0A 2ZEYA 1UOGA 4EN6B 2ERFA 3PTRB 4KWLA 4QPYA 1RMU2 4M3CB 3GZUC 5L19A 2ZMKA 2BDRA 4GA9A 1W6OB 1YQ8A 2YPDA 4LK6A 4Y1YA 4ZS3A 1AR92 1REDA 1XE0A 2XJRA 1ND3B 2VULA 3WLUA 4ET7A 3KLSA 2JE8A 1HJFA 4M3CA 5GLVA 2QQNA 4RR3A 2J1UA 4V2VA 4EN9B 4QMAA 1UKGA 1W6OA 5IJRA 1QIQA 3NO8A 3SISA 5AFBA 5CFCC 4XIOA 2O14A 3HD8B 3WW4A 1BJQA 1ND3A 1W2NA 4MGZE 1Y4WA 2BNOA 3WQ0A 3M8LA 4D7TA 2W1WA 1GOFA 3RRDA 3POIA 5F39A 3BPSA 5L9VA 2ZA9A 1RUG3 2RS32 4QXHA 1RUE3 4QX7A 4LQRA 4C0HA 1W0PA 1XBFA 4LHLA 2UWCA 3RG0A 2W95A 1WLCA 3UGFA 3ZYRA 1OOPA 2VPVA 4IEVA 3ME2A 2WSVA 5DAXA 4MGIE 1UYYA 5H9SA 4INDA 3DL3A 2GDFA 3LGRA 2JE7A 3ZXKA 2A1XA 3ES4A 4O61A 1LCLA 3WNNA 1HQWA 1TME2 4LA2A 5H9QA 1RHI1 5F5IA 1FPN2 2RM21 3OGJA 3M2MA 1V6IA 4QU1A 4AGGA 4HT1T 2BWCA 1L7LA 5C71A 2IC1A 1ZZ8A 2B45X 4B3NA 1W99A 1R093 4GXLA 4GMP3 3P1IA 3C2UA 1AL23 1WCDJ 4YM2A 4KBBA 1XC6A 3KD4A 1JYWA 3DUIA 2RS11 5J96B 5FZ0A 2PAKA 3M3OA 5FMDA 1FT9A 5FY4A 5FP3A 2ZGRA 3U14A 2VGDA 4Q29A 1XNAA 3I54A 1L7RA 2H6CA 1UMIA 4LORA 2A71A 1HRI2 3AMMA 4JQRA 1OD5A 2IVJA 3L2HA 1KD7A 1FMD1 1ZZCA 2W94A 2WS91 5HI0A 5I91A 3X29B 1YUDA 2WN2A 4JGYA 5FZAA 2G9ZA 4FPFA 2CNAA 3WHUA 2VBBA 5IK4A 1NLQA 3DECA 2FZ2A 3PMSA 5LASA 1EAH1 1XNDA 3MW2A 2AYHA 1X36A 2QZ2A 2DYCA 1CONA 1HV1A 2JX9A 2JD9A 1IKQA 2BUKA 1ZZ6A 3RMXA 4MVTA 2EAAA 2OYZA 3N9QA 1PIV2 5EP9A 1BQPA 4A3ZA 5A6ZA 4LUKA 5BNQA 3RDIA 3W9AA 5FO8B 4LHSA 3FLRA 3CNAA 3FC0A 1QJX2 3VBSC 4AAXA 5ABJB 3FJSA 2IZWA 1HLCA 1UY1A 3U11A 3TB0A 1TG7A 3E1F1 5C5TA 5FBZA 5T52A 4RHV1 3ILFA 4F3JA 2WO3A 1SLCA 4QM9A 5C9AC 5ABJA 1HXS2 3OF1A 1ACCA 3EB7A 4COYA 4TSVA 4PBOA 4LTAA 4XF3A 5E89A 3UGHA 1TE1B 4FPYA 5IK5A 1SLIA 2C5DA 4URAA 2VL4A 2FQPA 1R1A2 5KXCA 3FLPA 2FHRA 2PHUA 4JKMA 3O0VA 3T0DA 3LQCA 2J1VA 4IEWA 2EXHA 5FZBA 1N3OA 3AMQA 3RMYA 3ZN6B 1O4TA 1UZ0A 1RUH2 4KI5M 2DTYA 4W6WA 4AQ2A 2EA7A 3VHPA 1RUNA 2KM2A 4GALA 2VUCA 4XHBA 3M4FA 2QQUA 2ZEWA 5FZ3A 5F5QA 2XWJB 5FKCA 1UY0A 3VHRA 1AR62 4CEYC 3O7OA 1W0NA 1RHI3 2RM23 4CDWC 4FOWA 1KDMA 3WINE 2RDRA 4IE0A 2QFEA 2QQJA 2ZPXA 4GB31 4UWDA 3CDZB 4LUMA 3SITA 2DF7A 3GF6A 4PBPA 3V64A 1Z0HA 3I2OA 2D43A 3AYCA 4FTBA 4XJAA 1SBEA 1ZBA1 4L9BA 2FDHA 4QXCA 4XAAA 2RS13 1ODNA 3VBHB 4XBNA 3OOXA 3QH6A 4CDXC 1BLZA 2C9KA 1U5YA 4FP2A 2WINB 4E9KA 4HKWA 1IG0A 1CX1A 2OZ6A 1A8MA 3ZN4A 4Y1VA 3FZ3A 4E8DA 4YVSB 2ZEZA 1LOBA 1WCKA 4CU9A 4TYSA 3JBG1 4LIUA 5KXDA 2XBO1 2N7GA 3VBHA 3T3YA 4WZFA 1FMD3 2WS93 3UV9A 2RMU2 1C5HA 1NE6A 4NIIA 4GKXA 2Q8DA 5KR7A 4FPEA 4YVSA 2P37A 1DGRA 4XJUA 2DDUA 2SLIA 3OD4A 4D6QA 1W3VA 2AZ5A 1ENRA 2PMWB 2VMHA 3BIEA 3HAGA 3MV01 4GWIA 1EAH3 5HV4A 2BW8A 2UWAA 2ZHMA 5FYHA 2GC2A 5SV5A 4AHZA 4E27A 3VD9A 3GZTB 3WP3A 2WZPP 1J3QA 3LDKA 1QXRA 4LOSA 4CCDA 3KCYA 1H1IA 3ABZA 2IUWA 2AC1A 4DUVA 1GNHA 1CIWA 5FYCA 5IK7A 4BCUA 1O4YA 1DHKB 4YGCA 3OY8A 1ULOA 3FHIB 2Y6FA 2QQWA 4HFSA 3UETA 5L7OC 5DMYA 4FFGA 4LBQB 2ZGPA 5CG9A 2ARBA 1JXNA 2OS2A 3WQBA 5BNPC 3POBA 4RHV3 5CFCA 3WY6A 3KT4A 1GSLA 1K3IA 1RL3A 3P3NA 2MNGA 4AHWA 4C0BA 3T2QA 2F6BA 4GD4A 1ALYA 3B7MA 2KD7A 4N9HA 1R64A 2CDOA 5FXVA 3C7EA 2W87A 2ET1A 4AVBA 1AR73 3NV3A 4URTA 5FYVA 3SCGA 1AUYA 3I7DA 4BQYA 2ZCWA 3IIAA 5CA6A 4JAAA 5FZIA 4AVTA 4MX3A 3C7HA 2XOMA 5FPAA 4LT5A 4L97A 1L3JA 2IXHA 2J1SA 2GNBA 2VVEA 3K46A 5FXXA 1YQ2A 2ARAA 3HQUA 1VPHA 4XDQA 3LIGA 3THTA 1JZ4A 4HANA 3PNAA 4ASLA 1PMJX 3K4AA 5BNOC 4DZGA 3TEYA 1H6XA 3I59B 5FPUA 1RGSA 2XQXA 1YI9A 1LHVA 4YW5A 1RUG2 4FT8A 2D5HA 4IE4A 1WBFA 4GB33 2F4PA 2GP3A 1QHDA 1TZOA 1ULFA 1GUIA 2Q4SA 3MHZA 4XCAA 3VBOB 1DZQA 2WABA 3LEMA 4YW4A 3KS7A 1HB1A 4KG8A 2D6PA 5G04L 5C33A 4CEWB 3IDBB 4CUGA 4UBHA 1AZDA 1VIWB 3H7YA 1Y9QA 3VBOA 1EP0A 1GOHA 1S0BA 3QCWA 4LO5B 4AVVA 3JBG3 1YHFA 1S0GA 1LOEA 2V5YA 4ZXKA 3QBQA 3VKNA 3ZDSA 5A3OA 5FP9A 3E6CC 4DXSA 1BHGA 3HWJA 1R092 3GM8A 3J7HA 2BOIA 1AL22 2CSGA 1DQ2A 1YEWA 1V6OA 2HWE1 3QD6A 2Y6KA 3D5OA 1YFYA 4WM7C 3WR0A 4C1WA 5FKBA 2W3JA 1OA3A 3HN3A 5AVPA 5FZLA 5EWSA 2H0BA 2XB6C 2HWB1 4J6GA 5FLJA 3O12A 3U0ZA 1S4CA 2GALA 4AI9A 4HN1A 3GBFA 1N1YA 2VG9A 2XKPA 4K8RB 3N7MA 2R071 3NWKA 1GNYA 4DY3A 4MGTA 1V9U3 3I2IA 1GWKA 4S2FA 4BXSV 5KHJA 1VLNA 4IDZA 3OBAA 3V65A 3VBSA 5C9AB 4O9EA 5DZGA 1QH6A 4MGYE 3U4XA 1O4ZA 1XNTA 4XBQA 4QAWA 5T3NA 4BMEA 3O1UA 1LU1A 2IXKA 5LBFA 2BQPA 2QQMA 5FJKA 3THPA 1GFF2 1AF9A 5BNNB 3B9CA 3S30A 4B8EA 5C9AA 3NL1A 3GZAA 3A23A 2XUMA 2B5HA 3H8RA 3PMEA 2D3RA 3SQOA 2R0FA 2R16A 2QBXA 4MOAA 4IW3A 1LOFC 3PUHA 2KXLA 2UWBA 1KS5A 5BNNA 5I8SA 4N90A 3TEWA 1SHWB 2ADDA 5F5CA 5A32B 4Q4Y1 5E16A 3POYA 3ETQA 1G7YA 1OT5A 3MEPA 3NSTA 4IEOA 4AW7A 5F3CA 4K3UA 2CAUA 5FPBA 1SPPB 4CEYB 4XZPA 3PU3A 2FDGA 2WYSA 5F3IA 2GP5A 3QLQA 4XEZA 5DXDA 4N53B 2YGMA 4CDWB 5A32A 4E4ZA 1P8JA 3PDQA 1RUD1 2C26A 2I2SA 1UU6A 4BQXA 5BV6A 2X09A 4IGOA 4Y3OA 3T2OA 2KA3A 1K42A 2DV9A 2JICA 1H6YA 1SPPA 1UY4A 4ZY9A 4CEYA 1HQLA 1UKRA 4AI3A 1NYWA 5JDBA 4YZ5A 1UX7A 4N53A 2XWBB 4CDWA 1S55A 2VVDA 3D82A 4FPCA 1JZ5A 1RJ8A 4YZ4A 2YC0A 1RUOA 4IE5A 4MHUA 3WDTA 1PHMA 4DEQA 3PIGA 1W6QB 3VD5A 1UOBA 1UQXA 1YQCA 2YGLA 1A3KA 2L9LA 2Q8CA 2RDSA 1LB2A 1WGPA 4FFFA 4CDXA 1UMZA 4FXGB 1GWMA 4I0AA 2ZAHA 2XLGA 4YFWA 5K8SA 4MGQA 1O3SA 2JE9A 1RHI2 2DURA 2WT1A 3M70A 5FUIA 5T5PA 2WLQA 4NRQA 4RFT0 3T1MA 4YZ1A 4NPMA 3NNJA 4EJRA 3WNKA 2YZ4A 5EYYA 4ZS2A 1M06G 4DXTA 4WZCA 2B42B 2WZR1 2HWE3 2PTMA 2WR9A 4LPLA 1UX6A 4QD2A 5J09A 5JLVA 5FZ8A 1W9FA 1HB3A 2RS12 3T08A 4CXXA 2HWB3 2W92A 2BP6A 1OLME 1YXWA 2D97A 1DYPA 1CR7A 5L7OB 4NAMA 1RYYA 2V09A 3AB0A 3ON7A 2D3SA 1US2A 3MLKA 4UF0B 2R073 2XJUA 4U2AA 4HSLA 2BYVE 3ZSKA 5BNPB 5I0RA 1FMD2 1MS1A 2WS92 5F8PA 3ZYJB 2NQYA 2OT7A 3CL1A 3DPRB 1PVXA 5C8WA 1VE0A 2IXLA 2XL9A 2XH6A 1NLRA 2ZHKA 4AL9A 1X8EA 4DEVA 5L7OA 1XU1A 2UY9A 4UF0A 1MZFA 1EAH2 3JD71 3WNOA 5BNPA 3WF4A 1LOAA 3DPRA 4R52A 1IS4A 4HPKA 1YIFA 5LY2A 3ZPYA 5FK7A 3UJQA 5IK8A 2MEV1 4KQ7A 4DS0A 4DY5A 4PJYA 1LEMA 4XUOA 4YGEA 4JDOA 2AR6A 2OIIA 3AC0A 3PJYA 5JZGB 5JMCA 1PO21 4Q4W1 1H4GA 5A3WA 4I2OA 3I8TA 4IEPA 4Q4Y3 4YYOA 1UXXX 4TWTA 4XC9A 3L2YA 3TEZA 3E6DA 3LSEA 1O3RA 1LEDA 5LA9A 5BNOB 3GZEA 4AOCA 4IL7A 4RHV2 3LB9A 4MLOA 3KB5A 5J36A 1D4M2 4I0BA 5T5OA 1W39A 1ULEA 3KT7A 5A7SA 4YRDA 5FQ0B 2W46A 1F31A 1WBLA 3K4ZA 5FY0A 5BNOA 4XUNA 1JOJA 2PYTA 2QVSB 5FY8A 1AR72 3J8F1 1NCQC 4WVMB 4DRVA 2VXRA 1HN0A 3V56A 3C7FA 5FQ0A 1UYZA 4LOTA 1BEV1 1XU2A 4OMDA 4Y33A 3AJZA 1CN1A 1V6KA 3MF6A 4COZA 4XFIA 3AP9A 4A7YA 2WNEA 1GBGA 2GN3A 1H9PA 2QZ3A 3GALA 2GC1A 1PZ7A 4BDVB 1K12A 3NNGA 3DCQA 3SMHA 3GHNA 3ETPA 2ZKNA 4P5HA 2HYKA 4BH9A 1UNBA 1OF3A 1AHSA 1NZIA 2Y8KA 5FUPA 4GB32 3MW3A 1E57A 3U78A 3RQ0A 1S0JA 3CJIC 2WZR3 1W3XA 3LWCA 4D69A 1RUI1 3SH4A 4K1YA 4CUCA 4WM7A 3RZHA 5DQ0A 1MPXA 5EIYB 1N3QA 1WMFA 1Q5OA 2HH9A 3SEPA 4GWMA 2YBPA 4K40A 3MO4A 2Y64A 1REFA 2E7TA 4XUQA 3VDDB 5A1AA 3B3QE 1NA1C 3JBG2 4JZRA 3D8CA 5JR2A 4K7JA 4ITCA 2QUOA 3CQOA 2VC9A 2WA4A 1GICA 4HL0A 4A2UA 4OI0A 3I2GA 2A5ZA 1DFQA 2DTWA 1NOVA 1R081 3ZXEA 3T1LA 3MI8A 1SFPA 3CLPA 3Q9OA 2VOWA 1S0CA 4KH9A 3JD73 4GZ9A 4XF0A 5JWPA 3S57A 5DDJ1 3J9SA 2IXIA 3ZXAC 5A3LA 1FV2A 1POV0 1C1FA 1KS4A 1BK1A 1ZA4A 4AG4A 2MEV3 3BPZA 2JDAA 4KBZA 2P5BA 1WA4A 3P5BA 3Q8BA 3HBKA 4OZXA 3ZFGB 5A3MA 5J37A 1V9U2 3OYWA 4LEJA 3M3CA 3WT3A 1PO23 4Q4W3 5A33B 3RFRA 4EZHA 1MS4A 4HK8A 4P14A 5FAXA 4AFMA 4OHXA 4IE6A 4NWVA 3ZFGA 4AFAA 5FWJA 2AEZA 2UYBA 2Y0OA 2R0HA 5E1RA 1B35C 3CZUA 2WNUC 4LBJA 1WCSA 5IYYA 4IV1C 2JXAA 1HX6A 2E7AA 3H3UA 2ZX0A 3PUSA 5J7MA 3D0SA 3WQ7A 3J8F3 1QJEA 4YW1A 2XQRA 3WQ1A 5LEKA 1JYTA 4NHYA 3J7MA 1CWPA 4XXAA 1F4AA 3WF3A 5FJHA 1BEV3 2G19A 4NIGA 3KVBA 3ZFEC 1JHNA 1DGLA 3NJVA 3VL9A 1WLDA 1JOPA 4TN7A 4YM0A 1X8MA 1RJ7A 4ISRA 3WSOA 2XPJA 3WX5A 4Y26A 3URFA 1A6CA 4JV4A 2O0OA 2YV8A 5I0UA 3RVHA 3OUHA 1DIWA 5A7OA 1GWLA 5JSPA 1DQ6A 1GQPA 5FOJB 3NNMA 3N9MA 4IUGA 3SNMA 3IB3A 3MICA 5GZDA 4IEXA 3W5NA 1XNBA 3O0XA 2J1RA 3RNSA 2OPWA 3IPVB 1RUI3 2WJSA 2VZUA 5L9BA 3ZSMA 3N4MA 5DUXA 4QPGB 1MS9A 3MV11 5CVRA 1VBD1 3HVDA 4LBNA 5FZKA 4XDPA 2PHXA 1CPNA 3AKPA 3ACLA 3B9IA 3IPVA 1OQDA 4UYBA 3FUOA 1CZTA 1YO8A 3LA2A 1ZRRA 5C4WB 1RUJ1 1VBC1 2ILMA 2Z69A 4N43B 4DPNA 4QKBA 1HN1A 4LXLA 5AVAA 4DQAA 4EWDA 3ECQA 1PMIA 1R083 4KWKA 2HWE2 3LKJA 1JUHA 4CXYA 4QQ2A 2ZMLA 3OBTA 4GJZA 4HETA 5C4WA 4DOUA 1JZ2A 2BNMA 5CFDB 1IS5A 2HWB2 1UIKA 4OQ8A 5D1IA 4AQTA 3BUCA 3H50A 3DV8A 1ZZBA 2CWMA 4LBLA 4CE8A 3RZJA 1NY71 3WDXA 1N47A 4EN8B 1JYIA 4XYXA 4TTGA 2R072 1SCSA 4BB3A 5BPXA 3EQEA 3KHCA 4Q2FA 3WG4A 1UN1A 2PAEA 4BOWA 4YM3A 2WNVC 4JGZC 4NOTA 1POQA 2W1SA 1U0AA 2VMCA 4EWEA 3B69A 1FATA 4COVA 2W52A 3ZYPA 1XE7A 1DQ4A 2BFUS 3HNMA 3KGLA 1W06A 1NCQB 3OGRA 3H1MA 5E6HA 5A3NA 2D5FA 4IV3C 1SLAA 2TUNA 3VKOA 5ANNA 2Y34A 2DU1A 4HBNA 5GLWA 2BJSA 5FFOC 5HCHA 3I49A 5M0TA 3ALQA 3FUQA 5ACA1 2OA2A 4Y5TA 3RYRA 4RR3B 3N7JA 1NCQA 5F32A 4Q4Y2 3WZ1A 1JTZX 4META 5APAA 3LPGA 5A3TA 2Z4FA 4IGPA 4XBLA 3O1MA 3RZGA 3ILRA 3AYAA 1REEA 4QXBA 1WMDA 3AKSA 2RHPA 4QX1A 1OI6A 5GJ6A 3SLIA 2ZGLA 3IZOA 1OPOA 2QJVA 1PX4A 4JKLA 4AEKA 4ZXEA 1DP0A 1JBCA 3ROUA 3GGLA 1OH3A 1AX1A 1JHJA 1LHNA 3IMMA 3LSDA 1ZREA 1J1TA 3N36A 4K21A 2WNOA 3BIWE 3LZZA 3BTXA 1MVQA 1FX5A 5FDBA 2XONA 2ZS6B 1HKDA 1JYXA 1WW4A 2A6WA 2VOXA 3IT8A 4H7MA 4GH4C 1OOPB 1ULPA 4Q4X1 2B9UA 4M0HA 4P00B 4XILA 5LZ6A 1WZXA 3IAPA 1FV3A 3CJIA 4NUBA 4XZUG 4CCNA 2FMYA 3VGIA 4A44A 4P9JA 2Z5WA 5FK8A 5I8TA 1VAKA 3MBWA 5FR3A 1Y9GA 1O5UA 1O91A 3HEIA 2DCYA 4MUVA 4Y5SA 1GMMA 5FP4A 3TWIA 1NA1A 1RUJ3 4FPHA
chains in the Genus database with same CATH topology
1VBC3 3OTFA 1QXPA 3ZIWA 3ZSEA 1DZTA 2WZR2 5I0SA 5T5JA 1H2NA 1SBFA 2PA7A 5JI9A 1MS8A 5EZWA 1WD4A 5HCAA 1N1TA 4AWDA 4Q26A 2AENA 3CEWA 1H30A 5KXEA 2O8OA 5BXXA 2ZGNA 3FBYA 4RA0A 4JGYB 2R6QA 1COV1 1UF2C 3ASIA 2C9AA 2ZTNA 1SACA 2WNUB 1AYM3 1BKZA 3MIFA 3WVJA 4J1WA 2X5IB 3JD72 4E4DX 3MLJA 1V70A 2QE3A 2DFBA 1H4HA 1AVBA 2BWAA 3DKWA 4W6YA 2WNUA 3PVEA 1SBDA 1D0HA 2MEV2 4RGGA 3BODA 2X5IA 3ZFEB 1F9KA 1QMJA 5ACA3 1YIPA 1YNAA 4R9CA 4UXAA 3UK9A 1PO22 1XYOA 4Q4W2 2Q1MA 2C1FA 1DG6A 1FOD1 3ZFEA 2O1QA 5CU1A 3JUUA 4OI4A 1DGWA 2WT0A 2PHTA 1EY2A 5JVVA 2GN7A 1MZ6A 3M3EA 1Q8PA 3WP6A 3J8F2 3AP6A 1J58A 4XQ4A 4OVEA 2Z79A 4OI2A 4Q4X3 4CRQA 1OLRA 4I01A 1BEV2 3TN91 3WG1A 4IERA 3AFKA 4RQPC 1X33A 4M3CE 1IKPA 4MH0E 3WNXA 3K51A 3N7KA 4GKYA 4BA6A 2A70A 3ZX7A 4FOYA 2DFCA 4XJWA 3WP4A 4B29A 1KQRA 4YW2A 3HQXA 5L73A 3U07A 2A75A 3O14A 4DNYA 2W39A 3EO6A 2SBAA 1J1LA 2UU8A 4MXVA 2NN8A 1DZRA 3R4UA 2UURA 1CAWB 3GHMA 5EXOA 1UCXA 3TRSB 3SH3A 3ZVXA 3NAPC 3MIBA 4HMZA 1RUI2 2VW1A 1X7NA 4BLJA 2XJPA 4AVCA 3AYEA 1CAWA 1ND2C 4I09A 4YARA 4H3WA 1S0EA 4OUSA 4UW6A 4XF1A 2VU9A 4M0NA 3MPPG 3AMHA 2WA3A 5JOZA 3PLQA 1A78A 4NR1A 4YG3A 3WD5A 4L8QA 1G9CA 1ZRCA 2AUYA 1COV3 2BVBA 2GMPA 4YZ3A 4CDQB 1VB4A 4COUA 3AX4A 5K9YA 4FVVA 5DUWA 3OJBA 1RC6A 2G9GA 3AM2A 3FE5A 1SLBA 4PDWC 1VBB1 4CDQA 2ENRA 1ULDA 1IGOA 5IUQA 2XKOA 5LRSA 2H6BA 3KGZA 3OY8B 3MIDA 1YRZA 4ZKTB 4CDUC 1NG0A 1NCRC 4YVWC 5CFCB 1OHFA 2DVFA 5KHGA 1FOD3 1QQP1 1UPSA 2Q5TA 1VJ2A 4O9GA 4WVWA 4YGDA 4ISQA 4H55A 1ZX5A 3VUOA 1PGW1 4OHVA 4GH4B 2VMGA 3MPBA 4C91A 1KFUL 1CESA 4AI1A 3CF6E 1AXKA 1IS3A 2XVLA 1VR3A 3WW1A 1W2UA 2B8MA 4GH4A 3TN93 2V73A 3E5XA 3AMPA 5HCBA 3H0OA 3J4UH 1OKQA 1Q8OA 3AZWA 5FMOS 5J98B 3M3IA 4J1XA 3ES1A 1GKBA 4AFDA 1ENQA 2YYOA 1BZWA 1POV1 4N9IA 1QXJA 5GKAC 1UZYA 2VW2A 2I74A 5FO7B 3VZLA 4HK9A 3SXWA 5KXBA 2PAMA 1OSGA 1DYKA 1GZCA 2B46X 1RUE2 1K5MC 2I45A 2DCKA 1SEFA 3ZFFC 3PVNA 4GMP0 1IHMA 1ZBA3 2BGCA 1VB2A 1W6MA 3FFZA 4C1XA 4AHYA 4DRRA 1YCIA 3ZO0B 4W65A 4XW3A 4XHXA 3ZMNA 1CGPA 3NW4A 1VBC2 3RJ2X 4LO8A 1PK6C 1IQAA 2XBO3 4SBVA 3NV1A 4XMIA 1YLLA 2ES3A 3ZXDA 1GV9A 4H14A 1VBB3 3EJKA 4KWJA 2D7FA 1D0GA 4JTNA 2RR11 2VUAA 5KC6A 2LM3A 4IEQA 3S6PA 4L99A 4BYYA 2LALA 1QNYA 1UU4A 4JDNA 2DU0A 1PZ8A 3VBSB 3ZN5A 3TNPB 1WMEA 1QGLA 1SLLA 1AYM2 2G4IA 1CQ9A 2FZ1A 2XLAA 4DMIA 4F8AA 3AKQA 5JIAA 4FXKB 1QQP3 4HSJA 2CTVA 4R8HA 1PGL1 4LA3A 4XF9A 4PCRA 4F7ZA 1BVP1 1HRV1 4AFBA 4I3PA 4BZ4A 2W68A 2A3XA 3E97A 2WQZC 1KITA 3L9JT 4XTMA 1R1ZA 1WW6A 5CBLA 5ACA2 3ZXLA 1KXGA 5JAXA 1V6JA 3D0JA 2DWRA 4P9WA 4Q0PA 5LK5A 3IN9A 2DVBA 2CYFA 4Y20A 1RUC1 3MZHA 2XG3A 5J3UA 1H2KA 1ZRFA 2XJQA 1OA4A 1POV3 2VOKA 2EAKA 3VBUC 2JD4A 2P34A 1S0DA 1ND2B 5T55A 4Q4X2 3AJYA 4RL7A 4ASMB 5F1RA 2IXCA 3QACA 3ZIXA 1BBT1 1QJY1 1RTVA 1TMF1 3NAPA 4P9YA 2GC0A 2YHJA 3OD0A 3GBGA 4CDXB 2Y38A 3OPZA 1UL9A 4CZSA 3PTYA 1ND2A 2WKKA 2IFWA 1OA2A 1C5IA 4XFFA 2EXKA 2R1BA 1DQ1A 1QJU1 1DQ5A 2RM22 2ZHLA 3E6BA 2GZWA 4JTOA 4R4ZA 1JW6A 2A6YA 4Y1XA 2HEVF 4AVAA 5JIUA 4HZFA 2VH9A 3VBRC 3IM0A 1GANA 1TNFA 2MPFA 4P9GA 4R4XA 2W0XA 2CGPA 4PDWA 4ATFA 1A8DA 2HWF1 3MYXA 2ZX3A 2RR13 2RS51 1GQHA 3RI8A 4QQPA 4DB5A 1Y3TA 2ZABA 4MYEA 1NCRB 4AGRA 5T5LA 1YJLA 4YVWB 4ONUA 3P3PA 2VUJA 1RINA 4GIQA 1COV2 1QH7A 1S1AA 3MIEA 1VAVA 2DUPA 1NCRA 3AP7A 1UW8A 2HWD1 4HKOA 4IEZA 4YVWA 3RSJA 3V0AB 2ZAAA 1FPN1 5I93A 4HPKB 3NJZA 1HRV3 2BEOA 4JCKA 4D3WA 2GMEA 3ZXJA 2PHFA 3V0AA 4PF5A 3NKGA 2YDEA 1MEC1 4BMBA 3APBA 4ZU4A 1WD3A 2QNKA 5E8AA 3AZVA 5DUUA 4AFCA 1AXYA 4BHPA 1KJRA 1H8VA 1OQEA 2A3WA 3VZOA 1FOD2 5KC5A 1ASJ1 3H3ZA 1RUC3 3PVBB 2ARXA 1NE4A 4P9LA 4Y1ZA 1ENXA 1OQ1A 2P3IA 1HV0A 4PLNA 1AXZA 3JB8A 1LENA 4JRAA 2OUHA 1DDLA 3UKNA 1LGNA 1RUD3 2PHLA 4X8NA 4K9SA 3B02A 3I2DA 2NYYA 1MS5A 2CGNA 2QKDA 1BBT3 1QJY3 3MIHA 4JC1A 3TN92 4PLMA 1TMF3 1RIRA 1OFNA 4S2GA 1LECA 1PIV1 4NHLA 3VV1A 1IPJA 1UAIA 2YROA 2ZX1A 3ZFFA 2JJ6A 4W6XA 5GLTA 4PQ9A 4RS5C 2XJVA 3PHMA 1LJ7A 1XQNA 4R9DA 4B4QA 1ULCA 3ZSLA 5FO9B 4WM8C 5E88A 4SLIA 1QJU3 4Q1PA 1MQTC 4UW3A 1C1LA 1ZYBA 4D7YA 1PK6A 4WM7B 4AI2A 4KGGA 3BOPA 1U5IA 3FLTA 5CB7A 4ATEA 4LHNA 1G9DA 3PJQA 2HWF3 3MDPA 4BPZA 2RS53 4IQPA 1ZBA2 2NMNA 2NPIA 1NZCA 4HVOA 2PHRA 3VZKA 5GALA 2JG8C 2Y26A 5KBFA 1ENSA 1XE8A 4XOGA 2XBO2 1Q43A 2D6NA 2ZGSA 4FCAA 3JB4C 4KU7A 2HWD3 4EROA 5EYXA 1FPN3 1VBB2 1AYN1 3VHNA 3WW2A 2Q1ZB 2PQQA 3VN4A 5BUVA 3D4KA 3OYWB 4Q0UA 4FOQA 1S0IA 2JEMA 1MEC3 1F5JA 2A7AA 2ZGMA 1FI2A 3FMGA 5I0TA 3BTAA 1LOFA 2BFUL 1WW5A 1Y43B 5GLZA 3R05A 2VOVA 1ASJ3 3AXEA 1EPZA 2YPJA 1JH5A 3EBRA 2DCJA 1PGW2 3IMNA 4ES9A 1SFYA 4ORFA 1BMV1 2ZGUA 3VBUA 1F5FA 4D94A 4EN7B 2AGSA 1ZBE1 2HKXA 4QHBA 3UKTA 2ZGOA 3A0KA 1H1AA 4XJ8A 1OFSA 5K0UC 2E6VA 2YUEA 5GLUA 2XVKA 3GNEA 4LLOA 5CAZA 5BY5A 1PNGA 2A6VA 3VBRB 4OHYA 1U5ZA 2BNNA 5JI7A 1AL0G 2RJLA 4LE4A 3TOJA 4E2SA 2HEYF 3DGTA 4X6RB 1GYKA 2BBVA 1LULA 3KM5A 3VBRA 4AQSA 4AEMA 2XJTA 1O3QA 2GNMA 4YFZA 5EFUA 4Q4V1 1PVC1 1APNA 3TAYA 2OUJA 2OW4A 1QDOA 2X8KA 1CVNA 1FNZA 2EVXA 2ZX2A 1VRH1 2VNRA 3H1YA 5ABJC 1YYNA 2D98A 4DINB 1LU2A 4QU2A 3B01A 2ZZJA 2C0ZA 4XFAA 2VNGA 3ENRA 2PN5A 4I0WB 3HT1A 1AYN3 1VP6A 3HIFA 1SFNA 2RR12 4Z07A 4PLOA 2RE9A 2UYAA 2ZHNA 5DDJ3 3R6SA 2UY8A 4OHWA 1UZZA 4KG0A 4HVQA 2EIGA 1DBNA 1G9BA 2CL2A 1I5ZA 1JN2P 1I3HA 2E9QA 4QPIC 3NKTA 4Z8BA 1Z78A 3INAA 2JG9C 3O5SA 3IDEA 1QDCA 2A6ZA 1HRV2 1C4RA 4MGKE 3R4SA 1V6MA 4XQWA 2GMMA 2AH2A 1XRUA 1G8WA 2GNDA 4ES8A 5F6LB 2ZKLA 4K6BA 4XPVA 4BWOA 1T6GC 1HIXA 4Q8KA 1QWRA 1ZBE3 1WUVA 2HWC1 1RUF1 4XF4A 4I30A 1RUC2 2VQ0A 5AC91 4WM8B 4S2DA 2XJSA 2R30A 3AKRA 4YVSC 4L11A 1X50A 2R1DA 4RS5A 1TNRA 3LOBA 1AJKA 5L36A 1RUD2 1VALA 1CJDA 3WCSA 5DZFA 1YI7A 4WM8A 5FLIA 3CJIB 2DVAA 1MQTA 1Q8VA 1BBT2 1QJY2 2NM1A 2NMOA 3B94A 5EV7A 1TMF2 1KRIA 1ZM1A 1QKQA 2HEWF 3AZZA 1SQ4A 3MGUA 2JG8B 1JYCA 1TEIA 4Q4V3 2D40A 4R9BA 3ELNA 1PVC3 1IZ3A 2ZOEB 1NA1B 2GU9A 5DZEA 4E2QA 1OMIA 1VBD3 3EHKA 3RZZA 2JG8A 3ST7A 1VRH3 3BOWA 2O8QA 1QJU2 2TNFA 1VBA1 5LK7B 3VBFC 3TNQA 1I9RA 1VBE1 1NXD1 4JDMA 4YM1A 4YSFA 3G6JB 4Q0QA 2HWF2 1CAXB 1HW5A 2RS52 2VY0A 2R061 4X8PA 4Z92B 4OHZA 3VLBB 3JU9A 4NHKA 2Y0IA 1UU5A 1CAXA 3FBMA 4A7KA 5LRRA 3OGGA 4RGAA 4CYDA 3LA7A 3MFAA 2DVGA 2HWD2 3AP5A 3TYJA 1S0FA 1B35B 2I07B 2WWSA 4AEDC 3NV4A 4YG6A 5JPNB 3V0BB 1J3PA 4BIOA 4IV1B 3AMNA 1GNZA 2JKBA 4XTPA 3VZNA 1B35A 1MEC2 2DCZA 2QQPA 3R0RA 1XNKA 2CGOA 3V0BA 5JCTA 3WP5A 3RPQA 4IV1A 5K0UB 2WFPA 3VBOC 2HWC3 1H9WA 3FX3A 4NO4A 5D8AC 4DFSA 1RUF3 4M00A 4OULA 1LTEA 2P2KA 3H7JA 1ASJ2 3ATGA 5AC93 4KL1A 1CD3G 4V1PA 2E7QA 2IFRA 3W59A 4CEWC 3W58A 5K0UA 4AE2A 2E63A 1GQGA 4GULA 2GH8A 1OPMA 3E5UA 1MZEA 4B7KA 2CY6A 2VMIA 2BTVC 3BCWA 3U10A 4BE3A 2PELA 1ONAA 5FMOL 3S7EA 2H0VA 2WLPA 3B00A 4P9XA 4A3XA 3CJXA 1Q8SA 1N1VA 1LGCA 1B09A 5FLHA 2DUQA 5GZGA 3PVOA 4XFCA 4QGNA 4YW3A 3FFQA 2ZGKA 4HVRA 5CADA 2RJKA 4C90A 1Z7S1 1VBA3 1D4M1 2GNTA 4UW5A 4N7IA 4WVVA 1VBE3 5FTTC 2IXJA 4AI0A 3N35A 4M3CF 5FOBB 2IWGB 5BNNC 2DCTA 1AR71 1ULGA 4H7LA 1OLQA 4MV2A 2D44A 4XE9A 3MFCA 4WBBA 3ZMOA 1ZZ9A 1DF0A 2R063 3KMHA 2GC3A 2G9FA 5GZCA 2VECA 2FBEA 4LR4A 4QPIB 1RITA 3H8UA 3OBRA 5FRAA 1EPWA 1YFWA 4IEYA 5HBAA 2JG9B 4FQZA 2LTNA 2WNVB 3RJRA 4JGZB 1SMVA 1DLLA 2ET7A 1CJPA 3WOGA 3ZN6A 4BIFA 4QPIA 4IXLA 1AYN2 1R082 4N53C 4UBGA 2JG9A 1CX4A 4IV3B 2WNVA 2YY1A 4JGZA 5DDJ2 1C8M1 3MLLA 3KCXA 2QDNA 1NXMA 1PGSA 1BXHA 2GAUA 3WDVA 4FAGA 4I02A 4IV3A 1XYNA 1LR5A 5DG2A 5TSWA 4XETA 2EALA 2K2SA 3WUCA 3HMYA 3ILNA 1MACA 4S2HA 4EV0A 4I3GA 1BMV2 4PIXA 2E51A 2D6LX 3M3QA 4K1ZA 5I8YA 1D2SA 1VAMA 1KFXL 5FREA 1CAVB 1ZBE2 2CV6A 3GBWA 4Q1RA 5C8CC 3WDWA 4LNVA 2A6XA 2DVDA 4KNCA 1V9U1 4Y1UA 1QOOA 2MHFA 3JZVA 4F83A 3I4IA 1CAVA 3VBFB 1LGBA 2WFF1 4OI1A 2GSYA 1AX0A 1QY4A 1Z7S3 3DPRC 1D4M3 1DGWX 3VBFA 1EV11 1I6XA 4LBQA 4XFGA 1UPIA 3WXPA 3BALA 5GZFA 1W6MB 4Q4V2 3AFGA 1PVC2 1XXNA 2W08A 3FWEA 3USSA