4GAMC

Complex structure of methane monooxygenase hydroxylase and regulatory subunit
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A beta chain
publication title Control of substrate access to the active site in methane monooxygenase.
pubmed doi rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase
total genus 56
structure length 166
sequence length 166
chains with identical sequence H, M, R
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4gamC01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4gamC02
1FZHE 1XMGE 1FZ2E 1FZ7E 1XVBE 1FZ4E 1FZ0E 1FYZE 1XVEE 1XVGE 1MHYG 1XU3E 4GAMC 1XMFE 1MHZG 1FZ8E 1FZ6E 1FZ5E 1FZ3E 1XVCE 1XU5E 1FZIE 1FZ9E 1MTYG 1XVFE 1MMOG 1FZ1E 1XVDE 1XMHE
chains in the Genus database with same CATH superfamily
3OGLB 4M3TA 4E4BA 3J2PA 1FZ2E 4M3RA 3CQ8A 3C6NB 4J2DA 1XVEE 3E4WA 3SI6A 1NEXB 3NHGA 1FS1A 2ATQA 2DY4A 1XU3E 4AI6A 4I9LA 3LZIA 3CFPA 3NAEA 5H37A 4M45A 4DTMA 2VJ4A 4M41A 4AKHA 3UIQA 3HGLA 4J2AA 3LDBA 3N1EA 4M3YA 3TABA 2JHAA 3LD8A 4JS4A 1FZ6E 2VJ5A 5IREA 2PFVA 3NGIA 3HL8A 1XVCE 4KHYA 1FZIE 2FW3A 4FJ7A 4EYWA 3LZJA 3LDSA 3RWUA 3L8BA 1MTYG 1MMOG 1XVDE 3C95A 3J27A 4B08A 4FK0A 1XMGE 2LF3A 3K2OA 4DTPA 2B1EA 2B7MA 1FZ4E 3TAFA 3NE6A 4AKIA 3QEXA 3C6PB 3BVOA 2B8IA 3TJYA 3E4YA 3CFOA 4FJJA 4ADNA 4FJHA 1XMFE 4HCBA 4FJ8A 4FJ9A 3L1NA 4M3UA 4FJMA 4DTOA 1JW2A 3S9HA 4FJIA 4J2EA 4X5MA 2MMBA 3UO3A 2E32A 4EP9A 3N1BA 4DTSA 2VIXA 2OZSA 1Q9YA 1FZ5E 2JH8A 3RMCA 4FK4A 4FVMA 4DU3A 4M3WA 2OVRB 1XU5E 4DTNA 3SCXA 3L0MA 3MKSB 4DTRA 1FXXA 1P22A 3C6OB 4QNCA 4KHQA 3HGKE 4ICGC 2HD0A 2P1MB 3RMDA 2RCUA 4EPHA 4KHWA 1FZ1E 1Q9XA 2DTUA 3QERA 4FJXA 1XMHE 3RMBA 2OZMA 1FZHE 4IT5A 3SQ4A 4FJGA 1WAJA 4AKGA 3C94A 3QETA 3SUOA 1FZ7E 2JHPA 4X5NA 1XVBE 2OYQA 4DU4A 4DTJA 2E31A 1XVGE 3TL8B 3SVIA 1MHYG 2JHCA 3HP9A 1WAFA 3NCIA 2P1PB 4JRQA 4GAMC 3QEWA 2P5OA 4FJLA 4KHUA 1MHZG 4M42A 1CLQA 4KI6A 4RG8A 3WSOA 3TAGA 3SPYA 2YB5A 1FPOA 3QEVA 2JQTA 2JPNA 4FK2A 2MZWB 1FZ8E 3QNNA 3SUPA 4M3ZA 2OVQB 1FZ3E 4ADOA 3V7DB 4J2BA 3SNNA 3QEIA 2K5SA 3SUNA 4FJKA 4KI4A 2P5GA 4KHNA 3OGMB 1FZ9E 4KHSA 1XVFE 2QXFA 3SQ2A 3SQ1A 3SQ0A 2OVPB 2P1QB 4I6JB 4JRPA 4FJNA 3SJJA 1IH7A 4JS5A 3SPZA 5IZ7A 3RMAA 4QNDA 5IBKB 1N1CA 4DU1A 4DTUA 1FZ0E 1FYZE 3UO2A 3OGKB 3CFRA 2PFTA 3KD1E 3QESA 4I9QA 2P1NB 3SUQA 3L2OB 3TAEA 2RKHA 4RL5A 3NDKA 2H4TA 2FYOA 4E3SA 4DTXA 2LF6A 1XL3C 2DEBA 1IG9A 4FJ5A 4HCCA 2JH9A 1LDKE 3QEPA 2P1OB 2MW2A 3KD5E 3QNOA 4M3XA 4RNGA
chains in the Genus database with same CATH topology
3OGLB 4M3TA 4E4BA 3J2PA 1FZ2E 4M3RA 3CQ8A 3C6NB 4J2DA 1XVEE 3E4WA 3SI6A 1NEXB 3NHGA 1FS1A 2ATQA 2DY4A 1XU3E 4AI6A 4I9LA 3LZIA 3CFPA 3NAEA 5H37A 4M45A 4DTMA 2VJ4A 4M41A 4AKHA 3UIQA 3HGLA 4J2AA 3LDBA 3N1EA 4M3YA 3TABA 2JHAA 3LD8A 4JS4A 1FZ6E 2VJ5A 5IREA 2PFVA 3NGIA 3HL8A 1XVCE 4KHYA 1FZIE 2FW3A 4FJ7A 4EYWA 3LZJA 3LDSA 3RWUA 3L8BA 1MTYG 1MMOG 1XVDE 3C95A 3J27A 4B08A 4FK0A 1XMGE 2LF3A 3K2OA 4DTPA 2B1EA 2B7MA 1FZ4E 3TAFA 3NE6A 4AKIA 3QEXA 3C6PB 3TJYA 2B8IA 3E4YA 3CFOA 4FJJA 4ADNA 4FJHA 1XMFE 4HCBA 4FJ8A 4FJ9A 3L1NA 4FJMA 4DTOA 3S9HA 4FJIA 4J2EA 4X5MA 2MMBA 2E32A 4EP9A 3N1BA 4DTSA 2VIXA 2OZSA 1Q9YA 1FZ5E 2JH8A 3RMCA 4FK4A 4FVMA 4DU3A 4M3WA 2OVRB 1XU5E 4DTNA 3SCXA 3L0MA 3MKSB 4DTRA 1FXXA 1P22A 3C6OB 4QNCA 4KHQA 3HGKE 3RMDA 2HD0A 2P1MB 4KHWA 2RCUA 4EPHA 4M3UA 1FZ1E 1Q9XA 2DTUA 3QERA 4FJXA 1XMHE 3RMBA 2OZMA 1FZHE 3SQ4A 4FJGA 1WAJA 4AKGA 3C94A 3QETA 3SUOA 1FZ7E 2JHPA 4X5NA 1XVBE 2OYQA 4DU4A 4DTJA 2E31A 1XVGE 3TL8B 3SVIA 1MHYG 2JHCA 3HP9A 1WAFA 3NCIA 2P1PB 4JRQA 4GAMC 3QEWA 2P5OA 4FJLA 4KHUA 1MHZG 4M42A 1CLQA 4KI6A 4RG8A 3WSOA 3TAGA 3SPYA 2YB5A 3QEVA 2JPNA 4FK2A 2MZWB 1FZ8E 3QNNA 3SUPA 4M3ZA 2OVQB 1FZ3E 4ADOA 3V7DB 4J2BA 3SNNA 3QEIA 3SUNA 4FJKA 4KI4A 2P5GA 4KHNA 3OGMB 1FZ9E 4KHSA 1XVFE 2QXFA 3SQ2A 3SQ1A 3SQ0A 2OVPB 2P1QB 4I6JB 4JRPA 4FJNA 3SJJA 1IH7A 4JS5A 3SPZA 5IZ7A 3RMAA 4QNDA 5IBKB 4DTUA 4DU1A 1FZ0E 1FYZE 3OGKB 3CFRA 2PFTA 3KD1E 3QESA 4I9QA 2P1NB 3SUQA 3L2OB 3TAEA 4RL5A 3NDKA 2H4TA 2FYOA 4E3SA 4DTXA 2LF6A 1XL3C 2DEBA 1IG9A 4FJ5A 4HCCA 2JH9A 1LDKE 3QEPA 2P1OB 3KD5E 3QNOA 4M3XA 4RNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZH E;  1XMG E;  1FZ2 E;  1FZ7 E;  1XVB E;  1FZ4 E;  1FZ0 E;  1FYZ E;  1XVE E;  1XVG E;  1MHY G;  1XU3 E;  4GAM C;  1XMF E;  1MHZ G;  1FZ8 E;  1FZ6 E;  1FZ5 E;  1FZ3 E;  1XVC E;  1XU5 E;  1FZI E;  1FZ9 E;  1MTY G;  1XVF E;  1MMO G;  1FZ1 E;  1XVD E;  1XMH E; 
#chains in the Genus database with same CATH topology
 3OGL B;  4M3T A;  4E4B A;  3J2P A;  1FZ2 E;  4M3R A;  3CQ8 A;  3C6N B;  4J2D A;  1XVE E;  3E4W A;  3SI6 A;  1NEX B;  3NHG A;  1FS1 A;  2ATQ A;  2DY4 A;  1XU3 E;  4AI6 A;  4I9L A;  3LZI A;  3CFP A;  3NAE A;  5H37 A;  4M45 A;  4DTM A;  2VJ4 A;  4M41 A;  4AKH A;  3UIQ A;  3HGL A;  4J2A A;  3LDB A;  3N1E A;  4M3Y A;  3TAB A;  2JHA A;  3LD8 A;  4JS4 A;  1FZ6 E;  2VJ5 A;  5IRE A;  2PFV A;  3NGI A;  3HL8 A;  1XVC E;  4KHY A;  1FZI E;  2FW3 A;  4FJ7 A;  4EYW A;  3LZJ A;  3LDS A;  3RWU A;  3L8B A;  1MTY G;  1MMO G;  1XVD E;  3C95 A;  3J27 A;  4B08 A;  4FK0 A;  1XMG E;  2LF3 A;  3K2O A;  4DTP A;  2B1E A;  2B7M A;  1FZ4 E;  3TAF A;  3NE6 A;  4AKI A;  3QEX A;  3C6P B;  3BVO A;  2B8I A;  3TJY A;  3E4Y A;  3CFO A;  4FJJ A;  4ADN A;  4FJH A;  1XMF E;  4HCB A;  4FJ8 A;  4FJ9 A;  3L1N A;  4M3U A;  4FJM A;  4DTO A;  1JW2 A;  3S9H A;  4FJI A;  4J2E A;  4X5M A;  2MMB A;  3UO3 A;  2E32 A;  4EP9 A;  3N1B A;  4DTS A;  2VIX A;  2OZS A;  1Q9Y A;  1FZ5 E;  2JH8 A;  3RMC A;  4FK4 A;  4FVM A;  4DU3 A;  4M3W A;  2OVR B;  1XU5 E;  4DTN A;  3SCX A;  3L0M A;  3MKS B;  4DTR A;  1FXX A;  1P22 A;  3C6O B;  4QNC A;  4KHQ A;  3HGK E;  4ICG C;  2HD0 A;  2P1M B;  3RMD A;  2RCU A;  4EPH A;  4KHW A;  1FZ1 E;  1Q9X A;  2DTU A;  3QER A;  4FJX A;  1XMH E;  3RMB A;  2OZM A;  1FZH E;  4IT5 A;  3SQ4 A;  4FJG A;  1WAJ A;  4AKG A;  3C94 A;  3QET A;  3SUO A;  1FZ7 E;  2JHP A;  4X5N A;  1XVB E;  2OYQ A;  4DU4 A;  4DTJ A;  2E31 A;  1XVG E;  3TL8 B;  3SVI A;  1MHY G;  2JHC A;  3HP9 A;  1WAF A;  3NCI A;  2P1P B;  4JRQ A;  4GAM C;  3QEW A;  2P5O A;  4FJL A;  4KHU A;  1MHZ G;  4M42 A;  1CLQ A;  4KI6 A;  4RG8 A;  3WSO A;  3TAG A;  3SPY A;  2YB5 A;  1FPO A;  3QEV A;  2JQT A;  2JPN A;  4FK2 A;  2MZW B;  1FZ8 E;  3QNN A;  3SUP A;  4M3Z A;  2OVQ B;  1FZ3 E;  4ADO A;  3V7D B;  4J2B A;  3SNN A;  3QEI A;  2K5S A;  3SUN A;  4FJK A;  4KI4 A;  2P5G A;  4KHN A;  3OGM B;  1FZ9 E;  4KHS A;  1XVF E;  2QXF A;  3SQ2 A;  3SQ1 A;  3SQ0 A;  2OVP B;  2P1Q B;  4I6J B;  4JRP A;  4FJN A;  3SJJ A;  1IH7 A;  4JS5 A;  3SPZ A;  5IZ7 A;  3RMA A;  4QND A;  5IBK B;  1N1C A;  4DU1 A;  4DTU A;  1FZ0 E;  1FYZ E;  3UO2 A;  3OGK B;  3CFR A;  2PFT A;  3KD1 E;  3QES A;  4I9Q A;  2P1N B;  3SUQ A;  3L2O B;  3TAE A;  2RKH A;  4RL5 A;  3NDK A;  2H4T A;  2FYO A;  4E3S A;  4DTX A;  2LF6 A;  1XL3 C;  2DEB A;  1IG9 A;  4FJ5 A;  4HCC A;  2JH9 A;  1LDK E;  3QEP A;  2P1O B;  2MW2 A;  3KD5 E;  3QNO A;  4M3X A;  4RNG A; 
#chains in the Genus database with same CATH homology
 3OGL B;  4M3T A;  4E4B A;  3J2P A;  1FZ2 E;  4M3R A;  3CQ8 A;  3C6N B;  4J2D A;  1XVE E;  3E4W A;  3SI6 A;  1NEX B;  3NHG A;  1FS1 A;  2ATQ A;  2DY4 A;  1XU3 E;  4AI6 A;  4I9L A;  3LZI A;  3CFP A;  3NAE A;  5H37 A;  4M45 A;  4DTM A;  2VJ4 A;  4M41 A;  4AKH A;  3UIQ A;  3HGL A;  4J2A A;  3LDB A;  3N1E A;  4M3Y A;  3TAB A;  2JHA A;  3LD8 A;  4JS4 A;  1FZ6 E;  2VJ5 A;  5IRE A;  2PFV A;  3NGI A;  3HL8 A;  1XVC E;  4KHY A;  1FZI E;  2FW3 A;  4FJ7 A;  4EYW A;  3LZJ A;  3LDS A;  3RWU A;  3L8B A;  1MTY G;  1MMO G;  1XVD E;  3C95 A;  3J27 A;  4B08 A;  4FK0 A;  1XMG E;  2LF3 A;  3K2O A;  4DTP A;  2B1E A;  2B7M A;  1FZ4 E;  3TAF A;  3NE6 A;  4AKI A;  3QEX A;  3C6P B;  3TJY A;  2B8I A;  3E4Y A;  3CFO A;  4FJJ A;  4ADN A;  4FJH A;  1XMF E;  4HCB A;  4FJ8 A;  4FJ9 A;  3L1N A;  4FJM A;  4DTO A;  3S9H A;  4FJI A;  4J2E A;  4X5M A;  2MMB A;  2E32 A;  4EP9 A;  3N1B A;  4DTS A;  2VIX A;  2OZS A;  1Q9Y A;  1FZ5 E;  2JH8 A;  3RMC A;  4FK4 A;  4FVM A;  4DU3 A;  4M3W A;  2OVR B;  1XU5 E;  4DTN A;  3SCX A;  3L0M A;  3MKS B;  4DTR A;  1FXX A;  1P22 A;  3C6O B;  4QNC A;  4KHQ A;  3HGK E;  3RMD A;  2HD0 A;  2P1M B;  4KHW A;  2RCU A;  4EPH A;  4M3U A;  1FZ1 E;  1Q9X A;  2DTU A;  3QER A;  4FJX A;  1XMH E;  3RMB A;  2OZM A;  1FZH E;  3SQ4 A;  4FJG A;  1WAJ A;  4AKG A;  3C94 A;  3QET A;  3SUO A;  1FZ7 E;  2JHP A;  4X5N A;  1XVB E;  2OYQ A;  4DU4 A;  4DTJ A;  2E31 A;  1XVG E;  3TL8 B;  3SVI A;  1MHY G;  2JHC A;  3HP9 A;  1WAF A;  3NCI A;  2P1P B;  4JRQ A;  4GAM C;  3QEW A;  2P5O A;  4FJL A;  4KHU A;  1MHZ G;  4M42 A;  1CLQ A;  4KI6 A;  4RG8 A;  3WSO A;  3TAG A;  3SPY A;  2YB5 A;  3QEV A;  2JPN A;  4FK2 A;  2MZW B;  1FZ8 E;  3QNN A;  3SUP A;  4M3Z A;  2OVQ B;  1FZ3 E;  4ADO A;  3V7D B;  4J2B A;  3SNN A;  3QEI A;  3SUN A;  4FJK A;  4KI4 A;  2P5G A;  4KHN A;  3OGM B;  1FZ9 E;  4KHS A;  1XVF E;  2QXF A;  3SQ2 A;  3SQ1 A;  3SQ0 A;  2OVP B;  2P1Q B;  4I6J B;  4JRP A;  4FJN A;  3SJJ A;  1IH7 A;  4JS5 A;  3SPZ A;  5IZ7 A;  3RMA A;  4QND A;  5IBK B;  4DTU A;  4DU1 A;  1FZ0 E;  1FYZ E;  3OGK B;  3CFR A;  2PFT A;  3KD1 E;  3QES A;  4I9Q A;  2P1N B;  3SUQ A;  3L2O B;  3TAE A;  4RL5 A;  3NDK A;  2H4T A;  2FYO A;  4E3S A;  4DTX A;  2LF6 A;  1XL3 C;  2DEB A;  1IG9 A;  4FJ5 A;  4HCC A;  2JH9 A;  1LDK E;  3QEP A;  2P1O B;  3KD5 E;  3QNO A;  4M3X A;  4RNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...