4GAVA

Structure of the ndi1 protein from saccharomyces cerevisiae in complex with quinone
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 147
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gavA00
3SX6A 4GAVA 3T2YA 3HYXA 3T31A 3SZCA 4GAPA 3SYIA 5KMPA 4G6GA 3T2KA 3T2ZA 5KMSA 4G74A 3SY4A 3SZFA 3SXIA 5KMQA 3SZ0A 3T0KA 4G9KA 4NWZA 3SZWA 3HYWA 3T14A 3HYVA 4G73A 3KPKA 4G6HA 5KMRA
chains in the Genus database with same CATH superfamily
3VQRA 3O0HA 4FK1C 2QCUA 2YQUA 4H4SA 4UDPA 2JK6A 3NG7X 4X4JA 2H89A 4YWOA 2WDVA 1CJCA 4H7UA 1CC2A 3P1WA 3UP5A 3C4NA 4GAPA 2V61A 1Z6LA 4CNKA 3FBSA 4Z25A 3CGCA 1BF3A 1CBOA 3QFBA 3UKQA 4Y4NA 1S3EA 3ALJA 2ZBWA 4I58A 4JY2A 2BC0A 1ZMCA 4BV6A 3BI2A 1ZP0A 4JDRA 3AB1A 2R0GA 3CTYA 4RG3A 3KLJA 1FCDA 1ELIA 2BABA 3AE6A 4ZCCA 1GRHA 3L1RA 2BCGG 3KD9A 2R9ZA 4A65A 3UTHA 2WHDA 4H4PA 4OPIA 4M52A 2YLSA 3SX6A 3T2YA 2BK4A 1L9EA 3K7TA 4GF7A 3UTFA 2R0PA 2WU5A 2GQWA 2CDUA 1PBDA 4K22A 4OPLA 2VVMA 3V3NA 2WPCA 4CCQA 2B9WA 3RP7A 2YG5A 3GYIA 4ZN0A 1QJDA 1H82A 1FECA 4P9SA 3M12A 5HXIA 1KNPA 3FG2P 2JAEA 4JQ9A 2JBVA 3ICSA 3GD4A 2YM2A 2YAUA 1RP0A 3DJEA 3SZWA 3GRTA 2BRYA 3AEFA 4U8KA 4U2SA 2WOIA 3QFAA 3II4A 4JNAA 1XANA 3BI4A 3NH3X 1GV4A 5EBKA 1H7WA 5KVIA 1LQUA 3OC4A 1P2HA 1Q1WA 4H2PA 2GMHA 1FEAA 1IUSA 3ADAB 4Y4MA 5CQFA 4J31A 1PXAA 1S2QA 3CPIG 3LZXA 3PO7A 1VDCA 3REDA 3CNSA 4K5RA 1CJ4A 4II3A 3P4PA 1D7YA 4U8PA 4Z44A 4B63A 2C70A 4G6GA 3AEDA 3CGBA 2IVDA 2ZZCA 2ARDA 2FBWA 1DJQA 1OJ9A 2Z5XA 4A5LA 4NEWA 2QAEA 4U8NA 4EM4A 4Z2TA 2YG3A 3NHOX 1JNRA 2QA1A 1LTXR 4EM3A 1GRGA 2E4GA 2Q7VA 2JB1A 3NN0X 3G5RA 4A99A 5KOWA 1NENA 3AXBA 2XFQA 1PS9A 3AE9A 4G73A 3S5WA 1JRXA 1GT8A 3DJDA 3KKJA 3QVRA 4OPDA 3UKKA 1O95A 3UOXA 2B7RA 3GSIA 1PBCA 3CIRA 1NHPA 4LIIA 3I3LA 4IA5A 4U8LA 2RGJA 5FMHA 4EIPA 3L8KA 4Z24A 4JNQA 1EL9A 3DK8A 1LJ1A 2PHHA 2XVEA 2FJAA 1D7LA 4YTMA 4BJZA 3AEBA 4C77A 2VOUA 3JSKA 1JRYA 3GYXA 1YKJA 2FJDA 1OJCA 3NYCA 5DBJA 1NPXA 1Y0PA 1IUUA 1NG3A 2F5ZA 2YG7A 2Z5YA 2AQJA 1VQWA 3DMEA 3FMWA 3GD3A 4U8MA 2XFUA 2VQ7A 1ZOYA 1L9CA 2XFPA 3IC9A 3QSSA 2C66A 3CN8A 4J36A 1COYA 4J2WA 4TLXA 4REKA 3LXDA 3CPHG 4DSHA 4EMIA 2WP9A 3BNMA 3DJGX 4Z2UA 2GB0A 4XWRA 2C75A 4LA1A 4BK1A 3DH9A 3ITJA 3URHA 1GTEA 2BRAA 3SGLA 1E1KA 1PBBA 5GRTA 2H88A 5KNLA 3CNTA 4Y4LA 3UOZA 2JKCA 4CRTA 1F3PA 2B76A 4GDEA 3F8DA 4NWZA 3RNMA 3AYIA 4O5UA 4K7ZA 5BRTA 2YWLA 3IWAA 3ABVA 3WE0A 2GV8A 5BVAA 2YR4A 4DNAA 1PBFA 2GEWA 2Q6UA 1EBDA 3ALLA 2VRLA 1ZX9A 3OZ2A 2IVEA 3IF9A 4KX6A 4TM0A 4WX1A 3KU9A 2BS2A 3B6DA 3M13A 1ONFA 3ISHA 3NNEA 4IA6A 4TLZA 4YT0A 4USQA 3D1CA 2TPRA 2B9YA 5U25A 3ICTA 2OA1A 3BI5A 1BGNA 3AYLA 2XLPA 5KMSA 4J57A 3NK0X 2X3NA 1FOHA 2IIDA 3ATQA 2YG6A 4H4WA 1D4DA 1CF3A 2FJEA 2GF3A 2WDQA 5J60A 1H6VA 4KPRA 1NHQA 4II2A 1LVLA 4B66A 1M64A 1K4QA 3NIXA 2C72A 5J7XA 3UKAA 5JCIA 5KMPA 4YSXA 5C2TA 5KRQA 3C4AA 4Z26A 2XVIA 4YKFA 1Q9IA 3FIMB 3VR8A 2APGA 3UOYA 2JB2A 4A6NB 2Y6RA 1QO8A 3DK4A 1KFYA 2R4JA 2V3BA 1Y56B 2JB3A 2XCGA 1XPQA 3AD8B 1YQ4A 3NYFA 3SYIA 3ZYXA 2QA2A 3EF6A 1EL7A 2BYBA 2DKIA 4G74A 2C4CA 4C3XA 4NNJA 1P2EA 2XVFA 5CKUA 4IV9A 3P4SA 3VRBA 3CNJA 3T0KA 3CGEA 1REOA 2YVJA 1PJ7A 3GWDA 1CHUA 3BNUA 1E1NA 3NK2X 3DK9A 4C74A 1DODA 1OJAA 5KVHA 4WCTA 3CNPA 1F8RA 3SFEA 1VG9A 4C3YA 1RSGA 1CJ2A 4X9NA 1GALA 4MJWA 2UZZA 4YXDA 1F8WA 3HYXA 1BZLA 1N4UA 2EQ8A 1QLBA 3I6DA 4OPCA 3T31A 1MXTA 2C67A 1H7XA 4NTEA 2W0HA 3NKSA 4U2TA 3S61A 4Z2RA 4YSHA 1GTHA 4AP1A 4C5OA 4EIQA 4EQXA 1GOSA 3KPFA 3GDPA 2DKHA 2CVJA 2ZZ0A 3KVEA 1GRFA 3ICRA 4NTCA 3G5SA 4U2LA 1E7PA 5ER0A 4CY6A 4LU6A 5KOXA 3SM8A 3KA7A 4FX9A 1IUWA 3AEEA 1GRAA 1DJNA 1TYTA 2XVJA 4OPGA 1B8SA 1D5TA 4H4UA 1ZDLA 4H4TA 4NEVA 1IJHA 5EB5A 5BULA 2BC1A 2GRTA 1B37A 4BURA 3EANA 1PN0A 3K7QX 1NDAA 3PS9A 1GXFA 1EL5A 4UDRA 4XWZA 4IVMB 1GREA 2YLZA 3AYJA 4UDQA 1IUVA 2B9XA 2WU2A 2O9ZA 2BK3A 5IQ1A 4A9WA 1H84A 4YTPA 1K0JA 1B5QA 4E0VA 2GAHB 5KWFA 3NN6X 1PHHA 5U1OA 2WPEA 3Q6JA 1VG0A 3QSEA 2X99A 4USRA 2C3DA 1NEKA 3CMMA 4GDPA 4BJYA 1LPFA 4CY8A 4B1BA 1KDGA 3AE5A 1PBEA 3GDNA 4H4RA 5TR3A 4DGKA 5EOWA 3NK1X 1DOEA 3AEAA 2GR0A 4JN9A 4AOSA 1K0IA 4EMJA 1E39A 4XXGA 1GSNA 2YR5A 1IUTA 5FS7A 2J3NA 3BHKA 1H86A 2Q0KA 2X8HA 2XVHA 1EL8A 2YM1A 3NGCX 4PAAA 4D03A 1GRBA 1VRQB 2XFNA 1FEBA 1NG4A 4YSZA 1DNCA 3FPZA 2YR6A 5EB4A 3SQPA 3LOVA 4H2QA 3SZCA 2NPXA 2BXRA 2OALA 2R0CA 2WESA 2EQ7A 5FS6A 4YTNA 4OCGA 3T2ZA 1DOCA 4GR1A 4OVIA 5LV9A 1TDFA 4J33A 3AWIA 5M0ZA 1O5WA 3NTDA 4TM4A 2C7GA 4GRTA 2WEUA 3H4KA 1W4XA 2XLRA 3SFDA 3DGZA 5M10A 2C76A 1PXBA 3KPKA 5KMRA 4HB9A 4RSLA 2R45A 4J56A 4H4ZA 3EAOA 1E1LA 5JCNA 1H81A 2ACZA 2C64A 4YSYA 1CL0A 1PJ5A 4B67A 2Y6QA 3T37A 4EQSA 1GESA 1LQTA 4RG4A 1HYUA 3P9UA 3NYEA 3CGDA 4EQWA 2XDOA 1X31B 3F8PA 3UKFA 1F6MA 1E6EA 2GH5A 1YQ3A 2XFOA 2XLTA 3E1TA 3AE3A 3UTGA 1DXLA 4AT0A 4CNJA 1KSSA 4U8IA 4BK2A 5BUKA 3AE1A 3P4RA 1PJ6A 2GMJA 2V5ZA 2C73A 4GAVA 1TDNA 4A7AA 1IUXA 3AE2A 3F8RA 3ATRA 5C3JA 2R46A 1D4EA 4H4VA 2WBAA 5JCKA 4H2RA 3UKPA 3H8LA 5GSNA 2A89A 3EPTA 3D8XA 1XHCA 3GWFA 4HA6A 5KXJA 1YQZA 2WETA 1TYPA 2YLRA 2ZZBA 3G5QA 4DSGA 4OPTA 4B64A 3VRAA 4PABA 2HQMA 1CC6A 1V59A 3AE4A 1JU2A 2YVGA 1AOGA 3AD7B 4GUVA 2YLXA 4U8OA 3V76A 3NT6A 1CC4A 2TMDA 2VZ2A 4ADWA 1JNZA 2CULA 2BK5A 5FS8A 1NHSA 2WOWA 3LADA 4CBQA 1FL2A 2RABA 2V6OA 4Z43A 3VRDB 4JY3A 3RP6A 2WDRA 2GR1A 3AECA 5FS9A 2BA9A 4B65A 1ZY8A 3QSMA 1KNRA 2EQ9A 4BK3A 1JEHA 3UTEA 1BWCA 2E5VA 4FDCB 4D04A 3H8IA 2GVCA 3C96A 2RGHA 1SEZA 2BXSA 1NAAA 3Q9TA 2VQBA 3ALMA 1B4VA 4K5SA 3M0OA 3LB8A 2FJBA 3SZFA 2I0ZA 3UOVA 2BS4A 2BACA 4OPUA 1GEUA 3COXA 1S2YA 2RGOA 3BHFA 2AR8A 3DA1A 2C65A 4AT2A 3GYJA 2OAMA 4GCMA 4CCRA 3AEGA 4AOXA 1CJ3A 1L0VA 4O5QA 1L9DA 3UKLA 2V60A 2X8GA 2CFYA 1PDHA 3IHGA 2B7SA 1ZOVA 4J34A 1K0LA 2GAGB 3DGHA 4H4QA 5L46A 2AAQA 4FK1A 2R4EA 3CNDA 1N4VA 4EMWA 3B3RA 2GQFA 1OJDA 1H83A 2C3CA 2XLSA 3ZDNA 2A87A 2X8CA 2GR2A 2YLWA 1PXCA 3SY4A 3V3OA 2X50A 1GETA 4G9KA 2VVLA 4IVOB 5JCLA 2YVFA 3IHMA 3PVCA 3HYWA 2WP6A 2OLOA 3HYVA 5HY5A 1DOBA 2OLNA 3GRSA 1KF6A 1RYIA 5JCMA 3GMBA 3CPJG 4K2XA 3P4QA 1O94A 4H50A 4B69A 4ZCDA 2WQYA 3UCLA 1NHRA 1OJTA 1GRTA 2BS3A 3RHAA 1E1MA 4A6NA 2PYXA 3DJJA 1Y56A 3GMCA 3T2KA 1F8SA 3AE8A 3LZWA 3K30A 2XYOA 1TDKA 4H2NA 1S3BA 1GNDA 1N4WA 3K7MX 4YKGA 3SXIA 5KMQA 2XLUA 3LJPA 4H4YA 1LV0A 3VR9A 5HYMA 2WP5A 3AE7A 3NTAA 2WPFA 2WS3A 1M6IA 1TDOA 4NTDA 1JRZA 1MO9A 1BGJA 2WOVA 1MOKA 3T14A 1Q1RA 1ZK7A 3UP4A 3R9UA 4A79A 5IQ4A 1XDIA 2YG4A 1GPEA 4H4XA 2V3AA 4EQRA 1TRBA 3NRNA 4X9MA 4NZHA 1N1PA 4N9XA 5HHFA 5IPYA 3NLCA 1ZMDA 4ICYA 1JOAA 2NVKX 1GERA 2BCPA 1UKVG 4APNA 3AD9B 1BKWA 1YY5A 2YLTA 4I59A 3HZLA 4UP3A 3SZ0A 2Q0LA 2A8XA 2VRMA 2VVLG 4U8JA 1D4CA 2E1MA 2GR3A 1TDEA 1KSUA 1ZKQA 3QVPA 4TM3A 4AP3A 2EQ6A 4TM1A 4ECHA 3QJ4A 4K8DA 3UKHA 4G6HA 5U63A 4B68A 3RP8A
chains in the Genus database with same CATH topology
3VQRA 3O0HA 4FK1C 2QCUA 2YQUA 4H4SA 4UDPA 2JK6A 3NG7X 4X4JA 2H89A 4YWOA 2WDVA 1CJCA 4H7UA 1CC2A 3P1WA 3UP5A 3C4NA 4GAPA 2V61A 1Z6LA 4CNKA 3FBSA 4Z25A 3CGCA 1BF3A 1CBOA 3QFBA 3UKQA 4Y4NA 1S3EA 3ALJA 2ZBWA 4I58A 4JY2A 2BC0A 1ZMCA 4BV6A 3BI2A 1ZP0A 4JDRA 3AB1A 2R0GA 3CTYA 4RG3A 3KLJA 1FCDA 1ELIA 2BABA 3AE6A 4ZCCA 1GRHA 3L1RA 2BCGG 3KD9A 2R9ZA 4A65A 3UTHA 2WHDA 4H4PA 4OPIA 4M52A 2YLSA 3SX6A 3T2YA 2BK4A 1L9EA 3K7TA 4GF7A 3UTFA 2R0PA 2WU5A 2GQWA 2CDUA 1PBDA 4K22A 4OPLA 2VVMA 3V3NA 2WPCA 4CCQA 2B9WA 3RP7A 2YG5A 3GYIA 4ZN0A 1QJDA 1H82A 1FECA 4P9SA 3M12A 5HXIA 1KNPA 3FG2P 2JAEA 4JQ9A 2JBVA 3ICSA 3GD4A 2YM2A 2YAUA 1RP0A 3DJEA 3SZWA 3GRTA 2BRYA 3AEFA 4U8KA 4U2SA 2WOIA 3QFAA 3II4A 4JNAA 1XANA 3BI4A 3NH3X 1GV4A 5EBKA 1H7WA 5KVIA 1LQUA 3OC4A 1P2HA 1Q1WA 4H2PA 2GMHA 1FEAA 1IUSA 3ADAB 4Y4MA 5CQFA 4J31A 1PXAA 1S2QA 3CPIG 3LZXA 3PO7A 1VDCA 3REDA 3CNSA 4K5RA 1CJ4A 4II3A 3P4PA 1D7YA 4U8PA 4Z44A 4B63A 2C70A 4G6GA 3AEDA 3CGBA 2IVDA 2ZZCA 2ARDA 2FBWA 1DJQA 1OJ9A 2Z5XA 4A5LA 4NEWA 2QAEA 4U8NA 4EM4A 4Z2TA 2YG3A 3NHOX 1JNRA 2QA1A 1LTXR 4EM3A 1GRGA 2E4GA 2Q7VA 2JB1A 3NN0X 3G5RA 4A99A 5KOWA 1NENA 3AXBA 2XFQA 1PS9A 3AE9A 4G73A 3S5WA 1JRXA 1GT8A 3DJDA 3KKJA 3QVRA 4OPDA 3UKKA 1O95A 3UOXA 2B7RA 3GSIA 1PBCA 3CIRA 1NHPA 4LIIA 3I3LA 4IA5A 4U8LA 2RGJA 5FMHA 4EIPA 3L8KA 4Z24A 4JNQA 1EL9A 3DK8A 1LJ1A 2PHHA 2XVEA 2FJAA 1D7LA 4YTMA 4BJZA 3AEBA 4C77A 2VOUA 3JSKA 1JRYA 3GYXA 1YKJA 2FJDA 1OJCA 3NYCA 5DBJA 1NPXA 1Y0PA 1IUUA 1NG3A 2F5ZA 2YG7A 2Z5YA 2AQJA 1VQWA 3DMEA 3FMWA 3GD3A 4U8MA 2XFUA 2VQ7A 1ZOYA 1L9CA 2XFPA 3IC9A 3QSSA 2C66A 3CN8A 4J36A 1COYA 4J2WA 4TLXA 4REKA 3LXDA 3CPHG 4DSHA 4EMIA 2WP9A 3BNMA 3DJGX 4Z2UA 2GB0A 4XWRA 2C75A 4LA1A 4BK1A 3DH9A 3ITJA 3URHA 1GTEA 2BRAA 3SGLA 1E1KA 1PBBA 5GRTA 2H88A 5KNLA 3CNTA 4Y4LA 3UOZA 2JKCA 4CRTA 1F3PA 2B76A 4GDEA 3F8DA 4NWZA 3RNMA 3AYIA 4O5UA 4K7ZA 5BRTA 2YWLA 3IWAA 3ABVA 3WE0A 2GV8A 5BVAA 2YR4A 4DNAA 1PBFA 2GEWA 2Q6UA 1EBDA 3ALLA 2VRLA 1ZX9A 3OZ2A 2IVEA 3IF9A 4KX6A 4TM0A 4WX1A 3KU9A 2BS2A 3B6DA 3M13A 1ONFA 3ISHA 3NNEA 4IA6A 4TLZA 4YT0A 4USQA 3D1CA 2TPRA 2B9YA 5U25A 3ICTA 2OA1A 3BI5A 1BGNA 3AYLA 2XLPA 5KMSA 4J57A 3NK0X 2X3NA 1FOHA 2IIDA 3ATQA 2YG6A 4H4WA 1D4DA 1CF3A 2FJEA 2GF3A 2WDQA 5J60A 1H6VA 4KPRA 1NHQA 4II2A 1LVLA 4B66A 1M64A 1K4QA 3NIXA 2C72A 5J7XA 3UKAA 5JCIA 5KMPA 4YSXA 5C2TA 5KRQA 3C4AA 4Z26A 2XVIA 4YKFA 1Q9IA 3FIMB 3VR8A 2APGA 3UOYA 2JB2A 4A6NB 2Y6RA 1QO8A 3DK4A 1KFYA 2R4JA 2V3BA 1Y56B 2JB3A 2XCGA 1XPQA 3AD8B 1YQ4A 3NYFA 3SYIA 3ZYXA 2QA2A 3EF6A 1EL7A 2BYBA 2DKIA 4G74A 2C4CA 4C3XA 4NNJA 1P2EA 2XVFA 5CKUA 4IV9A 3P4SA 3VRBA 3CNJA 3T0KA 3CGEA 1REOA 2YVJA 1PJ7A 3GWDA 1CHUA 3BNUA 1E1NA 3NK2X 3DK9A 4C74A 1DODA 1OJAA 5KVHA 4WCTA 3CNPA 1F8RA 3SFEA 1VG9A 4C3YA 1RSGA 1CJ2A 4X9NA 1GALA 4MJWA 2UZZA 4YXDA 1F8WA 3HYXA 1BZLA 1N4UA 2EQ8A 1QLBA 3I6DA 4OPCA 3T31A 1MXTA 2C67A 1H7XA 4NTEA 2W0HA 3NKSA 4U2TA 3S61A 4Z2RA 4YSHA 1GTHA 4AP1A 4C5OA 4EIQA 4EQXA 1GOSA 3KPFA 3GDPA 2DKHA 2CVJA 2ZZ0A 3KVEA 1GRFA 3ICRA 4NTCA 3G5SA 4U2LA 1E7PA 5ER0A 4CY6A 4LU6A 5KOXA 3SM8A 3KA7A 4FX9A 1IUWA 3AEEA 1GRAA 1DJNA 1TYTA 2XVJA 4OPGA 1B8SA 1D5TA 4H4UA 1ZDLA 4H4TA 4NEVA 1IJHA 5EB5A 5BULA 2BC1A 2GRTA 1B37A 4BURA 3EANA 1PN0A 3K7QX 1NDAA 3PS9A 1GXFA 1EL5A 4UDRA 4XWZA 4IVMB 1GREA 2YLZA 3AYJA 4UDQA 1IUVA 2B9XA 2WU2A 2O9ZA 2BK3A 5IQ1A 4A9WA 1H84A 4YTPA 1K0JA 1B5QA 4E0VA 2GAHB 5KWFA 3NN6X 1PHHA 5U1OA 2WPEA 3Q6JA 1VG0A 3QSEA 2X99A 4USRA 2C3DA 1NEKA 3CMMA 4GDPA 4BJYA 1LPFA 4CY8A 4B1BA 1KDGA 3AE5A 1PBEA 3GDNA 4H4RA 5TR3A 4DGKA 5EOWA 3NK1X 1DOEA 3AEAA 2GR0A 4JN9A 4AOSA 1K0IA 4EMJA 1E39A 4XXGA 1GSNA 2YR5A 1IUTA 5FS7A 2J3NA 3BHKA 1H86A 2Q0KA 2X8HA 2XVHA 1EL8A 2YM1A 3NGCX 4PAAA 4D03A 1GRBA 1VRQB 2XFNA 1FEBA 1NG4A 4YSZA 1DNCA 3FPZA 2YR6A 5EB4A 3SQPA 3LOVA 4H2QA 3SZCA 2NPXA 2BXRA 2OALA 2R0CA 2WESA 2EQ7A 5FS6A 4YTNA 4OCGA 3T2ZA 1DOCA 4GR1A 4OVIA 5LV9A 1TDFA 4J33A 3AWIA 5M0ZA 1O5WA 3NTDA 4TM4A 2C7GA 4GRTA 2WEUA 3H4KA 1W4XA 2XLRA 3SFDA 3DGZA 5M10A 2C76A 1PXBA 3KPKA 5KMRA 4HB9A 4RSLA 2R45A 4J56A 4H4ZA 3EAOA 1E1LA 5JCNA 1H81A 2ACZA 2C64A 4YSYA 1CL0A 1PJ5A 4B67A 2Y6QA 3T37A 4EQSA 1GESA 1LQTA 4RG4A 1HYUA 3P9UA 3NYEA 3CGDA 4EQWA 2XDOA 1X31B 3F8PA 3UKFA 1F6MA 1E6EA 2GH5A 1YQ3A 2XFOA 2XLTA 3E1TA 3AE3A 3UTGA 1DXLA 4AT0A 4CNJA 1KSSA 4U8IA 4BK2A 5BUKA 3AE1A 3P4RA 1PJ6A 2GMJA 2V5ZA 2C73A 4GAVA 1TDNA 4A7AA 1IUXA 3AE2A 3F8RA 3ATRA 5C3JA 2R46A 1D4EA 4H4VA 2WBAA 5JCKA 4H2RA 3UKPA 3H8LA 5GSNA 2A89A 3EPTA 3D8XA 1XHCA 3GWFA 4HA6A 5KXJA 1YQZA 2WETA 1TYPA 2YLRA 2ZZBA 3G5QA 4DSGA 4OPTA 4B64A 3VRAA 4PABA 2HQMA 1CC6A 1V59A 3AE4A 1JU2A 2YVGA 1AOGA 3AD7B 4GUVA 2YLXA 4U8OA 3V76A 3NT6A 1CC4A 2TMDA 2VZ2A 4ADWA 1JNZA 2CULA 2BK5A 5FS8A 1NHSA 2WOWA 3LADA 4CBQA 1FL2A 2RABA 2V6OA 4Z43A 3VRDB 4JY3A 3RP6A 2WDRA 2GR1A 3AECA 5FS9A 2BA9A 4B65A 1ZY8A 3QSMA 1KNRA 2EQ9A 4BK3A 1JEHA 3UTEA 1BWCA 2E5VA 4FDCB 4D04A 3H8IA 2GVCA 3C96A 2RGHA 1SEZA 2BXSA 1NAAA 3Q9TA 2VQBA 3ALMA 1B4VA 4K5SA 3M0OA 3LB8A 2FJBA 3SZFA 2I0ZA 3UOVA 2BS4A 2BACA 4OPUA 1GEUA 3COXA 1S2YA 2RGOA 3BHFA 2AR8A 3DA1A 2C65A 4AT2A 3GYJA 2OAMA 4GCMA 4CCRA 3AEGA 4AOXA 1CJ3A 1L0VA 4O5QA 1L9DA 3UKLA 2V60A 2X8GA 2CFYA 1PDHA 3IHGA 2B7SA 1ZOVA 4J34A 1K0LA 2GAGB 3DGHA 4H4QA 5L46A 2AAQA 4FK1A 2R4EA 3CNDA 1N4VA 4EMWA 3B3RA 2GQFA 1OJDA 1H83A 2C3CA 2XLSA 3ZDNA 2A87A 2X8CA 2GR2A 2YLWA 1PXCA 3SY4A 3V3OA 2X50A 1GETA 4G9KA 2VVLA 4IVOB 5JCLA 2YVFA 3IHMA 3PVCA 3HYWA 2WP6A 2OLOA 3HYVA 5HY5A 1DOBA 2OLNA 3GRSA 1KF6A 1RYIA 5JCMA 3GMBA 3CPJG 4K2XA 3P4QA 1O94A 4H50A 4B69A 4ZCDA 2WQYA 3UCLA 1NHRA 1OJTA 1GRTA 2BS3A 3RHAA 1E1MA 4A6NA 2PYXA 3DJJA 1Y56A 3GMCA 3T2KA 1F8SA 3AE8A 3LZWA 3K30A 2XYOA 1TDKA 4H2NA 1S3BA 1GNDA 1N4WA 3K7MX 4YKGA 3SXIA 5KMQA 2XLUA 3LJPA 4H4YA 1LV0A 3VR9A 5HYMA 2WP5A 3AE7A 3NTAA 2WPFA 2WS3A 1M6IA 1TDOA 4NTDA 1JRZA 1MO9A 1BGJA 2WOVA 1MOKA 3T14A 1Q1RA 1ZK7A 3UP4A 3R9UA 4A79A 5IQ4A 1XDIA 2YG4A 1GPEA 4H4XA 2V3AA 4EQRA 1TRBA 3NRNA 4X9MA 4NZHA 1N1PA 4N9XA 5HHFA 5IPYA 3NLCA 1ZMDA 4ICYA 1JOAA 2NVKX 1GERA 2BCPA 1UKVG 4APNA 3AD9B 1BKWA 1YY5A 2YLTA 4I59A 3HZLA 4UP3A 3SZ0A 2Q0LA 2A8XA 2VRMA 2VVLG 4U8JA 1D4CA 2E1MA 2GR3A 1TDEA 1KSUA 1ZKQA 3QVPA 4TM3A 4AP3A 2EQ6A 4TM1A 4ECHA 3QJ4A 4K8DA 3UKHA 4G6HA 5U63A 4B68A 3RP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SX6 A;  4GAV A;  3T2Y A;  3HYX A;  3T31 A;  3SZC A;  4GAP A;  3SYI A;  5KMP A;  4G6G A;  3T2K A;  3T2Z A;  5KMS A;  4G74 A;  3SY4 A;  3SZF A;  3SXI A;  5KMQ A;  3SZ0 A;  3T0K A;  4G9K A;  4NWZ A;  3SZW A;  3HYW A;  3T14 A;  3HYV A;  4G73 A;  3KPK A;  4G6H A;  5KMR A; 
#chains in the Genus database with same CATH topology
 3VQR A;  3O0H A;  4FK1 C;  2QCU A;  2YQU A;  4H4S A;  4UDP A;  2JK6 A;  3NG7 X;  4X4J A;  2H89 A;  4YWO A;  2WDV A;  1CJC A;  4H7U A;  1CC2 A;  3P1W A;  3UP5 A;  3C4N A;  4GAP A;  2V61 A;  1Z6L A;  4CNK A;  3FBS A;  4Z25 A;  3CGC A;  1BF3 A;  1CBO A;  3QFB A;  3UKQ A;  4Y4N A;  1S3E A;  3ALJ A;  2ZBW A;  4I58 A;  4JY2 A;  2BC0 A;  1ZMC A;  4BV6 A;  3BI2 A;  1ZP0 A;  4JDR A;  3AB1 A;  2R0G A;  3CTY A;  4RG3 A;  3KLJ A;  1FCD A;  1ELI A;  2BAB A;  3AE6 A;  4ZCC A;  1GRH A;  3L1R A;  2BCG G;  3KD9 A;  2R9Z A;  4A65 A;  3UTH A;  2WHD A;  4H4P A;  4OPI A;  4M52 A;  2YLS A;  3SX6 A;  3T2Y A;  2BK4 A;  1L9E A;  3K7T A;  4GF7 A;  3UTF A;  2R0P A;  2WU5 A;  2GQW A;  2CDU A;  1PBD A;  4K22 A;  4OPL A;  2VVM A;  3V3N A;  2WPC A;  4CCQ A;  2B9W A;  3RP7 A;  2YG5 A;  3GYI A;  4ZN0 A;  1QJD A;  1H82 A;  1FEC A;  4P9S A;  3M12 A;  5HXI A;  1KNP A;  3FG2 P;  2JAE A;  4JQ9 A;  2JBV A;  3ICS A;  3GD4 A;  2YM2 A;  2YAU A;  1RP0 A;  3DJE A;  3SZW A;  3GRT A;  2BRY A;  3AEF A;  4U8K A;  4U2S A;  2WOI A;  3QFA A;  3II4 A;  4JNA A;  1XAN A;  3BI4 A;  3NH3 X;  1GV4 A;  5EBK A;  1H7W A;  5KVI A;  1LQU A;  3OC4 A;  1P2H A;  1Q1W A;  4H2P A;  2GMH A;  1FEA A;  1IUS A;  3ADA B;  4Y4M A;  5CQF A;  4J31 A;  1PXA A;  1S2Q A;  3CPI G;  3LZX A;  3PO7 A;  1VDC A;  3RED A;  3CNS A;  4K5R A;  1CJ4 A;  4II3 A;  3P4P A;  1D7Y A;  4U8P A;  4Z44 A;  4B63 A;  2C70 A;  4G6G A;  3AED A;  3CGB A;  2IVD A;  2ZZC A;  2ARD A;  2FBW A;  1DJQ A;  1OJ9 A;  2Z5X A;  4A5L A;  4NEW A;  2QAE A;  4U8N A;  4EM4 A;  4Z2T A;  2YG3 A;  3NHO X;  1JNR A;  2QA1 A;  1LTX R;  4EM3 A;  1GRG A;  2E4G A;  2Q7V A;  2JB1 A;  3NN0 X;  3G5R A;  4A99 A;  5KOW A;  1NEN A;  3AXB A;  2XFQ A;  1PS9 A;  3AE9 A;  4G73 A;  3S5W A;  1JRX A;  1GT8 A;  3DJD A;  3KKJ A;  3QVR A;  4OPD A;  3UKK A;  1O95 A;  3UOX A;  2B7R A;  3GSI A;  1PBC A;  3CIR A;  1NHP A;  4LII A;  3I3L A;  4IA5 A;  4U8L A;  2RGJ A;  5FMH A;  4EIP A;  3L8K A;  4Z24 A;  4JNQ A;  1EL9 A;  3DK8 A;  1LJ1 A;  2PHH A;  2XVE A;  2FJA A;  1D7L A;  4YTM A;  4BJZ A;  3AEB A;  4C77 A;  2VOU A;  3JSK A;  1JRY A;  3GYX A;  1YKJ A;  2FJD A;  1OJC A;  3NYC A;  5DBJ A;  1NPX A;  1Y0P A;  1IUU A;  1NG3 A;  2F5Z A;  2YG7 A;  2Z5Y A;  2AQJ A;  1VQW A;  3DME A;  3FMW A;  3GD3 A;  4U8M A;  2XFU A;  2VQ7 A;  1ZOY A;  1L9C A;  2XFP A;  3IC9 A;  3QSS A;  2C66 A;  3CN8 A;  4J36 A;  1COY A;  4J2W A;  4TLX A;  4REK A;  3LXD A;  3CPH G;  4DSH A;  4EMI A;  2WP9 A;  3BNM A;  3DJG X;  4Z2U A;  2GB0 A;  4XWR A;  2C75 A;  4LA1 A;  4BK1 A;  3DH9 A;  3ITJ A;  3URH A;  1GTE A;  2BRA A;  3SGL A;  1E1K A;  1PBB A;  5GRT A;  2H88 A;  5KNL A;  3CNT A;  4Y4L A;  3UOZ A;  2JKC A;  4CRT A;  1F3P A;  2B76 A;  4GDE A;  3F8D A;  4NWZ A;  3RNM A;  3AYI A;  4O5U A;  4K7Z A;  5BRT A;  2YWL A;  3IWA A;  3ABV A;  3WE0 A;  2GV8 A;  5BVA A;  2YR4 A;  4DNA A;  1PBF A;  2GEW A;  2Q6U A;  1EBD A;  3ALL A;  2VRL A;  1ZX9 A;  3OZ2 A;  2IVE A;  3IF9 A;  4KX6 A;  4TM0 A;  4WX1 A;  3KU9 A;  2BS2 A;  3B6D A;  3M13 A;  1ONF A;  3ISH A;  3NNE A;  4IA6 A;  4TLZ A;  4YT0 A;  4USQ A;  3D1C A;  2TPR A;  2B9Y A;  5U25 A;  3ICT A;  2OA1 A;  3BI5 A;  1BGN A;  3AYL A;  2XLP A;  5KMS A;  4J57 A;  3NK0 X;  2X3N A;  1FOH A;  2IID A;  3ATQ A;  2YG6 A;  4H4W A;  1D4D A;  1CF3 A;  2FJE A;  2GF3 A;  2WDQ A;  5J60 A;  1H6V A;  4KPR A;  1NHQ A;  4II2 A;  1LVL A;  4B66 A;  1M64 A;  1K4Q A;  3NIX A;  2C72 A;  5J7X A;  3UKA A;  5JCI A;  5KMP A;  4YSX A;  5C2T A;  5KRQ A;  3C4A A;  4Z26 A;  2XVI A;  4YKF A;  1Q9I A;  3FIM B;  3VR8 A;  2APG A;  3UOY A;  2JB2 A;  4A6N B;  2Y6R A;  1QO8 A;  3DK4 A;  1KFY A;  2R4J A;  2V3B A;  1Y56 B;  2JB3 A;  2XCG A;  1XPQ A;  3AD8 B;  1YQ4 A;  3NYF A;  3SYI A;  3ZYX A;  2QA2 A;  3EF6 A;  1EL7 A;  2BYB A;  2DKI A;  4G74 A;  2C4C A;  4C3X A;  4NNJ A;  1P2E A;  2XVF A;  5CKU A;  4IV9 A;  3P4S A;  3VRB A;  3CNJ A;  3T0K A;  3CGE A;  1REO A;  2YVJ A;  1PJ7 A;  3GWD A;  1CHU A;  3BNU A;  1E1N A;  3NK2 X;  3DK9 A;  4C74 A;  1DOD A;  1OJA A;  5KVH A;  4WCT A;  3CNP A;  1F8R A;  3SFE A;  1VG9 A;  4C3Y A;  1RSG A;  1CJ2 A;  4X9N A;  1GAL A;  4MJW A;  2UZZ A;  4YXD A;  1F8W A;  3HYX A;  1BZL A;  1N4U A;  2EQ8 A;  1QLB A;  3I6D A;  4OPC A;  3T31 A;  1MXT A;  2C67 A;  1H7X A;  4NTE A;  2W0H A;  3NKS A;  4U2T A;  3S61 A;  4Z2R A;  4YSH A;  1GTH A;  4AP1 A;  4C5O A;  4EIQ A;  4EQX A;  1GOS A;  3KPF A;  3GDP A;  2DKH A;  2CVJ A;  2ZZ0 A;  3KVE A;  1GRF A;  3ICR A;  4NTC A;  3G5S A;  4U2L A;  1E7P A;  5ER0 A;  4CY6 A;  4LU6 A;  5KOX A;  3SM8 A;  3KA7 A;  4FX9 A;  1IUW A;  3AEE A;  1GRA A;  1DJN A;  1TYT A;  2XVJ A;  4OPG A;  1B8S A;  1D5T A;  4H4U A;  1ZDL A;  4H4T A;  4NEV A;  1IJH A;  5EB5 A;  5BUL A;  2BC1 A;  2GRT A;  1B37 A;  4BUR A;  3EAN A;  1PN0 A;  3K7Q X;  1NDA A;  3PS9 A;  1GXF A;  1EL5 A;  4UDR A;  4XWZ A;  4IVM B;  1GRE A;  2YLZ A;  3AYJ A;  4UDQ A;  1IUV A;  2B9X A;  2WU2 A;  2O9Z A;  2BK3 A;  5IQ1 A;  4A9W A;  1H84 A;  4YTP A;  1K0J A;  1B5Q A;  4E0V A;  2GAH B;  5KWF A;  3NN6 X;  1PHH A;  5U1O A;  2WPE A;  3Q6J A;  1VG0 A;  3QSE A;  2X99 A;  4USR A;  2C3D A;  1NEK A;  3CMM A;  4GDP A;  4BJY A;  1LPF A;  4CY8 A;  4B1B A;  1KDG A;  3AE5 A;  1PBE A;  3GDN A;  4H4R A;  5TR3 A;  4DGK A;  5EOW A;  3NK1 X;  1DOE A;  3AEA A;  2GR0 A;  4JN9 A;  4AOS A;  1K0I A;  4EMJ A;  1E39 A;  4XXG A;  1GSN A;  2YR5 A;  1IUT A;  5FS7 A;  2J3N A;  3BHK A;  1H86 A;  2Q0K A;  2X8H A;  2XVH A;  1EL8 A;  2YM1 A;  3NGC X;  4PAA A;  4D03 A;  1GRB A;  1VRQ B;  2XFN A;  1FEB A;  1NG4 A;  4YSZ A;  1DNC A;  3FPZ A;  2YR6 A;  5EB4 A;  3SQP A;  3LOV A;  4H2Q A;  3SZC A;  2NPX A;  2BXR A;  2OAL A;  2R0C A;  2WES A;  2EQ7 A;  5FS6 A;  4YTN A;  4OCG A;  3T2Z A;  1DOC A;  4GR1 A;  4OVI A;  5LV9 A;  1TDF A;  4J33 A;  3AWI A;  5M0Z A;  1O5W A;  3NTD A;  4TM4 A;  2C7G A;  4GRT A;  2WEU A;  3H4K A;  1W4X A;  2XLR A;  3SFD A;  3DGZ A;  5M10 A;  2C76 A;  1PXB A;  3KPK A;  5KMR A;  4HB9 A;  4RSL A;  2R45 A;  4J56 A;  4H4Z A;  3EAO A;  1E1L A;  5JCN A;  1H81 A;  2ACZ A;  2C64 A;  4YSY A;  1CL0 A;  1PJ5 A;  4B67 A;  2Y6Q A;  3T37 A;  4EQS A;  1GES A;  1LQT A;  4RG4 A;  1HYU A;  3P9U A;  3NYE A;  3CGD A;  4EQW A;  2XDO A;  1X31 B;  3F8P A;  3UKF A;  1F6M A;  1E6E A;  2GH5 A;  1YQ3 A;  2XFO A;  2XLT A;  3E1T A;  3AE3 A;  3UTG A;  1DXL A;  4AT0 A;  4CNJ A;  1KSS A;  4U8I A;  4BK2 A;  5BUK A;  3AE1 A;  3P4R A;  1PJ6 A;  2GMJ A;  2V5Z A;  2C73 A;  4GAV A;  1TDN A;  4A7A A;  1IUX A;  3AE2 A;  3F8R A;  3ATR A;  5C3J A;  2R46 A;  1D4E A;  4H4V A;  2WBA A;  5JCK A;  4H2R A;  3UKP A;  3H8L A;  5GSN A;  2A89 A;  3EPT A;  3D8X A;  1XHC A;  3GWF A;  4HA6 A;  5KXJ A;  1YQZ A;  2WET A;  1TYP A;  2YLR A;  2ZZB A;  3G5Q A;  4DSG A;  4OPT A;  4B64 A;  3VRA A;  4PAB A;  2HQM A;  1CC6 A;  1V59 A;  3AE4 A;  1JU2 A;  2YVG A;  1AOG A;  3AD7 B;  4GUV A;  2YLX A;  4U8O A;  3V76 A;  3NT6 A;  1CC4 A;  2TMD A;  2VZ2 A;  4ADW A;  1JNZ A;  2CUL A;  2BK5 A;  5FS8 A;  1NHS A;  2WOW A;  3LAD A;  4CBQ A;  1FL2 A;  2RAB A;  2V6O A;  4Z43 A;  3VRD B;  4JY3 A;  3RP6 A;  2WDR A;  2GR1 A;  3AEC A;  5FS9 A;  2BA9 A;  4B65 A;  1ZY8 A;  3QSM A;  1KNR A;  2EQ9 A;  4BK3 A;  1JEH A;  3UTE A;  1BWC A;  2E5V A;  4FDC B;  4D04 A;  3H8I A;  2GVC A;  3C96 A;  2RGH A;  1SEZ A;  2BXS A;  1NAA A;  3Q9T A;  2VQB A;  3ALM A;  1B4V A;  4K5S A;  3M0O A;  3LB8 A;  2FJB A;  3SZF A;  2I0Z A;  3UOV A;  2BS4 A;  2BAC A;  4OPU A;  1GEU A;  3COX A;  1S2Y A;  2RGO A;  3BHF A;  2AR8 A;  3DA1 A;  2C65 A;  4AT2 A;  3GYJ A;  2OAM A;  4GCM A;  4CCR A;  3AEG A;  4AOX A;  1CJ3 A;  1L0V A;  4O5Q A;  1L9D A;  3UKL A;  2V60 A;  2X8G A;  2CFY A;  1PDH A;  3IHG A;  2B7S A;  1ZOV A;  4J34 A;  1K0L A;  2GAG B;  3DGH A;  4H4Q A;  5L46 A;  2AAQ A;  4FK1 A;  2R4E A;  3CND A;  1N4V A;  4EMW A;  3B3R A;  2GQF A;  1OJD A;  1H83 A;  2C3C A;  2XLS A;  3ZDN A;  2A87 A;  2X8C A;  2GR2 A;  2YLW A;  1PXC A;  3SY4 A;  3V3O A;  2X50 A;  1GET A;  4G9K A;  2VVL A;  4IVO B;  5JCL A;  2YVF A;  3IHM A;  3PVC A;  3HYW A;  2WP6 A;  2OLO A;  3HYV A;  5HY5 A;  1DOB A;  2OLN A;  3GRS A;  1KF6 A;  1RYI A;  5JCM A;  3GMB A;  3CPJ G;  4K2X A;  3P4Q A;  1O94 A;  4H50 A;  4B69 A;  4ZCD A;  2WQY A;  3UCL A;  1NHR A;  1OJT A;  1GRT A;  2BS3 A;  3RHA A;  1E1M A;  4A6N A;  2PYX A;  3DJJ A;  1Y56 A;  3GMC A;  3T2K A;  1F8S A;  3AE8 A;  3LZW A;  3K30 A;  2XYO A;  1TDK A;  4H2N A;  1S3B A;  1GND A;  1N4W A;  3K7M X;  4YKG A;  3SXI A;  5KMQ A;  2XLU A;  3LJP A;  4H4Y A;  1LV0 A;  3VR9 A;  5HYM A;  2WP5 A;  3AE7 A;  3NTA A;  2WPF A;  2WS3 A;  1M6I A;  1TDO A;  4NTD A;  1JRZ A;  1MO9 A;  1BGJ A;  2WOV A;  1MOK A;  3T14 A;  1Q1R A;  1ZK7 A;  3UP4 A;  3R9U A;  4A79 A;  5IQ4 A;  1XDI A;  2YG4 A;  1GPE A;  4H4X A;  2V3A A;  4EQR A;  1TRB A;  3NRN A;  4X9M A;  4NZH A;  1N1P A;  4N9X A;  5HHF A;  5IPY A;  3NLC A;  1ZMD A;  4ICY A;  1JOA A;  2NVK X;  1GER A;  2BCP A;  1UKV G;  4APN A;  3AD9 B;  1BKW A;  1YY5 A;  2YLT A;  4I59 A;  3HZL A;  4UP3 A;  3SZ0 A;  2Q0L A;  2A8X A;  2VRM A;  2VVL G;  4U8J A;  1D4C A;  2E1M A;  2GR3 A;  1TDE A;  1KSU A;  1ZKQ A;  3QVP A;  4TM3 A;  4AP3 A;  2EQ6 A;  4TM1 A;  4ECH A;  3QJ4 A;  4K8D A;  3UKH A;  4G6H A;  5U63 A;  4B68 A;  3RP8 A; 
#chains in the Genus database with same CATH homology
 3VQR A;  3O0H A;  4FK1 C;  2QCU A;  2YQU A;  4H4S A;  4UDP A;  2JK6 A;  3NG7 X;  4X4J A;  2H89 A;  4YWO A;  2WDV A;  1CJC A;  4H7U A;  1CC2 A;  3P1W A;  3UP5 A;  3C4N A;  4GAP A;  2V61 A;  1Z6L A;  4CNK A;  3FBS A;  4Z25 A;  3CGC A;  1BF3 A;  1CBO A;  3QFB A;  3UKQ A;  4Y4N A;  1S3E A;  3ALJ A;  2ZBW A;  4I58 A;  4JY2 A;  2BC0 A;  1ZMC A;  4BV6 A;  3BI2 A;  1ZP0 A;  4JDR A;  3AB1 A;  2R0G A;  3CTY A;  4RG3 A;  3KLJ A;  1FCD A;  1ELI A;  2BAB A;  3AE6 A;  4ZCC A;  1GRH A;  3L1R A;  2BCG G;  3KD9 A;  2R9Z A;  4A65 A;  3UTH A;  2WHD A;  4H4P A;  4OPI A;  4M52 A;  2YLS A;  3SX6 A;  3T2Y A;  2BK4 A;  1L9E A;  3K7T A;  4GF7 A;  3UTF A;  2R0P A;  2WU5 A;  2GQW A;  2CDU A;  1PBD A;  4K22 A;  4OPL A;  2VVM A;  3V3N A;  2WPC A;  4CCQ A;  2B9W A;  3RP7 A;  2YG5 A;  3GYI A;  4ZN0 A;  1QJD A;  1H82 A;  1FEC A;  4P9S A;  3M12 A;  5HXI A;  1KNP A;  3FG2 P;  2JAE A;  4JQ9 A;  2JBV A;  3ICS A;  3GD4 A;  2YM2 A;  2YAU A;  1RP0 A;  3DJE A;  3SZW A;  3GRT A;  2BRY A;  3AEF A;  4U8K A;  4U2S A;  2WOI A;  3QFA A;  3II4 A;  4JNA A;  1XAN A;  3BI4 A;  3NH3 X;  1GV4 A;  5EBK A;  1H7W A;  5KVI A;  1LQU A;  3OC4 A;  1P2H A;  1Q1W A;  4H2P A;  2GMH A;  1FEA A;  1IUS A;  3ADA B;  4Y4M A;  5CQF A;  4J31 A;  1PXA A;  1S2Q A;  3CPI G;  3LZX A;  3PO7 A;  1VDC A;  3RED A;  3CNS A;  4K5R A;  1CJ4 A;  4II3 A;  3P4P A;  1D7Y A;  4U8P A;  4Z44 A;  4B63 A;  2C70 A;  4G6G A;  3AED A;  3CGB A;  2IVD A;  2ZZC A;  2ARD A;  2FBW A;  1DJQ A;  1OJ9 A;  2Z5X A;  4A5L A;  4NEW A;  2QAE A;  4U8N A;  4EM4 A;  4Z2T A;  2YG3 A;  3NHO X;  1JNR A;  2QA1 A;  1LTX R;  4EM3 A;  1GRG A;  2E4G A;  2Q7V A;  2JB1 A;  3NN0 X;  3G5R A;  4A99 A;  5KOW A;  1NEN A;  3AXB A;  2XFQ A;  1PS9 A;  3AE9 A;  4G73 A;  3S5W A;  1JRX A;  1GT8 A;  3DJD A;  3KKJ A;  3QVR A;  4OPD A;  3UKK A;  1O95 A;  3UOX A;  2B7R A;  3GSI A;  1PBC A;  3CIR A;  1NHP A;  4LII A;  3I3L A;  4IA5 A;  4U8L A;  2RGJ A;  5FMH A;  4EIP A;  3L8K A;  4Z24 A;  4JNQ A;  1EL9 A;  3DK8 A;  1LJ1 A;  2PHH A;  2XVE A;  2FJA A;  1D7L A;  4YTM A;  4BJZ A;  3AEB A;  4C77 A;  2VOU A;  3JSK A;  1JRY A;  3GYX A;  1YKJ A;  2FJD A;  1OJC A;  3NYC A;  5DBJ A;  1NPX A;  1Y0P A;  1IUU A;  1NG3 A;  2F5Z A;  2YG7 A;  2Z5Y A;  2AQJ A;  1VQW A;  3DME A;  3FMW A;  3GD3 A;  4U8M A;  2XFU A;  2VQ7 A;  1ZOY A;  1L9C A;  2XFP A;  3IC9 A;  3QSS A;  2C66 A;  3CN8 A;  4J36 A;  1COY A;  4J2W A;  4TLX A;  4REK A;  3LXD A;  3CPH G;  4DSH A;  4EMI A;  2WP9 A;  3BNM A;  3DJG X;  4Z2U A;  2GB0 A;  4XWR A;  2C75 A;  4LA1 A;  4BK1 A;  3DH9 A;  3ITJ A;  3URH A;  1GTE A;  2BRA A;  3SGL A;  1E1K A;  1PBB A;  5GRT A;  2H88 A;  5KNL A;  3CNT A;  4Y4L A;  3UOZ A;  2JKC A;  4CRT A;  1F3P A;  2B76 A;  4GDE A;  3F8D A;  4NWZ A;  3RNM A;  3AYI A;  4O5U A;  4K7Z A;  5BRT A;  2YWL A;  3IWA A;  3ABV A;  3WE0 A;  2GV8 A;  5BVA A;  2YR4 A;  4DNA A;  1PBF A;  2GEW A;  2Q6U A;  1EBD A;  3ALL A;  2VRL A;  1ZX9 A;  3OZ2 A;  2IVE A;  3IF9 A;  4KX6 A;  4TM0 A;  4WX1 A;  3KU9 A;  2BS2 A;  3B6D A;  3M13 A;  1ONF A;  3ISH A;  3NNE A;  4IA6 A;  4TLZ A;  4YT0 A;  4USQ A;  3D1C A;  2TPR A;  2B9Y A;  5U25 A;  3ICT A;  2OA1 A;  3BI5 A;  1BGN A;  3AYL A;  2XLP A;  5KMS A;  4J57 A;  3NK0 X;  2X3N A;  1FOH A;  2IID A;  3ATQ A;  2YG6 A;  4H4W A;  1D4D A;  1CF3 A;  2FJE A;  2GF3 A;  2WDQ A;  5J60 A;  1H6V A;  4KPR A;  1NHQ A;  4II2 A;  1LVL A;  4B66 A;  1M64 A;  1K4Q A;  3NIX A;  2C72 A;  5J7X A;  3UKA A;  5JCI A;  5KMP A;  4YSX A;  5C2T A;  5KRQ A;  3C4A A;  4Z26 A;  2XVI A;  4YKF A;  1Q9I A;  3FIM B;  3VR8 A;  2APG A;  3UOY A;  2JB2 A;  4A6N B;  2Y6R A;  1QO8 A;  3DK4 A;  1KFY A;  2R4J A;  2V3B A;  1Y56 B;  2JB3 A;  2XCG A;  1XPQ A;  3AD8 B;  1YQ4 A;  3NYF A;  3SYI A;  3ZYX A;  2QA2 A;  3EF6 A;  1EL7 A;  2BYB A;  2DKI A;  4G74 A;  2C4C A;  4C3X A;  4NNJ A;  1P2E A;  2XVF A;  5CKU A;  4IV9 A;  3P4S A;  3VRB A;  3CNJ A;  3T0K A;  3CGE A;  1REO A;  2YVJ A;  1PJ7 A;  3GWD A;  1CHU A;  3BNU A;  1E1N A;  3NK2 X;  3DK9 A;  4C74 A;  1DOD A;  1OJA A;  5KVH A;  4WCT A;  3CNP A;  1F8R A;  3SFE A;  1VG9 A;  4C3Y A;  1RSG A;  1CJ2 A;  4X9N A;  1GAL A;  4MJW A;  2UZZ A;  4YXD A;  1F8W A;  3HYX A;  1BZL A;  1N4U A;  2EQ8 A;  1QLB A;  3I6D A;  4OPC A;  3T31 A;  1MXT A;  2C67 A;  1H7X A;  4NTE A;  2W0H A;  3NKS A;  4U2T A;  3S61 A;  4Z2R A;  4YSH A;  1GTH A;  4AP1 A;  4C5O A;  4EIQ A;  4EQX A;  1GOS A;  3KPF A;  3GDP A;  2DKH A;  2CVJ A;  2ZZ0 A;  3KVE A;  1GRF A;  3ICR A;  4NTC A;  3G5S A;  4U2L A;  1E7P A;  5ER0 A;  4CY6 A;  4LU6 A;  5KOX A;  3SM8 A;  3KA7 A;  4FX9 A;  1IUW A;  3AEE A;  1GRA A;  1DJN A;  1TYT A;  2XVJ A;  4OPG A;  1B8S A;  1D5T A;  4H4U A;  1ZDL A;  4H4T A;  4NEV A;  1IJH A;  5EB5 A;  5BUL A;  2BC1 A;  2GRT A;  1B37 A;  4BUR A;  3EAN A;  1PN0 A;  3K7Q X;  1NDA A;  3PS9 A;  1GXF A;  1EL5 A;  4UDR A;  4XWZ A;  4IVM B;  1GRE A;  2YLZ A;  3AYJ A;  4UDQ A;  1IUV A;  2B9X A;  2WU2 A;  2O9Z A;  2BK3 A;  5IQ1 A;  4A9W A;  1H84 A;  4YTP A;  1K0J A;  1B5Q A;  4E0V A;  2GAH B;  5KWF A;  3NN6 X;  1PHH A;  5U1O A;  2WPE A;  3Q6J A;  1VG0 A;  3QSE A;  2X99 A;  4USR A;  2C3D A;  1NEK A;  3CMM A;  4GDP A;  4BJY A;  1LPF A;  4CY8 A;  4B1B A;  1KDG A;  3AE5 A;  1PBE A;  3GDN A;  4H4R A;  5TR3 A;  4DGK A;  5EOW A;  3NK1 X;  1DOE A;  3AEA A;  2GR0 A;  4JN9 A;  4AOS A;  1K0I A;  4EMJ A;  1E39 A;  4XXG A;  1GSN A;  2YR5 A;  1IUT A;  5FS7 A;  2J3N A;  3BHK A;  1H86 A;  2Q0K A;  2X8H A;  2XVH A;  1EL8 A;  2YM1 A;  3NGC X;  4PAA A;  4D03 A;  1GRB A;  1VRQ B;  2XFN A;  1FEB A;  1NG4 A;  4YSZ A;  1DNC A;  3FPZ A;  2YR6 A;  5EB4 A;  3SQP A;  3LOV A;  4H2Q A;  3SZC A;  2NPX A;  2BXR A;  2OAL A;  2R0C A;  2WES A;  2EQ7 A;  5FS6 A;  4YTN A;  4OCG A;  3T2Z A;  1DOC A;  4GR1 A;  4OVI A;  5LV9 A;  1TDF A;  4J33 A;  3AWI A;  5M0Z A;  1O5W A;  3NTD A;  4TM4 A;  2C7G A;  4GRT A;  2WEU A;  3H4K A;  1W4X A;  2XLR A;  3SFD A;  3DGZ A;  5M10 A;  2C76 A;  1PXB A;  3KPK A;  5KMR A;  4HB9 A;  4RSL A;  2R45 A;  4J56 A;  4H4Z A;  3EAO A;  1E1L A;  5JCN A;  1H81 A;  2ACZ A;  2C64 A;  4YSY A;  1CL0 A;  1PJ5 A;  4B67 A;  2Y6Q A;  3T37 A;  4EQS A;  1GES A;  1LQT A;  4RG4 A;  1HYU A;  3P9U A;  3NYE A;  3CGD A;  4EQW A;  2XDO A;  1X31 B;  3F8P A;  3UKF A;  1F6M A;  1E6E A;  2GH5 A;  1YQ3 A;  2XFO A;  2XLT A;  3E1T A;  3AE3 A;  3UTG A;  1DXL A;  4AT0 A;  4CNJ A;  1KSS A;  4U8I A;  4BK2 A;  5BUK A;  3AE1 A;  3P4R A;  1PJ6 A;  2GMJ A;  2V5Z A;  2C73 A;  4GAV A;  1TDN A;  4A7A A;  1IUX A;  3AE2 A;  3F8R A;  3ATR A;  5C3J A;  2R46 A;  1D4E A;  4H4V A;  2WBA A;  5JCK A;  4H2R A;  3UKP A;  3H8L A;  5GSN A;  2A89 A;  3EPT A;  3D8X A;  1XHC A;  3GWF A;  4HA6 A;  5KXJ A;  1YQZ A;  2WET A;  1TYP A;  2YLR A;  2ZZB A;  3G5Q A;  4DSG A;  4OPT A;  4B64 A;  3VRA A;  4PAB A;  2HQM A;  1CC6 A;  1V59 A;  3AE4 A;  1JU2 A;  2YVG A;  1AOG A;  3AD7 B;  4GUV A;  2YLX A;  4U8O A;  3V76 A;  3NT6 A;  1CC4 A;  2TMD A;  2VZ2 A;  4ADW A;  1JNZ A;  2CUL A;  2BK5 A;  5FS8 A;  1NHS A;  2WOW A;  3LAD A;  4CBQ A;  1FL2 A;  2RAB A;  2V6O A;  4Z43 A;  3VRD B;  4JY3 A;  3RP6 A;  2WDR A;  2GR1 A;  3AEC A;  5FS9 A;  2BA9 A;  4B65 A;  1ZY8 A;  3QSM A;  1KNR A;  2EQ9 A;  4BK3 A;  1JEH A;  3UTE A;  1BWC A;  2E5V A;  4FDC B;  4D04 A;  3H8I A;  2GVC A;  3C96 A;  2RGH A;  1SEZ A;  2BXS A;  1NAA A;  3Q9T A;  2VQB A;  3ALM A;  1B4V A;  4K5S A;  3M0O A;  3LB8 A;  2FJB A;  3SZF A;  2I0Z A;  3UOV A;  2BS4 A;  2BAC A;  4OPU A;  1GEU A;  3COX A;  1S2Y A;  2RGO A;  3BHF A;  2AR8 A;  3DA1 A;  2C65 A;  4AT2 A;  3GYJ A;  2OAM A;  4GCM A;  4CCR A;  3AEG A;  4AOX A;  1CJ3 A;  1L0V A;  4O5Q A;  1L9D A;  3UKL A;  2V60 A;  2X8G A;  2CFY A;  1PDH A;  3IHG A;  2B7S A;  1ZOV A;  4J34 A;  1K0L A;  2GAG B;  3DGH A;  4H4Q A;  5L46 A;  2AAQ A;  4FK1 A;  2R4E A;  3CND A;  1N4V A;  4EMW A;  3B3R A;  2GQF A;  1OJD A;  1H83 A;  2C3C A;  2XLS A;  3ZDN A;  2A87 A;  2X8C A;  2GR2 A;  2YLW A;  1PXC A;  3SY4 A;  3V3O A;  2X50 A;  1GET A;  4G9K A;  2VVL A;  4IVO B;  5JCL A;  2YVF A;  3IHM A;  3PVC A;  3HYW A;  2WP6 A;  2OLO A;  3HYV A;  5HY5 A;  1DOB A;  2OLN A;  3GRS A;  1KF6 A;  1RYI A;  5JCM A;  3GMB A;  3CPJ G;  4K2X A;  3P4Q A;  1O94 A;  4H50 A;  4B69 A;  4ZCD A;  2WQY A;  3UCL A;  1NHR A;  1OJT A;  1GRT A;  2BS3 A;  3RHA A;  1E1M A;  4A6N A;  2PYX A;  3DJJ A;  1Y56 A;  3GMC A;  3T2K A;  1F8S A;  3AE8 A;  3LZW A;  3K30 A;  2XYO A;  1TDK A;  4H2N A;  1S3B A;  1GND A;  1N4W A;  3K7M X;  4YKG A;  3SXI A;  5KMQ A;  2XLU A;  3LJP A;  4H4Y A;  1LV0 A;  3VR9 A;  5HYM A;  2WP5 A;  3AE7 A;  3NTA A;  2WPF A;  2WS3 A;  1M6I A;  1TDO A;  4NTD A;  1JRZ A;  1MO9 A;  1BGJ A;  2WOV A;  1MOK A;  3T14 A;  1Q1R A;  1ZK7 A;  3UP4 A;  3R9U A;  4A79 A;  5IQ4 A;  1XDI A;  2YG4 A;  1GPE A;  4H4X A;  2V3A A;  4EQR A;  1TRB A;  3NRN A;  4X9M A;  4NZH A;  1N1P A;  4N9X A;  5HHF A;  5IPY A;  3NLC A;  1ZMD A;  4ICY A;  1JOA A;  2NVK X;  1GER A;  2BCP A;  1UKV G;  4APN A;  3AD9 B;  1BKW A;  1YY5 A;  2YLT A;  4I59 A;  3HZL A;  4UP3 A;  3SZ0 A;  2Q0L A;  2A8X A;  2VRM A;  2VVL G;  4U8J A;  1D4C A;  2E1M A;  2GR3 A;  1TDE A;  1KSU A;  1ZKQ A;  3QVP A;  4TM3 A;  4AP3 A;  2EQ6 A;  4TM1 A;  4ECH A;  3QJ4 A;  4K8D A;  3UKH A;  4G6H A;  5U63 A;  4B68 A;  3RP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...