4GAVA

Structure of the ndi1 protein from saccharomyces cerevisiae in complex with quinone
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
total genus 147
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4gavA00
3SYIA 5KMPA 4G74A 4G73A 3HYXA 3T0KA 3T2ZA 5KMQA 4G6HA 5KMRA 4GAPA 3SY4A 4G9KA 3SX6A 3SZCA 3T31A 5KMSA 3HYWA 4GAVA 4NWZA 3SZ0A 3HYVA 3SZFA 3KPKA 3T14A 4G6GA 3SXIA 3T2YA 3SZWA 3T2KA
chains in the Genus database with same CATH superfamily
2FJBA 1ZX9A 1F6MA 4K22A 4KX6A 1D4DA 2C66A 2GQWA 3P4QA 4YXDA 5KMPA 2BCPA 1ELIA 3LJPA 3DJDA 4BJYA 1CC2A 3CNJA 3AWIA 3AEEA 3I3LA 1GNDA 5U1OA 2ARDA 1IUTA 3AXBA 1CJ4A 3FIMB 2DKIA 3CPJG 4BURA 2YR4A 3VRDB 2BS3A 4B1BA 1S2QA 3AEGA 1SEZA 5IPYA 1TYPA 3ICRA 3AYLA 3GDPA 3VRAA 4K5RA 1KSUA 3ZDNA 4YKGA 1FEBA 3SZFA 3HZLA 4GDEA 4ZCDA 3CPHG 1RYIA 4YKFA 5KVIA 5TR3A 4Z44A 1GALA 3E1TA 2VQ7A 1E1LA 3Q6JA 2C73A 4PAAA 1OJ9A 1PXAA 1GERA 2X50A 1N1PA 3AE9A 3P4RA 4K7ZA 1M6IA 1GPEA 3GYXA 3AEFA 3C96A 3ICSA 3BI2A 3CN8A 3QVRA 3HYXA 3T0KA 3UKFA 1RSGA 2XCGA 3BI4A 4NZHA 4A99A 4CY8A 1GETA 2C65A 3BHFA 4BK3A 4H4TA 2NVKX 3GYIA 2BCGG 2JB3A 4CNKA 1FECA 4CY6A 1GTEA 4OPLA 4Z26A 1E1MA 2XFPA 2FBWA 1S3EA 1PDHA 1BKWA 3LOVA 1DODA 3UKPA 1GTHA 2FJAA 2BRAA 3QFAA 3JSKA 3ALLA 5U63A 1CC4A 3VQRA 3KPKA 1EBDA 1XANA 4X9MA 3UKHA 5FS6A 1GRHA 5IQ4A 4A7AA 3UP5A 2B76A 3C4NA 1Y56B 4JNQA 2GR2A 2C67A 3F8DA 4FX9A 1KFYA 5HHFA 5KOWA 1PJ6A 4YSHA 1MXTA 2XFQA 2WPCA 3CTYA 3NH3X 2RGJA 3BNMA 2RGOA 3GMCA 4ICYA 3V3NA 3AECA 2BRYA 1REOA 1ZK7A 1QJDA 2YG6A 3UTGA 1MO9A 3AE1A 3T31A 2OLNA 1S3BA 2XFNA 3G5SA 3L8KA 1BGNA 2TMDA 2VVLG 3QJ4A 2BYBA 4APNA 1PBEA 3AE7A 4O5UA 1PS9A 2RABA 3M0OA 3KPFA 3UTEA 3EANA 1DOBA 1EL7A 2GR0A 2XLRA 3NYEA 3SQPA 3UKLA 4CCQA 1Y56A 2HQMA 4NTCA 2UZZA 4YSXA 3UP4A 5KRQA 3H4KA 2H88A 4G74A 3AYIA 2YR5A 4J34A 4TM4A 3UKQA 1GXFA 5KMQA 1F8SA 2C64A 2OA1A 4H7UA 4PABA 4YTMA 2YWLA 5LV9A 5HXIA 4U8LA 1GT8A 3DGHA 5CQFA 2GV8A 2A8XA 2BA9A 3NLCA 2Q7VA 3AEAA 3I6DA 5GRTA 3ISHA 3HYVA 2BK4A 1RP0A 2FJDA 2YM1A 4J57A 3NTAA 2GEWA 3UKAA 2GAHB 3T2YA 3T2KA 3KA7A 4IA5A 1ZOYA 2OLOA 2YAUA 1DJNA 3VR8A 3S61A 4E0VA 2GAGB 2YLRA 3GD4A 1LVLA 2CDUA 4Y4LA 3RP8A 3P4PA 4D04A 1QO8A 2WDVA 2CVJA 2ZZCA 1OJTA 5EOWA 4EMIA 2WP5A 1CJCA 2XLUA 2YVJA 3NHOX 1COYA 3SY4A 1P2EA 1EL5A 2AQJA 4UP3A 1KNRA 1ZOVA 5KNLA 2WOVA 3NYCA 1NHQA 2YQUA 4X4JA 4LIIA 4RG3A 3CPIG 3NK0X 4NWZA 4HB9A 4YSZA 4J36A 4EQRA 1H7XA 3KU9A 1NAAA 2IVDA 4Z2TA 3RP7A 5CKUA 4DGKA 5KXJA 3DGZA 1TYTA 2XLPA 3VRBA 2C70A 2GRTA 1GRAA 1LJ1A 4HA6A 4X9NA 2JKCA 3CNPA 3F8RA 3DJGX 1GESA 1ONFA 2XFOA 1ZY8A 4B68A 1HYUA 3UKKA 4UDPA 5JCLA 3URHA 1N4VA 3AYJA 4BK2A 1CJ3A 4GF7A 3ATQA 5KMRA 1ZKQA 4II2A 4A9WA 1H83A 3UOYA 4H2QA 1NG3A 1JRXA 5J7XA 4B63A 1VG9A 1QLBA 3RHAA 3PVCA 4K2XA 1CC6A 1Y0PA 2EQ6A 3CNTA 2APGA 1B37A 4U8PA 2BABA 3AE3A 3K7QX 2E1MA 4BV6A 1PBCA 2V3AA 3C4AA 2YLWA 3QFBA 4FK1C 3BNUA 3R9UA 2PYXA 2VRLA 3FBSA 4EQSA 4P9SA 4C5OA 4AOXA 2O9ZA 3H8LA 4I59A 2GQFA 4J56A 2YR6A 3LZXA 3Q9TA 3IF9A 3VR9A 4G6HA 1E1KA 2WU5A 1Z6LA 2R9ZA 4RSLA 4YTNA 4OPTA 1TDNA 3ADAB 2GF3A 4EIPA 1UKVG 4AP3A 4H50A 3RNMA 2V5ZA 4MJWA 4H2RA 4B66A 2GH5A 3P1WA 4H4QA 1NHSA 2B7SA 1NG4A 5C2TA 3NRNA 5FS7A 1EL8A 2YLXA 3BI5A 4YWOA 4DNAA 2XLSA 2V60A 2VQBA 2BACA 3GMBA 3OC4A 5BUKA 2FJEA 4BJZA 1KF6A 2OAMA 2WP6A 2ZBWA 2GMHA 3AD9B 3AD8B 4GCMA 4XWRA 4A6NB 2AAQA 1IUWA 2YLTA 2NPXA 2XVHA 4TLZA 1FOHA 1BGJA 2C7GA 4A79A 1ZMDA 1YQ3A 1H7WA 5KOXA 2R0PA 4IA6A 4AT2A 2BXSA 2QA2A 3UTFA 1LPFA 3DK9A 1PJ5A 2VZ2A 4TLXA 2EQ7A 4IVOB 2R46A 4EIQA 1Q1RA 4H4VA 4TM3A 3AEDA 1XPQA 3SZ0A 3GWFA 2C75A 1VRQB 2WP9A 1K0IA 2R4JA 4U8IA 3CGEA 3UOZA 2A87A 3T14A 4H4RA 3BHKA 4XWZA 1GRGA 1NDAA 1PJ7A 2Z5XA 4B67A 5C3JA 2Q0LA 3DJJA 2GVCA 2E5VA 4KPRA 3B3RA 2XVFA 4C77A 3QSEA 4B65A 1H86A 1PN0A 1DOEA 5J60A 3ALJA 3NIXA 1NENA 1DXLA 3T2ZA 3CGBA 2R45A 1IUUA 1PBBA 1OJAA 4YTPA 2GB0A 4H4ZA 1ZP0A 3SX6A 1NHPA 2XVIA 4U8JA 1JNZA 1O94A 5EB5A 4AT0A 3SM8A 2WDQA 3AD7B 3GSIA 3K7MX 4GUVA 1TRBA 2XYOA 3T37A 3EF6A 4NTEA 4EMJA 1L9EA 3AEBA 5EB4A 3IWAA 3DK4A 2PHHA 3ALMA 1D4EA 1DJQA 3CNSA 4G6GA 4H4PA 4A5LA 4U2TA 4Z43A 2W0HA 3DH9A 3GWDA 3GDNA 3H8IA 2WOWA 2JBVA 2R0CA 1CHUA 5BULA 4K5SA 5HYMA 4XXGA 4H2PA 3IHGA 1FEAA 1F8WA 4O5QA 4B64A 4II3A 1F8RA 5GSNA 1GOSA 3L1RA 3NTDA 4IVMB 4LU6A 2C76A 2XVEA 2YG5A 5FS9A 2WQYA 3S5WA 2TPRA 2WHDA 4Y4NA 2X8HA 3KVEA 4Z2UA 1L0VA 5HY5A 2VRMA 2JAEA 1ZDLA 3D1CA 3AE6A 1CJ2A 1F3PA 3NT6A 4OVIA 3CGDA 1CF3A 2ZZBA 2X8GA 2XFUA 4GAVA 4USRA 4OPIA 2CFYA 2JB1A 2V61A 3UCLA 5JCKA 3COXA 2OALA 3DJEA 2YG4A 2JB2A 1GRTA 3UOVA 1W4XA 4JNAA 4B69A 1NHRA 3DK8A 1OJDA 2IVEA 4CRTA 1IJHA 1LQUA 4C3XA 2X99A 3KLJA 1H84A 1CBOA 2ZZ0A 4C74A 3GRTA 4AOSA 1K0JA 1JEHA 2YVGA 4JY2A 1E6EA 1E7PA 4GAPA 3K7TA 4EM3A 4N9XA 4OPGA 3SGLA 3LB8A 3SZCA 2X3NA 2BC1A 4U8OA 3NN0X 5M10A 5JCMA 1AOGA 3GYJA 4REKA 3NG7X 1PXBA 5JCNA 3AE4A 3KKJA 1DNCA 1PBDA 3ABVA 1PXCA 4H4YA 4H4UA 2C72A 4ADWA 2A89A 1KDGA 3SZWA 4CBQA 2B9WA 1GSNA 2WDRA 1S2YA 2Y6QA 5FMHA 4TM0A 4U8NA 4ZN0A 2BXRA 1FCDA 1XDIA 2YG7A 3G5QA 4M52A 5IQ1A 4NEVA 3AE5A 4H4SA 5BRTA 2IIDA 3DMEA 3OZ2A 1BZLA 1X31B 3P4SA 4A6NA 3F8PA 4EQXA 2GMJA 3SFEA 1JRZA 4I58A 1XHCA 3PO7A 4K8DA 2WU2A 1D7YA 3FPZA 2YLSA 4JDRA 1JOAA 3M13A 1B8SA 2X8CA 3NK2X 3P9UA 2WESA 1YY5A 1OJCA 2WOIA 1IUSA 1LTXR 1L9DA 1TDOA 3GD3A 1NPXA 4UDRA 5ER0A 2XDOA 4Y4MA 3SXIA 1JU2A 4IV9A 4RG4A 4OPUA 1GRBA 3AE2A 4TM1A 1YQZA 1JRYA 1M64A 2RGHA 2V6OA 3V76A 4GDPA 2BC0A 3K30A 3GRSA 3AB1A 3CMMA 3QVPA 4JQ9A 4YSYA 1LQTA 2GR1A 1CL0A 3ICTA 2GR3A 4J33A 3CIRA 1TDEA 1TDFA 4JN9A 1ZMCA 3EAOA 2YG3A 3IHMA 4J31A 3RP6A 2BS4A 3HYWA 4DSGA 1YQ4A 3LZWA 1Q9IA 2ACZA 4U8KA 2R4EA 4UDQA 4WCTA 5KVHA 3ATRA 2BK3A 5EBKA 2J3NA 4EM4A 2B9XA 3CNDA 5DBJA 2F5ZA 4YT0A 3QSSA 1N4UA 3M12A 3SYIA 2I0ZA 4U2LA 1D7LA 3NYFA 4FDCB 4LA1A 1K4QA 4OPDA 3NNEA 3KD9A 4Z24A 4A65A 4EMWA 2WPFA 2VVMA 2R0GA 1BWCA 2QAEA 4H4XA 1K0LA 4U8MA 4CNJA 1TDKA 2YVFA 4H4WA 2Z5YA 1E39A 3G5RA 2EQ9A 2QCUA 1GREA 2WPEA 2C4CA 1GEUA 4H2NA 3NGCX 1IUXA 1JNRA 2Q6UA 1GRFA 3CGCA 4U2SA 2QA1A 4WX1A 2BK5A 2YM2A 1O95A 1P2HA 1V59A 3SFDA 1N4WA 4ZCCA 1Q1WA 3WE0A 2WS3A 1BF3A 4NNJA 3EPTA 1L9CA 4G73A 4ECHA 3NKSA 1O5WA 1VDCA 3D8XA 3DA1A 3REDA 5BVAA 5L46A 2B7RA 2CULA 3ITJA 1IUVA 2VVLA 3AE8A 3O0HA 4G9KA 1H6VA 4EQWA 4D03A 2VOUA 2B9YA 1KSSA 1E1NA 1B4VA 2C3CA 2XVJA 3FG2P 3IC9A 3II4A 4NTDA 4DSHA 5KWFA 3LXDA 4AP1A 1FL2A 1D4CA 3ZYXA 5U25A 4FK1A 3NN6X 4Z25A 4OPCA 1GV4A 2WBAA 3V3OA 5FS8A 4JY3A 4GR1A 4GRTA 3PS9A 5JCIA 2V3BA 2C3DA 1D5TA 1DOCA 4OCGA 4C3YA 3FMWA 4BK1A 3B6DA 1VG0A 1VQWA 1LV0A 2Q0KA 2Y6RA 4NEWA 2YLZA 1EL9A 1KNPA 1MOKA 1H81A 4Z2RA 2H89A 2XLTA 1PHHA 1H82A 1PBFA 4J2WA 5KMSA 1B5QA 2WETA 5M0ZA 3UOXA 2BS2A 3NK1X 2JK6A 2AR8A 3LADA 2DKHA 1YKJA 2E4GA 1NEKA 4USQA 4CCRA 2WEUA 3UTHA 2EQ8A 3QSMA
chains in the Genus database with same CATH topology
2FJBA 1ZX9A 1F6MA 4K22A 4KX6A 1D4DA 2C66A 2GQWA 3P4QA 4YXDA 5KMPA 2BCPA 1ELIA 3LJPA 3DJDA 4BJYA 1CC2A 3CNJA 3AWIA 3AEEA 3I3LA 1GNDA 5U1OA 2ARDA 1IUTA 3AXBA 1CJ4A 3FIMB 2DKIA 3CPJG 4BURA 2YR4A 3VRDB 2BS3A 4B1BA 1S2QA 3AEGA 1SEZA 5IPYA 1TYPA 3ICRA 3AYLA 3GDPA 3VRAA 4K5RA 1KSUA 3ZDNA 4YKGA 1FEBA 3SZFA 3HZLA 4GDEA 4ZCDA 3CPHG 1RYIA 4YKFA 5KVIA 5TR3A 4Z44A 1GALA 3E1TA 2VQ7A 1E1LA 3Q6JA 2C73A 4PAAA 1OJ9A 1PXAA 1GERA 2X50A 1N1PA 3AE9A 3P4RA 4K7ZA 1M6IA 1GPEA 3GYXA 3AEFA 3C96A 3ICSA 3BI2A 3CN8A 3QVRA 3HYXA 3T0KA 3UKFA 1RSGA 2XCGA 3BI4A 4NZHA 4A99A 4CY8A 1GETA 2C65A 3BHFA 4BK3A 4H4TA 2NVKX 3GYIA 2BCGG 2JB3A 4CNKA 1FECA 4CY6A 1GTEA 4OPLA 4Z26A 1E1MA 2XFPA 2FBWA 1S3EA 1PDHA 1BKWA 3LOVA 1DODA 3UKPA 1GTHA 2FJAA 2BRAA 3QFAA 3JSKA 3ALLA 5U63A 1CC4A 3VQRA 3KPKA 1EBDA 1XANA 4X9MA 3UKHA 5FS6A 1GRHA 5IQ4A 4A7AA 3UP5A 2B76A 3C4NA 1Y56B 4JNQA 2GR2A 2C67A 3F8DA 4FX9A 1KFYA 5HHFA 5KOWA 1PJ6A 4YSHA 1MXTA 2XFQA 2WPCA 3CTYA 3NH3X 2RGJA 3BNMA 2RGOA 3GMCA 4ICYA 3V3NA 3AECA 2BRYA 1REOA 1ZK7A 1QJDA 2YG6A 3UTGA 1MO9A 3AE1A 3T31A 2OLNA 1S3BA 2XFNA 3G5SA 3L8KA 1BGNA 2TMDA 2VVLG 3QJ4A 2BYBA 4APNA 1PBEA 3AE7A 4O5UA 1PS9A 2RABA 3M0OA 3KPFA 3UTEA 3EANA 1DOBA 1EL7A 2GR0A 2XLRA 3NYEA 3SQPA 3UKLA 4CCQA 1Y56A 2HQMA 4NTCA 2UZZA 4YSXA 3UP4A 5KRQA 3H4KA 2H88A 4G74A 3AYIA 2YR5A 4J34A 4TM4A 3UKQA 1GXFA 5KMQA 1F8SA 2C64A 2OA1A 4H7UA 4PABA 4YTMA 2YWLA 5LV9A 5HXIA 4U8LA 1GT8A 3DGHA 5CQFA 2GV8A 2A8XA 2BA9A 3NLCA 2Q7VA 3AEAA 3I6DA 5GRTA 3ISHA 3HYVA 2BK4A 1RP0A 2FJDA 2YM1A 4J57A 3NTAA 2GEWA 3UKAA 2GAHB 3T2YA 3T2KA 3KA7A 4IA5A 1ZOYA 2OLOA 2YAUA 1DJNA 3VR8A 3S61A 4E0VA 2GAGB 2YLRA 3GD4A 1LVLA 2CDUA 4Y4LA 3RP8A 3P4PA 4D04A 1QO8A 2WDVA 2CVJA 2ZZCA 1OJTA 5EOWA 4EMIA 2WP5A 1CJCA 2XLUA 2YVJA 3NHOX 1COYA 3SY4A 1P2EA 1EL5A 2AQJA 4UP3A 1KNRA 1ZOVA 5KNLA 2WOVA 3NYCA 1NHQA 2YQUA 4X4JA 4LIIA 4RG3A 3CPIG 3NK0X 4NWZA 4HB9A 4YSZA 4J36A 4EQRA 1H7XA 3KU9A 1NAAA 2IVDA 4Z2TA 3RP7A 5CKUA 4DGKA 5KXJA 3DGZA 1TYTA 2XLPA 3VRBA 2C70A 2GRTA 1GRAA 1LJ1A 4HA6A 4X9NA 2JKCA 3CNPA 3F8RA 3DJGX 1GESA 1ONFA 2XFOA 1ZY8A 4B68A 1HYUA 3UKKA 4UDPA 5JCLA 3URHA 1N4VA 3AYJA 4BK2A 1CJ3A 4GF7A 3ATQA 5KMRA 1ZKQA 4II2A 4A9WA 1H83A 3UOYA 4H2QA 1NG3A 1JRXA 5J7XA 4B63A 1VG9A 1QLBA 3RHAA 3PVCA 4K2XA 1CC6A 1Y0PA 2EQ6A 3CNTA 2APGA 1B37A 4U8PA 2BABA 3AE3A 3K7QX 2E1MA 4BV6A 1PBCA 2V3AA 3C4AA 2YLWA 3QFBA 4FK1C 3BNUA 3R9UA 2PYXA 2VRLA 3FBSA 4EQSA 4P9SA 4C5OA 4AOXA 2O9ZA 3H8LA 4I59A 2GQFA 4J56A 2YR6A 3LZXA 3Q9TA 3IF9A 3VR9A 4G6HA 1E1KA 2WU5A 1Z6LA 2R9ZA 4RSLA 4YTNA 4OPTA 1TDNA 3ADAB 2GF3A 4EIPA 1UKVG 4AP3A 4H50A 3RNMA 2V5ZA 4MJWA 4H2RA 4B66A 2GH5A 3P1WA 4H4QA 1NHSA 2B7SA 1NG4A 5C2TA 3NRNA 5FS7A 1EL8A 2YLXA 3BI5A 4YWOA 4DNAA 2XLSA 2V60A 2VQBA 2BACA 3GMBA 3OC4A 5BUKA 2FJEA 4BJZA 1KF6A 2OAMA 2WP6A 2ZBWA 2GMHA 3AD9B 3AD8B 4GCMA 4XWRA 4A6NB 2AAQA 1IUWA 2YLTA 2NPXA 2XVHA 4TLZA 1FOHA 1BGJA 2C7GA 4A79A 1ZMDA 1YQ3A 1H7WA 5KOXA 2R0PA 4IA6A 4AT2A 2BXSA 2QA2A 3UTFA 1LPFA 3DK9A 1PJ5A 2VZ2A 4TLXA 2EQ7A 4IVOB 2R46A 4EIQA 1Q1RA 4H4VA 4TM3A 3AEDA 1XPQA 3SZ0A 3GWFA 2C75A 1VRQB 2WP9A 1K0IA 2R4JA 4U8IA 3CGEA 3UOZA 2A87A 3T14A 4H4RA 3BHKA 4XWZA 1GRGA 1NDAA 1PJ7A 2Z5XA 4B67A 5C3JA 2Q0LA 3DJJA 2GVCA 2E5VA 4KPRA 3B3RA 2XVFA 4C77A 3QSEA 4B65A 1H86A 1PN0A 1DOEA 5J60A 3ALJA 3NIXA 1NENA 1DXLA 3T2ZA 3CGBA 2R45A 1IUUA 1PBBA 1OJAA 4YTPA 2GB0A 4H4ZA 1ZP0A 3SX6A 1NHPA 2XVIA 4U8JA 1JNZA 1O94A 5EB5A 4AT0A 3SM8A 2WDQA 3AD7B 3GSIA 3K7MX 4GUVA 1TRBA 2XYOA 3T37A 3EF6A 4NTEA 4EMJA 1L9EA 3AEBA 5EB4A 3IWAA 3DK4A 2PHHA 3ALMA 1D4EA 1DJQA 3CNSA 4G6GA 4H4PA 4A5LA 4U2TA 4Z43A 2W0HA 3DH9A 3GWDA 3GDNA 3H8IA 2WOWA 2JBVA 2R0CA 1CHUA 5BULA 4K5SA 5HYMA 4XXGA 4H2PA 3IHGA 1FEAA 1F8WA 4O5QA 4B64A 4II3A 1F8RA 5GSNA 1GOSA 3L1RA 3NTDA 4IVMB 4LU6A 2C76A 2XVEA 2YG5A 5FS9A 2WQYA 3S5WA 2TPRA 2WHDA 4Y4NA 2X8HA 3KVEA 4Z2UA 1L0VA 5HY5A 2VRMA 2JAEA 1ZDLA 3D1CA 3AE6A 1CJ2A 1F3PA 3NT6A 4OVIA 3CGDA 1CF3A 2ZZBA 2X8GA 2XFUA 4GAVA 4USRA 4OPIA 2CFYA 2JB1A 2V61A 3UCLA 5JCKA 3COXA 2OALA 3DJEA 2YG4A 2JB2A 1GRTA 3UOVA 1W4XA 4JNAA 4B69A 1NHRA 3DK8A 1OJDA 2IVEA 4CRTA 1IJHA 1LQUA 4C3XA 2X99A 3KLJA 1H84A 1CBOA 2ZZ0A 4C74A 3GRTA 4AOSA 1K0JA 1JEHA 2YVGA 4JY2A 1E6EA 1E7PA 4GAPA 3K7TA 4EM3A 4N9XA 4OPGA 3SGLA 3LB8A 3SZCA 2X3NA 2BC1A 4U8OA 3NN0X 5M10A 5JCMA 1AOGA 3GYJA 4REKA 3NG7X 1PXBA 5JCNA 3AE4A 3KKJA 1DNCA 1PBDA 3ABVA 1PXCA 4H4YA 4H4UA 2C72A 4ADWA 2A89A 1KDGA 3SZWA 4CBQA 2B9WA 1GSNA 2WDRA 1S2YA 2Y6QA 5FMHA 4TM0A 4U8NA 4ZN0A 2BXRA 1FCDA 1XDIA 2YG7A 3G5QA 4M52A 5IQ1A 4NEVA 3AE5A 4H4SA 5BRTA 2IIDA 3DMEA 3OZ2A 1BZLA 1X31B 3P4SA 4A6NA 3F8PA 4EQXA 2GMJA 3SFEA 1JRZA 4I58A 1XHCA 3PO7A 4K8DA 2WU2A 1D7YA 3FPZA 2YLSA 4JDRA 1JOAA 3M13A 1B8SA 2X8CA 3NK2X 3P9UA 2WESA 1YY5A 1OJCA 2WOIA 1IUSA 1LTXR 1L9DA 1TDOA 3GD3A 1NPXA 4UDRA 5ER0A 2XDOA 4Y4MA 3SXIA 1JU2A 4IV9A 4RG4A 4OPUA 1GRBA 3AE2A 4TM1A 1YQZA 1JRYA 1M64A 2RGHA 2V6OA 3V76A 4GDPA 2BC0A 3K30A 3GRSA 3AB1A 3CMMA 3QVPA 4JQ9A 4YSYA 1LQTA 2GR1A 1CL0A 3ICTA 2GR3A 4J33A 3CIRA 1TDEA 1TDFA 4JN9A 1ZMCA 3EAOA 2YG3A 3IHMA 4J31A 3RP6A 2BS4A 3HYWA 4DSGA 1YQ4A 3LZWA 1Q9IA 2ACZA 4U8KA 2R4EA 4UDQA 4WCTA 5KVHA 3ATRA 2BK3A 5EBKA 2J3NA 4EM4A 2B9XA 3CNDA 5DBJA 2F5ZA 4YT0A 3QSSA 1N4UA 3M12A 3SYIA 2I0ZA 4U2LA 1D7LA 3NYFA 4FDCB 4LA1A 1K4QA 4OPDA 3NNEA 3KD9A 4Z24A 4A65A 4EMWA 2WPFA 2VVMA 2R0GA 1BWCA 2QAEA 4H4XA 1K0LA 4U8MA 4CNJA 1TDKA 2YVFA 4H4WA 2Z5YA 1E39A 3G5RA 2EQ9A 2QCUA 1GREA 2WPEA 2C4CA 1GEUA 4H2NA 3NGCX 1IUXA 1JNRA 2Q6UA 1GRFA 3CGCA 4U2SA 2QA1A 4WX1A 2BK5A 2YM2A 1O95A 1P2HA 1V59A 3SFDA 1N4WA 4ZCCA 1Q1WA 3WE0A 2WS3A 1BF3A 4NNJA 3EPTA 1L9CA 4G73A 4ECHA 3NKSA 1O5WA 1VDCA 3D8XA 3DA1A 3REDA 5BVAA 5L46A 2B7RA 2CULA 3ITJA 1IUVA 2VVLA 3AE8A 3O0HA 4G9KA 1H6VA 4EQWA 4D03A 2VOUA 2B9YA 1KSSA 1E1NA 1B4VA 2C3CA 2XVJA 3FG2P 3IC9A 3II4A 4NTDA 4DSHA 5KWFA 3LXDA 4AP1A 1FL2A 1D4CA 3ZYXA 5U25A 4FK1A 3NN6X 4Z25A 4OPCA 1GV4A 2WBAA 3V3OA 5FS8A 4JY3A 4GR1A 4GRTA 3PS9A 5JCIA 2V3BA 2C3DA 1D5TA 1DOCA 4OCGA 4C3YA 3FMWA 4BK1A 3B6DA 1VG0A 1VQWA 1LV0A 2Q0KA 2Y6RA 4NEWA 2YLZA 1EL9A 1KNPA 1MOKA 1H81A 4Z2RA 2H89A 2XLTA 1PHHA 1H82A 1PBFA 4J2WA 5KMSA 1B5QA 2WETA 5M0ZA 3UOXA 2BS2A 3NK1X 2JK6A 2AR8A 3LADA 2DKHA 1YKJA 2E4GA 1NEKA 4USQA 4CCRA 2WEUA 3UTHA 2EQ8A 3QSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYI A;  5KMP A;  4G74 A;  4G73 A;  3HYX A;  3T0K A;  3T2Z A;  5KMQ A;  4G6H A;  5KMR A;  4GAP A;  3SY4 A;  4G9K A;  3SX6 A;  3SZC A;  3T31 A;  5KMS A;  3HYW A;  4GAV A;  4NWZ A;  3SZ0 A;  3HYV A;  3SZF A;  3KPK A;  3T14 A;  4G6G A;  3SXI A;  3T2Y A;  3SZW A;  3T2K A; 
#chains in the Genus database with same CATH topology
 2FJB A;  1ZX9 A;  1F6M A;  4K22 A;  4KX6 A;  1D4D A;  2C66 A;  2GQW A;  3P4Q A;  4YXD A;  5KMP A;  2BCP A;  1ELI A;  3LJP A;  3DJD A;  4BJY A;  1CC2 A;  3CNJ A;  3AWI A;  3AEE A;  3I3L A;  1GND A;  5U1O A;  2ARD A;  1IUT A;  3AXB A;  1CJ4 A;  3FIM B;  2DKI A;  3CPJ G;  4BUR A;  2YR4 A;  3VRD B;  2BS3 A;  4B1B A;  1S2Q A;  3AEG A;  1SEZ A;  5IPY A;  1TYP A;  3ICR A;  3AYL A;  3GDP A;  3VRA A;  4K5R A;  1KSU A;  3ZDN A;  4YKG A;  1FEB A;  3SZF A;  3HZL A;  4GDE A;  4ZCD A;  3CPH G;  1RYI A;  4YKF A;  5KVI A;  5TR3 A;  4Z44 A;  1GAL A;  3E1T A;  2VQ7 A;  1E1L A;  3Q6J A;  2C73 A;  4PAA A;  1OJ9 A;  1PXA A;  1GER A;  2X50 A;  1N1P A;  3AE9 A;  3P4R A;  4K7Z A;  1M6I A;  1GPE A;  3GYX A;  3AEF A;  3C96 A;  3ICS A;  3BI2 A;  3CN8 A;  3QVR A;  3HYX A;  3T0K A;  3UKF A;  1RSG A;  2XCG A;  3BI4 A;  4NZH A;  4A99 A;  4CY8 A;  1GET A;  2C65 A;  3BHF A;  4BK3 A;  4H4T A;  2NVK X;  3GYI A;  2BCG G;  2JB3 A;  4CNK A;  1FEC A;  4CY6 A;  1GTE A;  4OPL A;  4Z26 A;  1E1M A;  2XFP A;  2FBW A;  1S3E A;  1PDH A;  1BKW A;  3LOV A;  1DOD A;  3UKP A;  1GTH A;  2FJA A;  2BRA A;  3QFA A;  3JSK A;  3ALL A;  5U63 A;  1CC4 A;  3VQR A;  3KPK A;  1EBD A;  1XAN A;  4X9M A;  3UKH A;  5FS6 A;  1GRH A;  5IQ4 A;  4A7A A;  3UP5 A;  2B76 A;  3C4N A;  1Y56 B;  4JNQ A;  2GR2 A;  2C67 A;  3F8D A;  4FX9 A;  1KFY A;  5HHF A;  5KOW A;  1PJ6 A;  4YSH A;  1MXT A;  2XFQ A;  2WPC A;  3CTY A;  3NH3 X;  2RGJ A;  3BNM A;  2RGO A;  3GMC A;  4ICY A;  3V3N A;  3AEC A;  2BRY A;  1REO A;  1ZK7 A;  1QJD A;  2YG6 A;  3UTG A;  1MO9 A;  3AE1 A;  3T31 A;  2OLN A;  1S3B A;  2XFN A;  3G5S A;  3L8K A;  1BGN A;  2TMD A;  2VVL G;  3QJ4 A;  2BYB A;  4APN A;  1PBE A;  3AE7 A;  4O5U A;  1PS9 A;  2RAB A;  3M0O A;  3KPF A;  3UTE A;  3EAN A;  1DOB A;  1EL7 A;  2GR0 A;  2XLR A;  3NYE A;  3SQP A;  3UKL A;  4CCQ A;  1Y56 A;  2HQM A;  4NTC A;  2UZZ A;  4YSX A;  3UP4 A;  5KRQ A;  3H4K A;  2H88 A;  4G74 A;  3AYI A;  2YR5 A;  4J34 A;  4TM4 A;  3UKQ A;  1GXF A;  5KMQ A;  1F8S A;  2C64 A;  2OA1 A;  4H7U A;  4PAB A;  4YTM A;  2YWL A;  5LV9 A;  5HXI A;  4U8L A;  1GT8 A;  3DGH A;  5CQF A;  2GV8 A;  2A8X A;  2BA9 A;  3NLC A;  2Q7V A;  3AEA A;  3I6D A;  5GRT A;  3ISH A;  3HYV A;  2BK4 A;  1RP0 A;  2FJD A;  2YM1 A;  4J57 A;  3NTA A;  2GEW A;  3UKA A;  2GAH B;  3T2Y A;  3T2K A;  3KA7 A;  4IA5 A;  1ZOY A;  2OLO A;  2YAU A;  1DJN A;  3VR8 A;  3S61 A;  4E0V A;  2GAG B;  2YLR A;  3GD4 A;  1LVL A;  2CDU A;  4Y4L A;  3RP8 A;  3P4P A;  4D04 A;  1QO8 A;  2WDV A;  2CVJ A;  2ZZC A;  1OJT A;  5EOW A;  4EMI A;  2WP5 A;  1CJC A;  2XLU A;  2YVJ A;  3NHO X;  1COY A;  3SY4 A;  1P2E A;  1EL5 A;  2AQJ A;  4UP3 A;  1KNR A;  1ZOV A;  5KNL A;  2WOV A;  3NYC A;  1NHQ A;  2YQU A;  4X4J A;  4LII A;  4RG3 A;  3CPI G;  3NK0 X;  4NWZ A;  4HB9 A;  4YSZ A;  4J36 A;  4EQR A;  1H7X A;  3KU9 A;  1NAA A;  2IVD A;  4Z2T A;  3RP7 A;  5CKU A;  4DGK A;  5KXJ A;  3DGZ A;  1TYT A;  2XLP A;  3VRB A;  2C70 A;  2GRT A;  1GRA A;  1LJ1 A;  4HA6 A;  4X9N A;  2JKC A;  3CNP A;  3F8R A;  3DJG X;  1GES A;  1ONF A;  2XFO A;  1ZY8 A;  4B68 A;  1HYU A;  3UKK A;  4UDP A;  5JCL A;  3URH A;  1N4V A;  3AYJ A;  4BK2 A;  1CJ3 A;  4GF7 A;  3ATQ A;  5KMR A;  1ZKQ A;  4II2 A;  4A9W A;  1H83 A;  3UOY A;  4H2Q A;  1NG3 A;  1JRX A;  5J7X A;  4B63 A;  1VG9 A;  1QLB A;  3RHA A;  3PVC A;  4K2X A;  1CC6 A;  1Y0P A;  2EQ6 A;  3CNT A;  2APG A;  1B37 A;  4U8P A;  2BAB A;  3AE3 A;  3K7Q X;  2E1M A;  4BV6 A;  1PBC A;  2V3A A;  3C4A A;  2YLW A;  3QFB A;  4FK1 C;  3BNU A;  3R9U A;  2PYX A;  2VRL A;  3FBS A;  4EQS A;  4P9S A;  4C5O A;  4AOX A;  2O9Z A;  3H8L A;  4I59 A;  2GQF A;  4J56 A;  2YR6 A;  3LZX A;  3Q9T A;  3IF9 A;  3VR9 A;  4G6H A;  1E1K A;  2WU5 A;  1Z6L A;  2R9Z A;  4RSL A;  4YTN A;  4OPT A;  1TDN A;  3ADA B;  2GF3 A;  4EIP A;  1UKV G;  4AP3 A;  4H50 A;  3RNM A;  2V5Z A;  4MJW A;  4H2R A;  4B66 A;  2GH5 A;  3P1W A;  4H4Q A;  1NHS A;  2B7S A;  1NG4 A;  5C2T A;  3NRN A;  5FS7 A;  1EL8 A;  2YLX A;  3BI5 A;  4YWO A;  4DNA A;  2XLS A;  2V60 A;  2VQB A;  2BAC A;  3GMB A;  3OC4 A;  5BUK A;  2FJE A;  4BJZ A;  1KF6 A;  2OAM A;  2WP6 A;  2ZBW A;  2GMH A;  3AD9 B;  3AD8 B;  4GCM A;  4XWR A;  4A6N B;  2AAQ A;  1IUW A;  2YLT A;  2NPX A;  2XVH A;  4TLZ A;  1FOH A;  1BGJ A;  2C7G A;  4A79 A;  1ZMD A;  1YQ3 A;  1H7W A;  5KOX A;  2R0P A;  4IA6 A;  4AT2 A;  2BXS A;  2QA2 A;  3UTF A;  1LPF A;  3DK9 A;  1PJ5 A;  2VZ2 A;  4TLX A;  2EQ7 A;  4IVO B;  2R46 A;  4EIQ A;  1Q1R A;  4H4V A;  4TM3 A;  3AED A;  1XPQ A;  3SZ0 A;  3GWF A;  2C75 A;  1VRQ B;  2WP9 A;  1K0I A;  2R4J A;  4U8I A;  3CGE A;  3UOZ A;  2A87 A;  3T14 A;  4H4R A;  3BHK A;  4XWZ A;  1GRG A;  1NDA A;  1PJ7 A;  2Z5X A;  4B67 A;  5C3J A;  2Q0L A;  3DJJ A;  2GVC A;  2E5V A;  4KPR A;  3B3R A;  2XVF A;  4C77 A;  3QSE A;  4B65 A;  1H86 A;  1PN0 A;  1DOE A;  5J60 A;  3ALJ A;  3NIX A;  1NEN A;  1DXL A;  3T2Z A;  3CGB A;  2R45 A;  1IUU A;  1PBB A;  1OJA A;  4YTP A;  2GB0 A;  4H4Z A;  1ZP0 A;  3SX6 A;  1NHP A;  2XVI A;  4U8J A;  1JNZ A;  1O94 A;  5EB5 A;  4AT0 A;  3SM8 A;  2WDQ A;  3AD7 B;  3GSI A;  3K7M X;  4GUV A;  1TRB A;  2XYO A;  3T37 A;  3EF6 A;  4NTE A;  4EMJ A;  1L9E A;  3AEB A;  5EB4 A;  3IWA A;  3DK4 A;  2PHH A;  3ALM A;  1D4E A;  1DJQ A;  3CNS A;  4G6G A;  4H4P A;  4A5L A;  4U2T A;  4Z43 A;  2W0H A;  3DH9 A;  3GWD A;  3GDN A;  3H8I A;  2WOW A;  2JBV A;  2R0C A;  1CHU A;  5BUL A;  4K5S A;  5HYM A;  4XXG A;  4H2P A;  3IHG A;  1FEA A;  1F8W A;  4O5Q A;  4B64 A;  4II3 A;  1F8R A;  5GSN A;  1GOS A;  3L1R A;  3NTD A;  4IVM B;  4LU6 A;  2C76 A;  2XVE A;  2YG5 A;  5FS9 A;  2WQY A;  3S5W A;  2TPR A;  2WHD A;  4Y4N A;  2X8H A;  3KVE A;  4Z2U A;  1L0V A;  5HY5 A;  2VRM A;  2JAE A;  1ZDL A;  3D1C A;  3AE6 A;  1CJ2 A;  1F3P A;  3NT6 A;  4OVI A;  3CGD A;  1CF3 A;  2ZZB A;  2X8G A;  2XFU A;  4GAV A;  4USR A;  4OPI A;  2CFY A;  2JB1 A;  2V61 A;  3UCL A;  5JCK A;  3COX A;  2OAL A;  3DJE A;  2YG4 A;  2JB2 A;  1GRT A;  3UOV A;  1W4X A;  4JNA A;  4B69 A;  1NHR A;  3DK8 A;  1OJD A;  2IVE A;  4CRT A;  1IJH A;  1LQU A;  4C3X A;  2X99 A;  3KLJ A;  1H84 A;  1CBO A;  2ZZ0 A;  4C74 A;  3GRT A;  4AOS A;  1K0J A;  1JEH A;  2YVG A;  4JY2 A;  1E6E A;  1E7P A;  4GAP A;  3K7T A;  4EM3 A;  4N9X A;  4OPG A;  3SGL A;  3LB8 A;  3SZC A;  2X3N A;  2BC1 A;  4U8O A;  3NN0 X;  5M10 A;  5JCM A;  1AOG A;  3GYJ A;  4REK A;  3NG7 X;  1PXB A;  5JCN A;  3AE4 A;  3KKJ A;  1DNC A;  1PBD A;  3ABV A;  1PXC A;  4H4Y A;  4H4U A;  2C72 A;  4ADW A;  2A89 A;  1KDG A;  3SZW A;  4CBQ A;  2B9W A;  1GSN A;  2WDR A;  1S2Y A;  2Y6Q A;  5FMH A;  4TM0 A;  4U8N A;  4ZN0 A;  2BXR A;  1FCD A;  1XDI A;  2YG7 A;  3G5Q A;  4M52 A;  5IQ1 A;  4NEV A;  3AE5 A;  4H4S A;  5BRT A;  2IID A;  3DME A;  3OZ2 A;  1BZL A;  1X31 B;  3P4S A;  4A6N A;  3F8P A;  4EQX A;  2GMJ A;  3SFE A;  1JRZ A;  4I58 A;  1XHC A;  3PO7 A;  4K8D A;  2WU2 A;  1D7Y A;  3FPZ A;  2YLS A;  4JDR A;  1JOA A;  3M13 A;  1B8S A;  2X8C A;  3NK2 X;  3P9U A;  2WES A;  1YY5 A;  1OJC A;  2WOI A;  1IUS A;  1LTX R;  1L9D A;  1TDO A;  3GD3 A;  1NPX A;  4UDR A;  5ER0 A;  2XDO A;  4Y4M A;  3SXI A;  1JU2 A;  4IV9 A;  4RG4 A;  4OPU A;  1GRB A;  3AE2 A;  4TM1 A;  1YQZ A;  1JRY A;  1M64 A;  2RGH A;  2V6O A;  3V76 A;  4GDP A;  2BC0 A;  3K30 A;  3GRS A;  3AB1 A;  3CMM A;  3QVP A;  4JQ9 A;  4YSY A;  1LQT A;  2GR1 A;  1CL0 A;  3ICT A;  2GR3 A;  4J33 A;  3CIR A;  1TDE A;  1TDF A;  4JN9 A;  1ZMC A;  3EAO A;  2YG3 A;  3IHM A;  4J31 A;  3RP6 A;  2BS4 A;  3HYW A;  4DSG A;  1YQ4 A;  3LZW A;  1Q9I A;  2ACZ A;  4U8K A;  2R4E A;  4UDQ A;  4WCT A;  5KVH A;  3ATR A;  2BK3 A;  5EBK A;  2J3N A;  4EM4 A;  2B9X A;  3CND A;  5DBJ A;  2F5Z A;  4YT0 A;  3QSS A;  1N4U A;  3M12 A;  3SYI A;  2I0Z A;  4U2L A;  1D7L A;  3NYF A;  4FDC B;  4LA1 A;  1K4Q A;  4OPD A;  3NNE A;  3KD9 A;  4Z24 A;  4A65 A;  4EMW A;  2WPF A;  2VVM A;  2R0G A;  1BWC A;  2QAE A;  4H4X A;  1K0L A;  4U8M A;  4CNJ A;  1TDK A;  2YVF A;  4H4W A;  2Z5Y A;  1E39 A;  3G5R A;  2EQ9 A;  2QCU A;  1GRE A;  2WPE A;  2C4C A;  1GEU A;  4H2N A;  3NGC X;  1IUX A;  1JNR A;  2Q6U A;  1GRF A;  3CGC A;  4U2S A;  2QA1 A;  4WX1 A;  2BK5 A;  2YM2 A;  1O95 A;  1P2H A;  1V59 A;  3SFD A;  1N4W A;  4ZCC A;  1Q1W A;  3WE0 A;  2WS3 A;  1BF3 A;  4NNJ A;  3EPT A;  1L9C A;  4G73 A;  4ECH A;  3NKS A;  1O5W A;  1VDC A;  3D8X A;  3DA1 A;  3RED A;  5BVA A;  5L46 A;  2B7R A;  2CUL A;  3ITJ A;  1IUV A;  2VVL A;  3AE8 A;  3O0H A;  4G9K A;  1H6V A;  4EQW A;  4D03 A;  2VOU A;  2B9Y A;  1KSS A;  1E1N A;  1B4V A;  2C3C A;  2XVJ A;  3FG2 P;  3IC9 A;  3II4 A;  4NTD A;  4DSH A;  5KWF A;  3LXD A;  4AP1 A;  1FL2 A;  1D4C A;  3ZYX A;  5U25 A;  4FK1 A;  3NN6 X;  4Z25 A;  4OPC A;  1GV4 A;  2WBA A;  3V3O A;  5FS8 A;  4JY3 A;  4GR1 A;  4GRT A;  3PS9 A;  5JCI A;  2V3B A;  2C3D A;  1D5T A;  1DOC A;  4OCG A;  4C3Y A;  3FMW A;  4BK1 A;  3B6D A;  1VG0 A;  1VQW A;  1LV0 A;  2Q0K A;  2Y6R A;  4NEW A;  2YLZ A;  1EL9 A;  1KNP A;  1MOK A;  1H81 A;  4Z2R A;  2H89 A;  2XLT A;  1PHH A;  1H82 A;  1PBF A;  4J2W A;  5KMS A;  1B5Q A;  2WET A;  5M0Z A;  3UOX A;  2BS2 A;  3NK1 X;  2JK6 A;  2AR8 A;  3LAD A;  2DKH A;  1YKJ A;  2E4G A;  1NEK A;  4USQ A;  4CCR A;  2WEU A;  3UTH A;  2EQ8 A;  3QSM A; 
#chains in the Genus database with same CATH homology
 2FJB A;  1ZX9 A;  1F6M A;  4K22 A;  4KX6 A;  1D4D A;  2C66 A;  2GQW A;  3P4Q A;  4YXD A;  5KMP A;  2BCP A;  1ELI A;  3LJP A;  3DJD A;  4BJY A;  1CC2 A;  3CNJ A;  3AWI A;  3AEE A;  3I3L A;  1GND A;  5U1O A;  2ARD A;  1IUT A;  3AXB A;  1CJ4 A;  3FIM B;  2DKI A;  3CPJ G;  4BUR A;  2YR4 A;  3VRD B;  2BS3 A;  4B1B A;  1S2Q A;  3AEG A;  1SEZ A;  5IPY A;  1TYP A;  3ICR A;  3AYL A;  3GDP A;  3VRA A;  4K5R A;  1KSU A;  3ZDN A;  4YKG A;  1FEB A;  3SZF A;  3HZL A;  4GDE A;  4ZCD A;  3CPH G;  1RYI A;  4YKF A;  5KVI A;  5TR3 A;  4Z44 A;  1GAL A;  3E1T A;  2VQ7 A;  1E1L A;  3Q6J A;  2C73 A;  4PAA A;  1OJ9 A;  1PXA A;  1GER A;  2X50 A;  1N1P A;  3AE9 A;  3P4R A;  4K7Z A;  1M6I A;  1GPE A;  3GYX A;  3AEF A;  3C96 A;  3ICS A;  3BI2 A;  3CN8 A;  3QVR A;  3HYX A;  3T0K A;  3UKF A;  1RSG A;  2XCG A;  3BI4 A;  4NZH A;  4A99 A;  4CY8 A;  1GET A;  2C65 A;  3BHF A;  4BK3 A;  4H4T A;  2NVK X;  3GYI A;  2BCG G;  2JB3 A;  4CNK A;  1FEC A;  4CY6 A;  1GTE A;  4OPL A;  4Z26 A;  1E1M A;  2XFP A;  2FBW A;  1S3E A;  1PDH A;  1BKW A;  3LOV A;  1DOD A;  3UKP A;  1GTH A;  2FJA A;  2BRA A;  3QFA A;  3JSK A;  3ALL A;  5U63 A;  1CC4 A;  3VQR A;  3KPK A;  1EBD A;  1XAN A;  4X9M A;  3UKH A;  5FS6 A;  1GRH A;  5IQ4 A;  4A7A A;  3UP5 A;  2B76 A;  3C4N A;  1Y56 B;  4JNQ A;  2GR2 A;  2C67 A;  3F8D A;  4FX9 A;  1KFY A;  5HHF A;  5KOW A;  1PJ6 A;  4YSH A;  1MXT A;  2XFQ A;  2WPC A;  3CTY A;  3NH3 X;  2RGJ A;  3BNM A;  2RGO A;  3GMC A;  4ICY A;  3V3N A;  3AEC A;  2BRY A;  1REO A;  1ZK7 A;  1QJD A;  2YG6 A;  3UTG A;  1MO9 A;  3AE1 A;  3T31 A;  2OLN A;  1S3B A;  2XFN A;  3G5S A;  3L8K A;  1BGN A;  2TMD A;  2VVL G;  3QJ4 A;  2BYB A;  4APN A;  1PBE A;  3AE7 A;  4O5U A;  1PS9 A;  2RAB A;  3M0O A;  3KPF A;  3UTE A;  3EAN A;  1DOB A;  1EL7 A;  2GR0 A;  2XLR A;  3NYE A;  3SQP A;  3UKL A;  4CCQ A;  1Y56 A;  2HQM A;  4NTC A;  2UZZ A;  4YSX A;  3UP4 A;  5KRQ A;  3H4K A;  2H88 A;  4G74 A;  3AYI A;  2YR5 A;  4J34 A;  4TM4 A;  3UKQ A;  1GXF A;  5KMQ A;  1F8S A;  2C64 A;  2OA1 A;  4H7U A;  4PAB A;  4YTM A;  2YWL A;  5LV9 A;  5HXI A;  4U8L A;  1GT8 A;  3DGH A;  5CQF A;  2GV8 A;  2A8X A;  2BA9 A;  3NLC A;  2Q7V A;  3AEA A;  3I6D A;  5GRT A;  3ISH A;  3HYV A;  2BK4 A;  1RP0 A;  2FJD A;  2YM1 A;  4J57 A;  3NTA A;  2GEW A;  3UKA A;  2GAH B;  3T2Y A;  3T2K A;  3KA7 A;  4IA5 A;  1ZOY A;  2OLO A;  2YAU A;  1DJN A;  3VR8 A;  3S61 A;  4E0V A;  2GAG B;  2YLR A;  3GD4 A;  1LVL A;  2CDU A;  4Y4L A;  3RP8 A;  3P4P A;  4D04 A;  1QO8 A;  2WDV A;  2CVJ A;  2ZZC A;  1OJT A;  5EOW A;  4EMI A;  2WP5 A;  1CJC A;  2XLU A;  2YVJ A;  3NHO X;  1COY A;  3SY4 A;  1P2E A;  1EL5 A;  2AQJ A;  4UP3 A;  1KNR A;  1ZOV A;  5KNL A;  2WOV A;  3NYC A;  1NHQ A;  2YQU A;  4X4J A;  4LII A;  4RG3 A;  3CPI G;  3NK0 X;  4NWZ A;  4HB9 A;  4YSZ A;  4J36 A;  4EQR A;  1H7X A;  3KU9 A;  1NAA A;  2IVD A;  4Z2T A;  3RP7 A;  5CKU A;  4DGK A;  5KXJ A;  3DGZ A;  1TYT A;  2XLP A;  3VRB A;  2C70 A;  2GRT A;  1GRA A;  1LJ1 A;  4HA6 A;  4X9N A;  2JKC A;  3CNP A;  3F8R A;  3DJG X;  1GES A;  1ONF A;  2XFO A;  1ZY8 A;  4B68 A;  1HYU A;  3UKK A;  4UDP A;  5JCL A;  3URH A;  1N4V A;  3AYJ A;  4BK2 A;  1CJ3 A;  4GF7 A;  3ATQ A;  5KMR A;  1ZKQ A;  4II2 A;  4A9W A;  1H83 A;  3UOY A;  4H2Q A;  1NG3 A;  1JRX A;  5J7X A;  4B63 A;  1VG9 A;  1QLB A;  3RHA A;  3PVC A;  4K2X A;  1CC6 A;  1Y0P A;  2EQ6 A;  3CNT A;  2APG A;  1B37 A;  4U8P A;  2BAB A;  3AE3 A;  3K7Q X;  2E1M A;  4BV6 A;  1PBC A;  2V3A A;  3C4A A;  2YLW A;  3QFB A;  4FK1 C;  3BNU A;  3R9U A;  2PYX A;  2VRL A;  3FBS A;  4EQS A;  4P9S A;  4C5O A;  4AOX A;  2O9Z A;  3H8L A;  4I59 A;  2GQF A;  4J56 A;  2YR6 A;  3LZX A;  3Q9T A;  3IF9 A;  3VR9 A;  4G6H A;  1E1K A;  2WU5 A;  1Z6L A;  2R9Z A;  4RSL A;  4YTN A;  4OPT A;  1TDN A;  3ADA B;  2GF3 A;  4EIP A;  1UKV G;  4AP3 A;  4H50 A;  3RNM A;  2V5Z A;  4MJW A;  4H2R A;  4B66 A;  2GH5 A;  3P1W A;  4H4Q A;  1NHS A;  2B7S A;  1NG4 A;  5C2T A;  3NRN A;  5FS7 A;  1EL8 A;  2YLX A;  3BI5 A;  4YWO A;  4DNA A;  2XLS A;  2V60 A;  2VQB A;  2BAC A;  3GMB A;  3OC4 A;  5BUK A;  2FJE A;  4BJZ A;  1KF6 A;  2OAM A;  2WP6 A;  2ZBW A;  2GMH A;  3AD9 B;  3AD8 B;  4GCM A;  4XWR A;  4A6N B;  2AAQ A;  1IUW A;  2YLT A;  2NPX A;  2XVH A;  4TLZ A;  1FOH A;  1BGJ A;  2C7G A;  4A79 A;  1ZMD A;  1YQ3 A;  1H7W A;  5KOX A;  2R0P A;  4IA6 A;  4AT2 A;  2BXS A;  2QA2 A;  3UTF A;  1LPF A;  3DK9 A;  1PJ5 A;  2VZ2 A;  4TLX A;  2EQ7 A;  4IVO B;  2R46 A;  4EIQ A;  1Q1R A;  4H4V A;  4TM3 A;  3AED A;  1XPQ A;  3SZ0 A;  3GWF A;  2C75 A;  1VRQ B;  2WP9 A;  1K0I A;  2R4J A;  4U8I A;  3CGE A;  3UOZ A;  2A87 A;  3T14 A;  4H4R A;  3BHK A;  4XWZ A;  1GRG A;  1NDA A;  1PJ7 A;  2Z5X A;  4B67 A;  5C3J A;  2Q0L A;  3DJJ A;  2GVC A;  2E5V A;  4KPR A;  3B3R A;  2XVF A;  4C77 A;  3QSE A;  4B65 A;  1H86 A;  1PN0 A;  1DOE A;  5J60 A;  3ALJ A;  3NIX A;  1NEN A;  1DXL A;  3T2Z A;  3CGB A;  2R45 A;  1IUU A;  1PBB A;  1OJA A;  4YTP A;  2GB0 A;  4H4Z A;  1ZP0 A;  3SX6 A;  1NHP A;  2XVI A;  4U8J A;  1JNZ A;  1O94 A;  5EB5 A;  4AT0 A;  3SM8 A;  2WDQ A;  3AD7 B;  3GSI A;  3K7M X;  4GUV A;  1TRB A;  2XYO A;  3T37 A;  3EF6 A;  4NTE A;  4EMJ A;  1L9E A;  3AEB A;  5EB4 A;  3IWA A;  3DK4 A;  2PHH A;  3ALM A;  1D4E A;  1DJQ A;  3CNS A;  4G6G A;  4H4P A;  4A5L A;  4U2T A;  4Z43 A;  2W0H A;  3DH9 A;  3GWD A;  3GDN A;  3H8I A;  2WOW A;  2JBV A;  2R0C A;  1CHU A;  5BUL A;  4K5S A;  5HYM A;  4XXG A;  4H2P A;  3IHG A;  1FEA A;  1F8W A;  4O5Q A;  4B64 A;  4II3 A;  1F8R A;  5GSN A;  1GOS A;  3L1R A;  3NTD A;  4IVM B;  4LU6 A;  2C76 A;  2XVE A;  2YG5 A;  5FS9 A;  2WQY A;  3S5W A;  2TPR A;  2WHD A;  4Y4N A;  2X8H A;  3KVE A;  4Z2U A;  1L0V A;  5HY5 A;  2VRM A;  2JAE A;  1ZDL A;  3D1C A;  3AE6 A;  1CJ2 A;  1F3P A;  3NT6 A;  4OVI A;  3CGD A;  1CF3 A;  2ZZB A;  2X8G A;  2XFU A;  4GAV A;  4USR A;  4OPI A;  2CFY A;  2JB1 A;  2V61 A;  3UCL A;  5JCK A;  3COX A;  2OAL A;  3DJE A;  2YG4 A;  2JB2 A;  1GRT A;  3UOV A;  1W4X A;  4JNA A;  4B69 A;  1NHR A;  3DK8 A;  1OJD A;  2IVE A;  4CRT A;  1IJH A;  1LQU A;  4C3X A;  2X99 A;  3KLJ A;  1H84 A;  1CBO A;  2ZZ0 A;  4C74 A;  3GRT A;  4AOS A;  1K0J A;  1JEH A;  2YVG A;  4JY2 A;  1E6E A;  1E7P A;  4GAP A;  3K7T A;  4EM3 A;  4N9X A;  4OPG A;  3SGL A;  3LB8 A;  3SZC A;  2X3N A;  2BC1 A;  4U8O A;  3NN0 X;  5M10 A;  5JCM A;  1AOG A;  3GYJ A;  4REK A;  3NG7 X;  1PXB A;  5JCN A;  3AE4 A;  3KKJ A;  1DNC A;  1PBD A;  3ABV A;  1PXC A;  4H4Y A;  4H4U A;  2C72 A;  4ADW A;  2A89 A;  1KDG A;  3SZW A;  4CBQ A;  2B9W A;  1GSN A;  2WDR A;  1S2Y A;  2Y6Q A;  5FMH A;  4TM0 A;  4U8N A;  4ZN0 A;  2BXR A;  1FCD A;  1XDI A;  2YG7 A;  3G5Q A;  4M52 A;  5IQ1 A;  4NEV A;  3AE5 A;  4H4S A;  5BRT A;  2IID A;  3DME A;  3OZ2 A;  1BZL A;  1X31 B;  3P4S A;  4A6N A;  3F8P A;  4EQX A;  2GMJ A;  3SFE A;  1JRZ A;  4I58 A;  1XHC A;  3PO7 A;  4K8D A;  2WU2 A;  1D7Y A;  3FPZ A;  2YLS A;  4JDR A;  1JOA A;  3M13 A;  1B8S A;  2X8C A;  3NK2 X;  3P9U A;  2WES A;  1YY5 A;  1OJC A;  2WOI A;  1IUS A;  1LTX R;  1L9D A;  1TDO A;  3GD3 A;  1NPX A;  4UDR A;  5ER0 A;  2XDO A;  4Y4M A;  3SXI A;  1JU2 A;  4IV9 A;  4RG4 A;  4OPU A;  1GRB A;  3AE2 A;  4TM1 A;  1YQZ A;  1JRY A;  1M64 A;  2RGH A;  2V6O A;  3V76 A;  4GDP A;  2BC0 A;  3K30 A;  3GRS A;  3AB1 A;  3CMM A;  3QVP A;  4JQ9 A;  4YSY A;  1LQT A;  2GR1 A;  1CL0 A;  3ICT A;  2GR3 A;  4J33 A;  3CIR A;  1TDE A;  1TDF A;  4JN9 A;  1ZMC A;  3EAO A;  2YG3 A;  3IHM A;  4J31 A;  3RP6 A;  2BS4 A;  3HYW A;  4DSG A;  1YQ4 A;  3LZW A;  1Q9I A;  2ACZ A;  4U8K A;  2R4E A;  4UDQ A;  4WCT A;  5KVH A;  3ATR A;  2BK3 A;  5EBK A;  2J3N A;  4EM4 A;  2B9X A;  3CND A;  5DBJ A;  2F5Z A;  4YT0 A;  3QSS A;  1N4U A;  3M12 A;  3SYI A;  2I0Z A;  4U2L A;  1D7L A;  3NYF A;  4FDC B;  4LA1 A;  1K4Q A;  4OPD A;  3NNE A;  3KD9 A;  4Z24 A;  4A65 A;  4EMW A;  2WPF A;  2VVM A;  2R0G A;  1BWC A;  2QAE A;  4H4X A;  1K0L A;  4U8M A;  4CNJ A;  1TDK A;  2YVF A;  4H4W A;  2Z5Y A;  1E39 A;  3G5R A;  2EQ9 A;  2QCU A;  1GRE A;  2WPE A;  2C4C A;  1GEU A;  4H2N A;  3NGC X;  1IUX A;  1JNR A;  2Q6U A;  1GRF A;  3CGC A;  4U2S A;  2QA1 A;  4WX1 A;  2BK5 A;  2YM2 A;  1O95 A;  1P2H A;  1V59 A;  3SFD A;  1N4W A;  4ZCC A;  1Q1W A;  3WE0 A;  2WS3 A;  1BF3 A;  4NNJ A;  3EPT A;  1L9C A;  4G73 A;  4ECH A;  3NKS A;  1O5W A;  1VDC A;  3D8X A;  3DA1 A;  3RED A;  5BVA A;  5L46 A;  2B7R A;  2CUL A;  3ITJ A;  1IUV A;  2VVL A;  3AE8 A;  3O0H A;  4G9K A;  1H6V A;  4EQW A;  4D03 A;  2VOU A;  2B9Y A;  1KSS A;  1E1N A;  1B4V A;  2C3C A;  2XVJ A;  3FG2 P;  3IC9 A;  3II4 A;  4NTD A;  4DSH A;  5KWF A;  3LXD A;  4AP1 A;  1FL2 A;  1D4C A;  3ZYX A;  5U25 A;  4FK1 A;  3NN6 X;  4Z25 A;  4OPC A;  1GV4 A;  2WBA A;  3V3O A;  5FS8 A;  4JY3 A;  4GR1 A;  4GRT A;  3PS9 A;  5JCI A;  2V3B A;  2C3D A;  1D5T A;  1DOC A;  4OCG A;  4C3Y A;  3FMW A;  4BK1 A;  3B6D A;  1VG0 A;  1VQW A;  1LV0 A;  2Q0K A;  2Y6R A;  4NEW A;  2YLZ A;  1EL9 A;  1KNP A;  1MOK A;  1H81 A;  4Z2R A;  2H89 A;  2XLT A;  1PHH A;  1H82 A;  1PBF A;  4J2W A;  5KMS A;  1B5Q A;  2WET A;  5M0Z A;  3UOX A;  2BS2 A;  3NK1 X;  2JK6 A;  2AR8 A;  3LAD A;  2DKH A;  1YKJ A;  2E4G A;  1NEK A;  4USQ A;  4CCR A;  2WEU A;  3UTH A;  2EQ8 A;  3QSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...