4GB34

Human coxsackievirus b3 strain rd coat protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
55
Chain Sequence
b'GAQVSTQKTGIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKSLPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein 1
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 55
sequence length 68
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4gb3400
1ASJ4 1NCQD 1R084 2R044 1COV4 1EAH4 1MQTD 1POV0 1RUE4 1PVC4 1VBC4 2PLV4 1RUI4 2RMU4 1RUC4 1RUJ4 1RVF4 1VBE4 4Q4W4 2X5ID 1PO24 2RM24 4Q4X4 4Q4Y4 1Z7S4 1AR94 1AR84 1EV14 1RUG4 1RUF4 4Q4V4 1PO14 1OOPD 1RUD4 2R074 1VRH4 1RMU4 2HWB4 1H8TD 2RS14 1VBA4 4PDWD 1VBB4 1AL24 1NA1D 1PIV4 2R064 1BEV4 1K5MD 1D4M4 2RS54 1VBD4 1R094 2RR14 3JD74 2RS34 4GB34 1HRV4 1HRI4 2HWC4 3JBG4 1AR64 1RHI4 4RHV4 1HXS4 1RUH4 1AR74 3J8F4
chains in the Genus database with same CATH superfamily
1NCQD 1YQ4A 2R044 2WDVA 3AE4A 3VR9A 1POV0 1PVC4 1L0VA 2PLV4 1PO24 4Q4X4 4YTMA 1ZP0A 4Q4V4 1RUF4 3AE1A 1KFYA 1VRH4 3P4RA 1H8TD 3AE6A 1NENA 3AEGA 2PW9A 3VR8A 2H89A 2R064 1R094 4YT0A 4GB34 1HRV4 2R7FA 4YXDA 3AECA 2HWC4 3VRAA 4RHV4 3AEDA 1RUH4 5C2TA 3SUCA 3SFDA 1VBC4 1XHZA 2RMU4 3P4PA 1XHXA 3AEEA 4YTNA 2FBWA 3AE7A 4Q4Y4 1RUG4 1RMU4 2EX3A 2WQYA 5C3JA 2RS14 1VBA4 1YQ3A 3CIRA 3P4QA 2WU5A 3FI7A 1K5MD 2RS54 1VBD4 3AE5A 3P4SA 3JBG4 1RHI4 2PYLA 1ASJ4 1R084 3AE2A 1ZOYA 1COV4 3AE3A 1EAH4 1RUE4 1RUI4 3GQHA 1RUJ4 2X5ID 2PYJA 2RM24 1Z7S4 1AR94 1AR84 2PZSA 1XI1A 2PY5A 1RUD4 2R074 2ACZA 3VRBA 4PDWD 1VBB4 1PIV4 3GQKA 2B76A 4KX6A 3JD74 2WP9A 3J8F4 3AEAA 2WS3A 1MQTD 2H88A 4YSYA 1NEKA 4Q4W4 1RUC4 4YSZA 1VBE4 3SFEA 2WDRA 1EV14 1PO14 3AEFA 1OOPD 2HWB4 3AEBA 1AL24 1NA1D 3AE8A 1BEV4 4YTPA 1D4M4 2WDQA 3ABVA 4YSXA 3AE9A 2RR14 2RS34 1HRI4 1AR64 2WU2A 1HXS4 1RVF4 1AR74 1KF6A
chains in the Genus database with same CATH topology
1ASJ4 1NCQD 1R084 2R044 1COV4 1EAH4 1MQTD 1POV0 1RUE4 1PVC4 1VBC4 2PLV4 1RUI4 2RMU4 1RUC4 1RUJ4 1RVF4 1VBE4 4Q4W4 2X5ID 1PO24 2RM24 4Q4X4 4Q4Y4 1Z7S4 1AR94 1AR84 1EV14 1RUG4 1RUF4 4Q4V4 1PO14 1OOPD 1RUD4 2R074 1VRH4 1RMU4 2HWB4 1H8TD 2RS14 1VBA4 4PDWD 1VBB4 1AL24 1NA1D 1PIV4 2R064 1BEV4 1K5MD 1D4M4 2RS54 1VBD4 1R094 2RR14 3JD74 2RS34 4GB34 1HRV4 1HRI4 2HWC4 3JBG4 1AR64 1RHI4 4RHV4 1HXS4 1RUH4 1AR74 3J8F4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASJ 4;  1NCQ D;  1R08 4;  2R04 4;  1COV 4;  1EAH 4;  1MQT D;  1POV 0;  1RUE 4;  1PVC 4;  1VBC 4;  2PLV 4;  1RUI 4;  2RMU 4;  1RUC 4;  1RUJ 4;  1RVF 4;  1VBE 4;  4Q4W 4;  2X5I D;  1PO2 4;  2RM2 4;  4Q4X 4;  4Q4Y 4;  1Z7S 4;  1AR9 4;  1AR8 4;  1EV1 4;  1RUG 4;  1RUF 4;  4Q4V 4;  1PO1 4;  1OOP D;  1RUD 4;  2R07 4;  1VRH 4;  1RMU 4;  2HWB 4;  1H8T D;  2RS1 4;  1VBA 4;  4PDW D;  1VBB 4;  1AL2 4;  1NA1 D;  1PIV 4;  2R06 4;  1BEV 4;  1K5M D;  1D4M 4;  2RS5 4;  1VBD 4;  1R09 4;  2RR1 4;  3JD7 4;  2RS3 4;  4GB3 4;  1HRV 4;  1HRI 4;  2HWC 4;  3JBG 4;  1AR6 4;  1RHI 4;  4RHV 4;  1HXS 4;  1RUH 4;  1AR7 4;  3J8F 4; 
#chains in the Genus database with same CATH topology
 1NCQ D;  1YQ4 A;  2R04 4;  2WDV A;  3AE4 A;  3VR9 A;  1POV 0;  1PVC 4;  1L0V A;  2PLV 4;  1PO2 4;  4Q4X 4;  4YTM A;  1ZP0 A;  4Q4V 4;  1RUF 4;  3AE1 A;  1KFY A;  1VRH 4;  3P4R A;  1H8T D;  3AE6 A;  1NEN A;  3AEG A;  2PW9 A;  3VR8 A;  2H89 A;  2R06 4;  1R09 4;  4YT0 A;  4GB3 4;  1HRV 4;  2R7F A;  4YXD A;  3AEC A;  2HWC 4;  3VRA A;  4RHV 4;  3AED A;  1RUH 4;  5C2T A;  3SUC A;  3SFD A;  1VBC 4;  1XHZ A;  2RMU 4;  3P4P A;  1XHX A;  3AEE A;  4YTN A;  2FBW A;  3AE7 A;  4Q4Y 4;  1RUG 4;  1RMU 4;  2EX3 A;  2WQY A;  5C3J A;  2RS1 4;  1VBA 4;  1YQ3 A;  3CIR A;  3P4Q A;  2WU5 A;  3FI7 A;  1K5M D;  2RS5 4;  1VBD 4;  3AE5 A;  3P4S A;  3JBG 4;  1RHI 4;  2PYL A;  1ASJ 4;  1R08 4;  3AE2 A;  1ZOY A;  1COV 4;  3AE3 A;  1EAH 4;  1RUE 4;  1RUI 4;  3GQH A;  1RUJ 4;  2X5I D;  2PYJ A;  2RM2 4;  1Z7S 4;  1AR9 4;  1AR8 4;  2PZS A;  1XI1 A;  2PY5 A;  1RUD 4;  2R07 4;  2ACZ A;  3VRB A;  4PDW D;  1VBB 4;  1PIV 4;  3GQK A;  2B76 A;  4KX6 A;  3JD7 4;  2WP9 A;  3J8F 4;  3AEA A;  2WS3 A;  1MQT D;  2H88 A;  4YSY A;  1NEK A;  4Q4W 4;  1RUC 4;  4YSZ A;  1VBE 4;  3SFE A;  2WDR A;  1EV1 4;  1PO1 4;  3AEF A;  1OOP D;  2HWB 4;  3AEB A;  1AL2 4;  1NA1 D;  3AE8 A;  1BEV 4;  4YTP A;  1D4M 4;  2WDQ A;  3ABV A;  4YSX A;  3AE9 A;  2RR1 4;  2RS3 4;  1HRI 4;  1AR6 4;  2WU2 A;  1HXS 4;  1RVF 4;  1AR7 4;  1KF6 A; 
#chains in the Genus database with same CATH homology
 1ASJ 4;  1NCQ D;  1R08 4;  2R04 4;  1COV 4;  1EAH 4;  1MQT D;  1POV 0;  1RUE 4;  1PVC 4;  1VBC 4;  2PLV 4;  1RUI 4;  2RMU 4;  1RUC 4;  1RUJ 4;  1RVF 4;  1VBE 4;  4Q4W 4;  2X5I D;  1PO2 4;  2RM2 4;  4Q4X 4;  4Q4Y 4;  1Z7S 4;  1AR9 4;  1AR8 4;  1EV1 4;  1RUG 4;  1RUF 4;  4Q4V 4;  1PO1 4;  1OOP D;  1RUD 4;  2R07 4;  1VRH 4;  1RMU 4;  2HWB 4;  1H8T D;  2RS1 4;  1VBA 4;  4PDW D;  1VBB 4;  1AL2 4;  1NA1 D;  1PIV 4;  2R06 4;  1BEV 4;  1K5M D;  1D4M 4;  2RS5 4;  1VBD 4;  1R09 4;  2RR1 4;  3JD7 4;  2RS3 4;  4GB3 4;  1HRV 4;  1HRI 4;  2HWC 4;  3JBG 4;  1AR6 4;  1RHI 4;  4RHV 4;  1HXS 4;  1RUH 4;  1AR7 4;  3J8F 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...