4GB34

Human coxsackievirus b3 strain rd coat protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
55
Chain Sequence
GAQVSTQKTGIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKSLPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
molecule keywords coat protein 1
molecule tags Virus
total genus 4
structure length 55
sequence length 68
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4gb3400
1VRH4 4PDWD 4Q4Y4 1HRV4 1EV14 2HWB4 1HRI4 1RUG4 1RUF4 1COV4 2HWC4 2RS34 1AR74 1K5MD 4Q4W4 1VBD4 4GB34 3JBG4 1NA1D 1R084 1PVC4 2R044 2R074 1RUI4 1R094 2PLV4 1VBB4 1MQTD 1OOPD 1PO24 1Z7S4 1VBC4 1POV0 1AR94 1BEV4 1AR84 1AL24 2RMU4 1RUC4 2R064 1PIV4 4RHV4 1ASJ4 1RMU4 1HXS4 2RR14 1VBE4 3J8F4 2X5ID 1RUD4 4Q4X4 2RS54 4Q4V4 1EAH4 1AR64 1H8TD 1NCQD 1PO14 1RUE4 1D4M4 1RHI4 1RVF4 1RUH4 2RM24 1RUJ4 2RS14 3JD74 1VBA4
chains in the Genus database with same CATH superfamily
1RUF4 2WU5A 4YT0A 2PY5A 3VR8A 1MQTD 2PYJA 4KX6A 3SFDA 2PYLA 3AE3A 3P4RA 2H88A 3AE9A 2RMU4 1RUC4 4RHV4 1YQ4A 3P4PA 3AE4A 2RR14 1RUD4 2RS54 4Q4V4 1NCQD 1PO14 1RVF4 1RUH4 3AEEA 1VRH4 1ZOYA 4PDWD 4YXDA 2HWB4 1NENA 4GB34 3JBG4 3VRAA 1R084 2R074 1KFYA 2PLV4 1OOPD 1PO24 1VBC4 1AR94 1AR84 1AL24 1NEKA 3SUCA 3AEBA 2B76A 1PIV4 2H89A 3AEGA 2R7FA 1HXS4 3FI7A 3J8F4 2X5ID 1KF6A 3AEDA 2WDRA 2WDVA 1EAH4 2WDQA 1RHI4 3ABVA 1L0VA 2RM24 3JD74 1VBA4 4Q4Y4 4YTNA 2WS3A 1EV14 1HRV4 3VR9A 4YTMA 1RUG4 3AECA 5C3JA 1COV4 2HWC4 2WU2A 3AE1A 1K5MD 1VBD4 3VRBA 1NA1D 3AE8A 2WQYA 1XI1A 1RUI4 3CIRA 3GQKA 1Z7S4 2FBWA 2ACZA 2EX3A 1VBE4 4Q4X4 4YSXA 5C2TA 4YSZA 1AR64 2WP9A 1XHZA 4YSYA 1D4M4 1RUJ4 2RS14 2PW9A 3AE5A 3P4QA 1HRI4 2PZSA 2RS34 1AR74 4Q4W4 1PVC4 2R044 1R094 1VBB4 1POV0 3GQHA 1BEV4 3AEAA 2R064 1ZP0A 1YQ3A 1ASJ4 1RMU4 1XHXA 3AE6A 4YTPA 3AE7A 1H8TD 3AEFA 1RUE4 3SFEA 3P4SA 3AE2A
chains in the Genus database with same CATH topology
1VRH4 4PDWD 4Q4Y4 1HRV4 1EV14 2HWB4 1HRI4 1RUG4 1RUF4 1COV4 2HWC4 2RS34 1AR74 1K5MD 4Q4W4 1VBD4 4GB34 3JBG4 1NA1D 1R084 1PVC4 2R044 2R074 1RUI4 1R094 2PLV4 1VBB4 1MQTD 1OOPD 1PO24 1Z7S4 1VBC4 1POV0 1AR94 1BEV4 1AR84 1AL24 2RMU4 1RUC4 2R064 1PIV4 4RHV4 1ASJ4 1RMU4 1HXS4 2RR14 1VBE4 3J8F4 2X5ID 1RUD4 4Q4X4 2RS54 4Q4V4 1EAH4 1AR64 1H8TD 1NCQD 1PO14 1RUE4 1D4M4 1RHI4 1RVF4 1RUH4 2RM24 1RUJ4 2RS14 3JD74 1VBA4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRH 4;  4PDW D;  4Q4Y 4;  1HRV 4;  1EV1 4;  2HWB 4;  1HRI 4;  1RUG 4;  1RUF 4;  1COV 4;  2HWC 4;  2RS3 4;  1AR7 4;  1K5M D;  4Q4W 4;  1VBD 4;  4GB3 4;  3JBG 4;  1NA1 D;  1R08 4;  1PVC 4;  2R04 4;  2R07 4;  1RUI 4;  1R09 4;  2PLV 4;  1VBB 4;  1MQT D;  1OOP D;  1PO2 4;  1Z7S 4;  1VBC 4;  1POV 0;  1AR9 4;  1BEV 4;  1AR8 4;  1AL2 4;  2RMU 4;  1RUC 4;  2R06 4;  1PIV 4;  4RHV 4;  1ASJ 4;  1RMU 4;  1HXS 4;  2RR1 4;  1VBE 4;  3J8F 4;  2X5I D;  1RUD 4;  4Q4X 4;  2RS5 4;  4Q4V 4;  1EAH 4;  1AR6 4;  1H8T D;  1NCQ D;  1PO1 4;  1RUE 4;  1D4M 4;  1RHI 4;  1RVF 4;  1RUH 4;  2RM2 4;  1RUJ 4;  2RS1 4;  3JD7 4;  1VBA 4; 
#chains in the Genus database with same CATH topology
 1RUF 4;  2WU5 A;  4YT0 A;  2PY5 A;  3VR8 A;  1MQT D;  2PYJ A;  4KX6 A;  3SFD A;  2PYL A;  3AE3 A;  3P4R A;  2H88 A;  3AE9 A;  2RMU 4;  1RUC 4;  4RHV 4;  1YQ4 A;  3P4P A;  3AE4 A;  2RR1 4;  1RUD 4;  2RS5 4;  4Q4V 4;  1NCQ D;  1PO1 4;  1RVF 4;  1RUH 4;  3AEE A;  1VRH 4;  1ZOY A;  4PDW D;  4YXD A;  2HWB 4;  1NEN A;  4GB3 4;  3JBG 4;  3VRA A;  1R08 4;  2R07 4;  1KFY A;  2PLV 4;  1OOP D;  1PO2 4;  1VBC 4;  1AR9 4;  1AR8 4;  1AL2 4;  1NEK A;  3SUC A;  3AEB A;  2B76 A;  1PIV 4;  2H89 A;  3AEG A;  2R7F A;  1HXS 4;  3FI7 A;  3J8F 4;  2X5I D;  1KF6 A;  3AED A;  2WDR A;  2WDV A;  1EAH 4;  2WDQ A;  1RHI 4;  3ABV A;  1L0V A;  2RM2 4;  3JD7 4;  1VBA 4;  4Q4Y 4;  4YTN A;  2WS3 A;  1EV1 4;  1HRV 4;  3VR9 A;  4YTM A;  1RUG 4;  3AEC A;  5C3J A;  1COV 4;  2HWC 4;  2WU2 A;  3AE1 A;  1K5M D;  1VBD 4;  3VRB A;  1NA1 D;  3AE8 A;  2WQY A;  1XI1 A;  1RUI 4;  3CIR A;  3GQK A;  1Z7S 4;  2FBW A;  2ACZ A;  2EX3 A;  1VBE 4;  4Q4X 4;  4YSX A;  5C2T A;  4YSZ A;  1AR6 4;  2WP9 A;  1XHZ A;  4YSY A;  1D4M 4;  1RUJ 4;  2RS1 4;  2PW9 A;  3AE5 A;  3P4Q A;  1HRI 4;  2PZS A;  2RS3 4;  1AR7 4;  4Q4W 4;  1PVC 4;  2R04 4;  1R09 4;  1VBB 4;  1POV 0;  3GQH A;  1BEV 4;  3AEA A;  2R06 4;  1ZP0 A;  1YQ3 A;  1ASJ 4;  1RMU 4;  1XHX A;  3AE6 A;  4YTP A;  3AE7 A;  1H8T D;  3AEF A;  1RUE 4;  3SFE A;  3P4S A;  3AE2 A; 
#chains in the Genus database with same CATH homology
 1VRH 4;  4PDW D;  4Q4Y 4;  1HRV 4;  1EV1 4;  2HWB 4;  1HRI 4;  1RUG 4;  1RUF 4;  1COV 4;  2HWC 4;  2RS3 4;  1AR7 4;  1K5M D;  4Q4W 4;  1VBD 4;  4GB3 4;  3JBG 4;  1NA1 D;  1R08 4;  1PVC 4;  2R04 4;  2R07 4;  1RUI 4;  1R09 4;  2PLV 4;  1VBB 4;  1MQT D;  1OOP D;  1PO2 4;  1Z7S 4;  1VBC 4;  1POV 0;  1AR9 4;  1BEV 4;  1AR8 4;  1AL2 4;  2RMU 4;  1RUC 4;  2R06 4;  1PIV 4;  4RHV 4;  1ASJ 4;  1RMU 4;  1HXS 4;  2RR1 4;  1VBE 4;  3J8F 4;  2X5I D;  1RUD 4;  4Q4X 4;  2RS5 4;  4Q4V 4;  1EAH 4;  1AR6 4;  1H8T D;  1NCQ D;  1PO1 4;  1RUE 4;  1D4M 4;  1RHI 4;  1RVF 4;  1RUH 4;  2RM2 4;  1RUJ 4;  2RS1 4;  3JD7 4;  1VBA 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...