4GB34

Human coxsackievirus b3 strain rd coat protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
55
Chain Sequence
GAQVSTQKTGIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKSLPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein 1
publication title The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 55
sequence length 68
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4gb3400
2RMU4 1RUD4 1Z7S4 1EAH4 2PLV4 1K5MD 1HRI4 1AL24 1VBC4 1AR84 1MQTD 1AR94 1OOPD 2RM24 1NCQD 4PDWD 4Q4Y4 1RMU4 1BEV4 4Q4W4 1RUH4 2RS54 4GB34 1PO24 1RVF4 1POV0 2HWC4 3JBG4 4RHV4 4Q4X4 1RUG4 1PVC4 1EV14 1RUJ4 1VBD4 2HWB4 1RHI4 1R094 1RUI4 2X5ID 1PIV4 1H8TD 4Q4V4 2R064 3JD74 1ASJ4 1VBA4 1VBE4 1HRV4 1PO14 1COV4 1R084 2RS14 1AR64 2RR14 2RS34 1RUE4 1RUC4 1VRH4 2R044 1HXS4 2R074 1NA1D 1D4M4 1RUF4 1VBB4 3J8F4 1AR74
chains in the Genus database with same CATH superfamily
3AE4A 2R7FA 2WU5A 3VRAA 1XI1A 2PZSA 1EAH4 1K5MD 1OOPD 1AR94 1NCQD 4YSZA 2WS3A 1BEV4 3AEDA 2RS54 1RVF4 1POV0 2HWC4 3FI7A 4Q4X4 1RHI4 1PIV4 1H8TD 2R064 1R084 4YSYA 1ZOYA 2WQYA 1RUE4 3AEFA 1RUC4 3VR8A 2R074 3AEGA 5C3JA 3VR9A 3JBG4 2ACZA 1AR74 1NENA 1NEKA 2RMU4 1Z7S4 3AE8A 2FBWA 1AL24 3AE9A 2EX3A 2WDQA 1PO24 2PW9A 3AEAA 1RUG4 2H89A 1RUI4 1HRV4 2RS14 2RR14 2RS34 3AE3A 2PYJA 1YQ4A 4YSXA 1YQ3A 4YTMA 1HRI4 2H88A 1VBC4 2RM24 1MQTD 3AE6A 3CIRA 4PDWD 4Q4Y4 3SFDA 4YXDA 2PY5A 1RMU4 2WU2A 4Q4W4 4YTPA 4GB34 3AECA 4RHV4 1KF6A 3VRBA 1XHZA 1PVC4 3P4PA 3SFEA 1EV14 1VBD4 1R094 2X5ID 4Q4V4 3AE7A 1VBA4 4YT0A 1L0VA 2PYLA 1PO14 1COV4 3AE2A 1XHXA 3ABVA 3SUCA 2R044 1HXS4 1NA1D 3AE1A 1D4M4 3AE5A 1RUF4 1VBB4 3J8F4 1RUD4 3P4QA 2PLV4 1AR84 4KX6A 2B76A 3P4SA 1RUH4 2WDRA 2WDVA 5C2TA 1RUJ4 3GQHA 2HWB4 3AEBA 2WP9A 3JD74 1ASJ4 1VBE4 1ZP0A 1AR64 4YTNA 3GQKA 1KFYA 3P4RA 3AEEA 1VRH4
chains in the Genus database with same CATH topology
2RMU4 1RUD4 1Z7S4 1EAH4 2PLV4 1K5MD 1HRI4 1AL24 1VBC4 1AR84 1MQTD 1AR94 1OOPD 2RM24 1NCQD 4PDWD 4Q4Y4 1RMU4 1BEV4 4Q4W4 1RUH4 2RS54 4GB34 1PO24 1RVF4 1POV0 2HWC4 3JBG4 4RHV4 4Q4X4 1RUG4 1PVC4 1EV14 1RUJ4 1VBD4 2HWB4 1RHI4 1R094 1RUI4 2X5ID 1PIV4 1H8TD 4Q4V4 2R064 3JD74 1ASJ4 1VBA4 1VBE4 1HRV4 1PO14 1COV4 1R084 2RS14 1AR64 2RR14 2RS34 1RUE4 1RUC4 1VRH4 2R044 1HXS4 2R074 1NA1D 1D4M4 1RUF4 1VBB4 3J8F4 1AR74
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMU 4;  1RUD 4;  1Z7S 4;  1EAH 4;  2PLV 4;  1K5M D;  1HRI 4;  1AL2 4;  1VBC 4;  1AR8 4;  1MQT D;  1AR9 4;  1OOP D;  2RM2 4;  1NCQ D;  4PDW D;  4Q4Y 4;  1RMU 4;  1BEV 4;  4Q4W 4;  1RUH 4;  2RS5 4;  4GB3 4;  1PO2 4;  1RVF 4;  1POV 0;  2HWC 4;  3JBG 4;  4RHV 4;  4Q4X 4;  1RUG 4;  1PVC 4;  1EV1 4;  1RUJ 4;  1VBD 4;  2HWB 4;  1RHI 4;  1R09 4;  1RUI 4;  2X5I D;  1PIV 4;  1H8T D;  4Q4V 4;  2R06 4;  3JD7 4;  1ASJ 4;  1VBA 4;  1VBE 4;  1HRV 4;  1PO1 4;  1COV 4;  1R08 4;  2RS1 4;  1AR6 4;  2RR1 4;  2RS3 4;  1RUE 4;  1RUC 4;  1VRH 4;  2R04 4;  1HXS 4;  2R07 4;  1NA1 D;  1D4M 4;  1RUF 4;  1VBB 4;  3J8F 4;  1AR7 4; 
#chains in the Genus database with same CATH topology
 3AE4 A;  2R7F A;  2WU5 A;  3VRA A;  1XI1 A;  2PZS A;  1EAH 4;  1K5M D;  1OOP D;  1AR9 4;  1NCQ D;  4YSZ A;  2WS3 A;  1BEV 4;  3AED A;  2RS5 4;  1RVF 4;  1POV 0;  2HWC 4;  3FI7 A;  4Q4X 4;  1RHI 4;  1PIV 4;  1H8T D;  2R06 4;  1R08 4;  4YSY A;  1ZOY A;  2WQY A;  1RUE 4;  3AEF A;  1RUC 4;  3VR8 A;  2R07 4;  3AEG A;  5C3J A;  3VR9 A;  3JBG 4;  2ACZ A;  1AR7 4;  1NEN A;  1NEK A;  2RMU 4;  1Z7S 4;  3AE8 A;  2FBW A;  1AL2 4;  3AE9 A;  2EX3 A;  2WDQ A;  1PO2 4;  2PW9 A;  3AEA A;  1RUG 4;  2H89 A;  1RUI 4;  1HRV 4;  2RS1 4;  2RR1 4;  2RS3 4;  3AE3 A;  2PYJ A;  1YQ4 A;  4YSX A;  1YQ3 A;  4YTM A;  1HRI 4;  2H88 A;  1VBC 4;  2RM2 4;  1MQT D;  3AE6 A;  3CIR A;  4PDW D;  4Q4Y 4;  3SFD A;  4YXD A;  2PY5 A;  1RMU 4;  2WU2 A;  4Q4W 4;  4YTP A;  4GB3 4;  3AEC A;  4RHV 4;  1KF6 A;  3VRB A;  1XHZ A;  1PVC 4;  3P4P A;  3SFE A;  1EV1 4;  1VBD 4;  1R09 4;  2X5I D;  4Q4V 4;  3AE7 A;  1VBA 4;  4YT0 A;  1L0V A;  2PYL A;  1PO1 4;  1COV 4;  3AE2 A;  1XHX A;  3ABV A;  3SUC A;  2R04 4;  1HXS 4;  1NA1 D;  3AE1 A;  1D4M 4;  3AE5 A;  1RUF 4;  1VBB 4;  3J8F 4;  1RUD 4;  3P4Q A;  2PLV 4;  1AR8 4;  4KX6 A;  2B76 A;  3P4S A;  1RUH 4;  2WDR A;  2WDV A;  5C2T A;  1RUJ 4;  3GQH A;  2HWB 4;  3AEB A;  2WP9 A;  3JD7 4;  1ASJ 4;  1VBE 4;  1ZP0 A;  1AR6 4;  4YTN A;  3GQK A;  1KFY A;  3P4R A;  3AEE A;  1VRH 4; 
#chains in the Genus database with same CATH homology
 2RMU 4;  1RUD 4;  1Z7S 4;  1EAH 4;  2PLV 4;  1K5M D;  1HRI 4;  1AL2 4;  1VBC 4;  1AR8 4;  1MQT D;  1AR9 4;  1OOP D;  2RM2 4;  1NCQ D;  4PDW D;  4Q4Y 4;  1RMU 4;  1BEV 4;  4Q4W 4;  1RUH 4;  2RS5 4;  4GB3 4;  1PO2 4;  1RVF 4;  1POV 0;  2HWC 4;  3JBG 4;  4RHV 4;  4Q4X 4;  1RUG 4;  1PVC 4;  1EV1 4;  1RUJ 4;  1VBD 4;  2HWB 4;  1RHI 4;  1R09 4;  1RUI 4;  2X5I D;  1PIV 4;  1H8T D;  4Q4V 4;  2R06 4;  3JD7 4;  1ASJ 4;  1VBA 4;  1VBE 4;  1HRV 4;  1PO1 4;  1COV 4;  1R08 4;  2RS1 4;  1AR6 4;  2RR1 4;  2RS3 4;  1RUE 4;  1RUC 4;  1VRH 4;  2R04 4;  1HXS 4;  2R07 4;  1NA1 D;  1D4M 4;  1RUF 4;  1VBB 4;  3J8F 4;  1AR7 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...