4GB5A

Crystal structure of kfla4162 protein from kribbella flavida
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
b'DAETDRAEIIELFGRYADIADLKEFTDLPRRVHTDPLTIDFESVTGMPPMTVPLSDYGAALRASFGAFSATHHAITGHVVTIDSDRATIHAHVRAEHWLPAEVAGDGPDRWLVVGFYDNEAVRTADGWRLSSVKLTASYQENAHLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of Kfla4162 protein from Kribbella flavida (CASP Target)
rcsb
source organism Kribbella flavida
molecule tags Structural genomics, unknown function
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gb5A00
4RZMA 2A15A 1ISKA 5KP3A 1BUQA 4K1VA 3VSYA 3B4OA 1EA2A 3GZXB 2Z76A 4FCJA 3RGRA 4PEJA 4R1KA 2QIYA 3DZLA 3H3HA 2BNGA 5AIGA 3DXOA 1U5OA 1OPYA 3F14A 4XBXA 2RGQA 4WP5A 3OXAA 3M8CA 3JUOA 4HZ9B 4L7KA 1ZO2A 1GY6A 3FZWA 5AIIA 3JUPA 4HM6B 4LGQA 5D81A 3OWYA 3UJMA 3SOAA 2Z77A 1NWWA 2GBWB 2BMRB 4J9AA 5KP4A 3DM8A 3G16A 3DUKA 4HJLB 3FF0A 1EG9B 4MJDA 4X2OA 1W6YA 3UNLA 3B7CA 3K7CA 3B8LA 1VZZA 1CQSA 3F8XA 1ASKA 3MSOA 3NV0B 3WMDA 2XSOB 3KKGA 2W2CA 5JPPA 1JB4A 3CPOA 3ROBA 4HM4B 1W01A 5BXQA 5IG5A 1DMMA 4K1UA 1DMQA 3NXJA 3F7SA 5D82A 4WYKB 2K54A 3MKIA 4GB5A 1JB5A 3ER7A 3EQQB 2GEXA 1TP6A 1ULJB 2QGUA 3MYTA 1JB2A 5IERA 4N3VA 5CF1A 1A2KA 2PZVA 3NV0A 1OCVA 3HZPA 5TGNA 1K41A 4HZBB 1QMAA 1W02A 1UUVB 2YFJB 2F99A 3SEDA 3CNMA 3EBYA 3EN1B 3EF8A 1OUNA 3MG2A 3JUQA 2Z7AA 1OHSA 3CNXA 4HM5B 3GZBA 5DRVA 1OH0A 1OGZA 3HK4A 5KP1A 4STDA 1O7WB 4WWUC 1OHOA 3EN8A 4J8TA 5CF2A 4XM4A 3OWSA 1IDPA 5BVBA 1NDOB 1GYBA 3KZTA 2HMOB 1QJGA 2UX0A 1ULIB 2F86B 5IG3A 1JN5B 3FKAA 3DMCA 4FCMA 3BB9A 2CHCA 2HMJB 3EX9A 5IENA 5DREA 4KVHA 1JKGB 1ZX2A 4CDLA 2BMQB 2HMLB 4XBTA 4HVNA 3MG3A 4Q53A 7STDA 1S5AA 4H3UA 3NM2A 1O7GB 1DMNA 1NU3A 4ORLA 3STDA 4XBYA 2XR8B 3GZRA 3MHEA 3FSDA 3D9RA 1E97A 2HMKB 2RFRA 1JN5A 2GXFA 5IF6A 5AIFA 3EBTA 3NBRA 2XRXB 3EC9A 3CU3A 3OX9A 3SOYA 3F40A 1W00A 3GRDA 1E3RA 1STDA 4HM8B 1TUHA 2B24B 1WQLB 2F98A 1OGXA 4R9KA 1O7PB 3NHXA 1HKXA 4LMIA 4X2HA 8CHOA 3KE7A 3FLJA 4WYKA 3OWUA 3MG1A 3LYGA 2XSHB 3EJVA 3KSPA 3RGAA 3FH1A 3K0ZA 4LEHA 3E99A 1AR0A 5AI1A 2GEYA 1Q42A 1O7HB 1C7HA 3Q90A 2B1XB 4L8PA 4HM1B 5CK6A 2RCDA 5AIHA 6STDA 5EVHA 5IG0A 3JUMA 3ECFA 5G2GA 3T8UA 5HGRA 1OF5B 2INXA 4HKVB 5JPUA 1GS3A 3G8ZA 3JUNA 1GY5A 4OVMA 2HMMB 3G0KA 1O7NB 4HM7B 4XDWA 1SJWA 3T8NA 5STDA 5D83A 4HM2B 1Q40B 3GZYB 5IEPA 2GBXB 2YFLB 3I0YA 5CLKA 2I9WA 4L8OA 3F7XA 1O7MB 3OV4A 1UUWB 4U13A 4XDVA 3S5CA 2HMNB 4R9LA 5AEUB 4I4KA 1E3VA 5IEOA 4HM3B 5IG4A 3LZAA 3BLZA 2BMOB 2YFIB 2IMJA 3F8HA 3A76A 3H51A 4OUQA 3IPTA 4IIAA 1OF5A 2OWPA 5AEWB 3EHCA 3NUVA 3FGYA 4XB5A 1Q40A 3VGNA 2STDA 1JKGA 5FW5A 1Z1SA 2CKFB 3GWRA 5CXOA 3FF2A 3F9SA 4HM0B 1GY7A 3B4PA 2JQ5A 3HX8A 1OHPA 2R4IA
chains in the Genus database with same CATH superfamily
1BVIA 4RZMA 2A15A 3SYUA 4AKZA 1ISKA 1FUSA 5KP3A 3UL5A 1BUQA 1RLSA 3IJEB 4K1VA 3VSYA 1FYSA 1W7CA 3B4OA 4O02B 1R4CA 1EA2A 3CCV3 1UI8A 2ZHXB 2OQEA 1RTUA 2Z76A 3GZXB 4FCJA 4R4KA 2KRTA 3RGRA 4PEJA 1X1UA 2XF3A 4R1KA 3N9HA 3GSPA 3JVCA 3WDGB 1LOWA 3BIRA 1N5PA 2QIYA 3DZLA 1YVBI 4N6MA 3H3HA 1I2FA 1FGQA 2D42A 1IQYA 1I2EA 1PY3A 1UCLA 5ELUA 1ROVA 1RGGA 2CFWA 2BNGA 5AIGA 3DXOA 1WMNA 1U5OA 1OPYA 3DGNA 2CG0A 1JZOA 2W04A 3F14A 5AYSC 2H0GA 3D4AA 2FXTA 3CME3 1AVKA 3DGLA 3CC73 3WHOA 3PYJA 4XBXA 2CC3A 2RGQA 5M1AA 4N6NB 1AQZA 2K0MA 1I8VA 4WP5A 1QVG2 1UDII 3OXAA 1N8R4 1JV2B 4MMXB 1LQMB 3M8CA 4O2HA 3JUOA 2RSXA 1RHLA 4HZ9B 1VQ63 1QALA 4RNTA 4L7KA 1ZO2A 1GY6A 3FZWA 2UUGC 5AIIA 2CWUA 1YJ93 3LT8A 3NQYA 3JUPA 4HM6B 4GHOA 4LZIA 1RN7A 2IUJA 4LGQA 1D6UA 1EKMA 5D81A 2XH9A 3LT9A 2P0XA 3U97A 1BANA 5ELJA 3OWYA 3FG4A 2GU1A 3URPA 2F4YA 3UJMA 4ZM8A 1PU4A 3SOAA 1MGRA 3O8YA 2Z77A 4JF8A 1VQM3 4EV5A 1JRQA 1IQ8A 1QAFA 2CH9A 1NWWA 1YI23 2GBWB 2BMRB 4K90B 1BNSA 4J9AA 1SQWA 1U8CB 3QRDA 3DM8A 3G16A 3X3XA 4AEQA 5KP4A 1NJI4 1BRGA 3DUKA 1RNBA 2CWVA 1RGKA 1RGHA 4HJLB 1W5ZA 4EC6A 1NO3A 3FF0A 1EG9B 5M19A 1GMRA 1MNLA 3X3YA 3DGOA 3PCSA 5JBSA 2BO9B 4MJDA 4X2OA 4NREA 1AY7A 2W03A 1UUGB 1W6YA 4FMAA 3UNLA 3WODG 1RGAA 3B7CA 2OTJ3 1HZ1A 1VQN3 5BIRA 1LOVA 3K9MC 3K7CA 3B8LA 4O8SA 1LQGC 1DVDA 1SARA 3KN4A 1VZZA 4HBRA 3UL6A 1CQSA 2OOVA 1CYUA 3F8XA 1ASKA 1AVLA 1RN4A 3I563 3MSOA 2P09A 2OTL3 3WA3A 3NV0B 1KD14 4MMZB 1BRJA 3WMDA 4EXRA 2XSOB 3KKGA 1EUIC 1Q7HA 2W2CA 5JPPA 3FCSB 1JB4A 3CPOA 2IYJA 3ROBA 4N6UA 4HM4B 1W01A 5BXQA 1JBSA 5IG5A 1IV7A 1DMMA 4K1UA 3X40A 4BL3A 1X1YA 3ALAA 1I0VA 5LC7A 2OCTA 1DMQA 1S723 3NXJA 4BTYA 1RRHA 3F7SA 3OW22 1IYYA 2C11A 5D82A 3Q1CA 1VQK3 4WYKB 3D5IA 1B21A 2K54A 3PZWA 2R41A 1FUWA 4HAAA 2F5WA 2ZDJA 5EQLA 1B2UA 3MKIA 1BSAA 1W6CA 6GSPA 1FGMA 3X3ZA 4GB5A 4GL6A 4CJNA 1B2MA 2CW9A 3RNTA 1LOYA 3UB1A 1BRHA 1JZDA 1US1A 1JB5A 3ER7A 3PGBA 4TX4A 3EQQB 3Q3FA 2GEXA 1FUTA 2M7OA 1TP6A 4EYCA 1LRAA 1ULJB 2QGUA 1KWIA 3MYTA 1BUJA 1IV9A 1JB2A 1SIIA 4HYZA 4KFEA 1YJW3 2WO0A 5IERA 4N3VA 1V74A 5CF1A 1VQP3 1DYUA 1A2KA 2PZVA 3NV0A 3WR2A 1M1K4 1TTOA 1OCVA 3HZPA 3VF1A 5TGNA 3ZG5A 1WNHA 1IT8A 1K41A 1IVVA 3V99A 2RBIA 4HZBB 1QMAA 1W02A 1UUVB 2YFJB 2F99A 3SEDA 3LTAA 1X1XA 3CNMA 3EBYA 1FGTA 3SVAA 1VQ93 3EN1B 3S27A 3EF8A 1RNTA 2F56A 1OUNA 2H0IA 3MG2A 1BAOA 2XFSA 2XFTA 3KIIA 3JUQA 4RNZA 1KSIA 1FGOA 2Z7AA 1OHSA 1EEJA 3CNXA 1PYLA 3G4S3 3NQZA 1BRSA 1K28A 4HM5B 7RNTA 2XGLA 1CEWI 1GOYA 3MPHA 2BHMA 3GZBA 3HOHA 5DRVA 3EB8A 1N5HA 2PNCA 1N8QA 1B2SA 1DVCA 1T3BA 2CK3H 1EQKA 1OH0A 1OGZA 3HK4A 5KP1A 2O9UX 1O7WB 2UGIA 4STDA 5AYRB 3CCU3 1BSEA 4WWUC 1OHOA 1YHQ3 3I553 1IVWA 3EN8A 4J8TA 5CF2A 1IVUA 1ROAA 1V58A 5G1KA 3CC23 3S28A 1YJN3 4XM4A 1BSCA 3KFQC 9RNTA 1MOLA 2QA43 3CPW2 4R80A 2CX1A 2D1WA 2HOHA 3OWSA 2CWTA 3AGOA 1IDPA 5BVBA 1NDOB 5RNTA 1GYBA 3KZTA 1K8A4 2HMOB 4KFFA 5HOHA 4N6TA 4FR9A 1W2ZA 1K9M4 1QJGA 2UX0A 1F8NA 1ULIB 2F86B 5IG3A 1RGEA 1B20A 6RNTA 5GSPA 1JN5B 1N9JA 2W0QA 3FKAA 2O3OA 1JBRA 3DMCA 4JRFA 3L0RA 2E2TA 1BNRA 2L1SA 4FCMA 4I5QA 1JJ22 2ML5A 3BB9A 1TRQA 1A2VA 1YGWA 2CHCA 1RGLA 1T2HA 2HMJB 1I3FA 1G0TA 3EX9A 4K61A 4LYLB 5IENA 5DREA 4KVHA 1I3IA 2MF7A 1NB5I 1BRKA 1JKGB 3DGMA 1C54A 4RNYA 1IT7A 1ZX2A 4CDLA 2BMQB 2HMLB 3KCHA 4XBTA 1BSBA 1G02A 4HVNA 3MG3A 1VQO3 2GU3A 1FZUA 1X1WA 2ZL8A 3FG3A 2Y73A 4FCZA 4Q53A 1GD4A 1Q9EA 3ZFZA 3A5EA 3BNBA 3IMAB 3AMOB 4RBNA 1TFKA 1TJDA 3Q2PA 7STDA 1Q7Y4 1S5AA 1B27A 4H3UA 1BGSA 3NM2A 1O7GB 1DMNA 1NU3A 4H61A 1RN1A 3LTCA 1LOXA 4ORLA 2XR8B 4XBYA 3STDA 3WA2X 2W56B 1BIRA 4BL2A 4CPKA 1BOXA 3GZRA 3KSED 1IK3A 3CCL3 1J2BA 4J5GA 1RJOA 3MHEA 1CH0A 2CFDA 2LYXA 2Q07A 1V57A 3FSDA 3D9RA 1GD3A 1E97A 2HMKB 3SXXA 3CCE3 2RFRA 2XEPA 1BNGA 1JN5A 1I70A 1Q814 2GXFA 3SLUA 3PXMA 1UCKA 2E2VA 5IF6A 4IPBA 4WHAA 2YX9A 1TU5A 1IU7A 5AIFA 1NB3I 3EBTA 1LNIA 4FMDA 4KZ1A 1RDSA 3NBRA 4DKIA 1MWUA 2KF6A 2XRXB 3BNEA 3D79A 5A0OB 3EC9A 3CU3A 4KT3B 3OX9A 1MGWA 1BNEA 2OQEC 3S29A 3DY5A 3SOYA 3F40A 1W00A 2SBLA 5I97A 4WFOA 2CG1A 1AV4A 4N6OB 2SARA 2CIUA 3GRDA 3V98A 3NX0A 1E3RA 1UCIA 3AHSA 1RGFA 3K63A 1BU4A 1LNHA 1M904 3NBBA 1W4NA 1ZGXA 3ZG0A 1RRLA 4BU4A 3U1WA 1STDA 3AHWA 1MWSA 3AMOA 1KC84 2IUKA 4HM8B 3SX1A 1MWTA 2KF5A 4N6V0 4CCVA 2WGOA 1TUHA 2B24B 2LQVA 3DGYA 2GSPA 2Z6BA 2C4BA 1WQLB 3EE1A 3N8BA 2F98A 2XGNA 3X41A 4BIRA 1MWRA 1OGXA 2W56A 1M9GA 1O7PB 4R9KA 1BNFA 3NHXA 2KCDA 1TIJA 1BRNL 1VQ53 1VQL3 2WGQA 3LXUX 1HKXA 2AAEA 4LMIA 4X2HA 1JBTA 1T2IA 8CHOA 3KE7A 3FLJA 3G713 3D5GA 4WYKA 1ZS7A 3BNDA 3OWUA 2BT3A 2KXGA 3J7Yd 3LOYA 3MG1A 3LYGA 2XSHB 3EJVA 3KSPA 1VQ73 1TRPA 2ML6A 3RGAA 1UW1A 3FH1A 3K0ZA 1B2XA 4LEHA 3E99A 1AR0A 5AI1A 2GEYA 4AKYA 3CXC2 2AADA 2MC8A 3N54B 3CC43 1Q42A 1A67A 1DE3A 3CMA3 1D6ZA 1LVNA 1UI7A 4NPBA 2Y74A 1O7HB 2FNQA 1FA3A 1C7HA 1W6GA 1Y4KA 2B1XB 1WTHA 3Q90A 1K734 4L8PA 1BSDA 2W9PA 1I0XA 3DH2A 4HOHA 4HM1B 2P0MA 1A2PA 5CK6A 2RCDA 5AIHA 5M18A 1QVF2 6STDA 1RKYA 5EVHA 2KAAA 5IG0A 4G1MB 2C10A 8RNTA 3NM7A 3JUMA 3QK9A 1I2GA 1GSPA 1WMPA 3ECFA 3NBJA 5G2GA 1L5GB 1YNVX 3T0UA 1NNVA 2IA7A 5HGRA 3T8UA 1SIHA 2CFLA 4EW5A 1VQ43 1OF5B 2INXA 1CYVA 4HKVB 5JPUA 1GS3A 2BU4A 1B2ZA 3G8ZA 3JUNA 1UCJA 1KQS2 1GY5A 3HIGA 4LSOA 4OVMA 2FGTA 2HMMB 1O7NB 2CFKA 3G0KA 3MWZA 4HM7B 1UGIA 2CFGA 2BIRA 2WOFA 4XDWA 4J5KA 3AGNA 2IY2A 1SJWA 3BNCA 3WOFB 3CCR3 3T8NA 5STDA 2OOVC 4IT7A 1GOUA 5D83A 1BNIA 4HM2B 1Q40B 3CCS3 2JDIH 2J8XB 1WMOA 3GZYB 5IEPA 3HIIA 2GBXB 2YFLB 3I0YA 1Q864 5CLKA 1PFPA 2I9WA 1RCLA 1RSNA 2KF3A 2ZA4A 3LMLA 4L8OA 3F7XA 1LXEA 4EBGA 1O7MB 1Q824 1JNQA 3X42A 4ILFA 1HU9A 1IQXA 3OV4A 1M1XB 1UUWB 4U13A 3LTBA 1QAKA 4XDVA 3S5CA 2HMNB 1R4YA 2RNTA 2E2UA 4R9LA 3V92A 5AEUB 7GSPA 4I4KA 1E3VA 2L4VA 1A90A 4MMYB 4GSPA 1YGEA 5BU4A 1N9EA 4KFDA 5LC6A 1IVXA 5IEOA 1HYFA 4QWTA 1STFI 3BU4A 4HM3B 5IG4A 3LZAA 4NHFA 3BLZA 2BMOB 4MEIA 2W6JH 1DETA 2YFIB 2IMJA 3F8HA 1T5YA 1GMQA 3A76A 5FGOA 3TDGA 1YIJ3 3H51A 3PS8A 4OUQA 2V1LA 3HI7A 3IPTA 4O3VA 2QEX3 4FMBA 1OF5A 4IIAA 3G6E3 2OWPA 2P05A 5AEWB 3EHCA 1RGCA 1UGHI 1YIT3 1D6YA 3D3LA 3NUVA 1FW7A 4BTXA 2KF4A 3CD63 3PCRA 4N6LA 5G1LA 2P38A 3WOEB 3FGYA 5IW9A 1SPUA 4XB5A 4EV2A 1FGRA 1Q40A 2K3DA 3VGNA 2W9QA 1YVSA 2STDA 3CCM3 1JKGA 1BNJA 1GMPA 1GOVA 1TFOA 2CX0A 1RCKA 1VQ83 5FW5A 1Z1SA 4FMCA 3LH4A 2F5MA 2CKFB 1VQQA 3GWRA 4OK0A 1OACA 5CXOA 3GAXA 2WOHA 1G96A 3FF2A 3F9SA 2H0HA 4HM0B 5EEOA 1BRIA 3RDEA 3K5TA 3FG1A 3CCJ3 3S67A 1GY7A 3B4PA 1RMSA 2JQ5A 1W2B2 1B3SA 3HX8A 3CCQ3 3LTDA 1OHPA 4BTWA 2R4IA
chains in the Genus database with same CATH topology
4RZMA 2A15A 4AKZA 1ISKA 5KP3A 3UL5A 1BUQA 3IJEB 4K1VA 3VSYA 1W7CA 3B4OA 4O02B 1R4CA 1EA2A 3CCV3 1UI8A 2OQEA 3GZXB 2Z76A 4FCJA 4R4KA 2KRTA 3RGRA 4PEJA 2XF3A 4R1KA 3N9HA 3JVCA 3WDGB 1N5PA 2QIYA 3DZLA 1YVBI 4N6MA 3H3HA 1FGQA 2D42A 1IQYA 5ELUA 1ROVA 2CFWA 2BNGA 5AIGA 3DXOA 1WMNA 1U5OA 1OPYA 3DGNA 2CG0A 2W04A 3F14A 5AYSC 2FXTA 1AVKA 3DGLA 3CC73 3PYJA 4XBXA 2CC3A 2RGQA 4N6NB 2K0MA 4WP5A 1QVG2 1N8R4 3OXAA 1JV2B 4MMXB 3M8CA 4O2HA 3JUOA 2RSXA 4HZ9B 1VQ63 1QALA 4L7KA 1ZO2A 1GY6A 3FZWA 5AIIA 2CWUA 1YJ93 3LT8A 3NQYA 3JUPA 4HM6B 4LZIA 1RN7A 2IUJA 4LGQA 1D6UA 1EKMA 5D81A 2XH9A 3LT9A 2P0XA 3U97A 5ELJA 3OWYA 3FG4A 2GU1A 1PU4A 3UJMA 4ZM8A 3SOAA 3O8YA 2Z77A 4JF8A 1VQM3 4EV5A 1JRQA 1IQ8A 1QAFA 2CH9A 1NWWA 1YI23 2GBWB 2BMRB 4K90B 4J9AA 1SQWA 1U8CB 3QRDA 3DM8A 3G16A 3X3XA 4AEQA 5KP4A 1NJI4 3DUKA 2CWVA 4HJLB 1W5ZA 4EC6A 1NO3A 3FF0A 1EG9B 1MNLA 3X3YA 3DGOA 3PCSA 5JBSA 2BO9B 4MJDA 4X2OA 4NREA 2W03A 1W6YA 3UNLA 4FMAA 3WODG 2OTJ3 3B7CA 1VQN3 3K9MC 3K7CA 3B8LA 4O8SA 1DVDA 3KN4A 4HBRA 1VZZA 3UL6A 1CQSA 2OOVA 1CYUA 3F8XA 1ASKA 1AVLA 3I563 3MSOA 2P09A 2OTL3 3WA3A 3NV0B 1KD14 4MMZB 3WMDA 4EXRA 2XSOB 3KKGA 2W2CA 5JPPA 3FCSB 1JB4A 3CPOA 3ROBA 4N6UA 4HM4B 1W01A 5BXQA 5IG5A 1IV7A 1DMMA 4K1UA 3X40A 3ALAA 5LC7A 2OCTA 1DMQA 1S723 3NXJA 4BTYA 1RRHA 3F7SA 3OW22 2C11A 5D82A 3Q1CA 1VQK3 4WYKB 2K54A 3PZWA 1FUWA 2ZDJA 5EQLA 3MKIA 1W6CA 1FGMA 3X3ZA 4GB5A 4GL6A 2CW9A 3UB1A 1US1A 1JB5A 3ER7A 3PGBA 4TX4A 3EQQB 2GEXA 2M7OA 4EYCA 1TP6A 1ULJB 2QGUA 1KWIA 3MYTA 1IV9A 1JB2A 1SIIA 4HYZA 4KFEA 1YJW3 2WO0A 5IERA 4N3VA 1V74A 5CF1A 1VQP3 1DYUA 1A2KA 2PZVA 3NV0A 1M1K4 1OCVA 3HZPA 3VF1A 5TGNA 1WNHA 1IT8A 1K41A 1IVVA 3V99A 4HZBB 1QMAA 1W02A 1UUVB 2YFJB 2F99A 3SEDA 3LTAA 3CNMA 3EBYA 1FGTA 3SVAA 1VQ93 3EN1B 3S27A 3EF8A 1OUNA 3MG2A 2XFSA 2XFTA 3KIIA 3JUQA 4RNZA 1KSIA 1FGOA 2Z7AA 1OHSA 3CNXA 3G4S3 3NQZA 1K28A 4HM5B 2XGLA 1CEWI 3MPHA 2BHMA 3GZBA 5DRVA 3EB8A 1N5HA 2PNCA 1N8QA 1DVCA 2CK3H 1EQKA 1OH0A 1OGZA 3HK4A 5KP1A 2O9UX 1O7WB 4STDA 5AYRB 3CCU3 4WWUC 1OHOA 1YHQ3 3I553 1IVWA 3EN8A 4J8TA 5CF2A 1IVUA 1ROAA 1YJN3 3CC23 3S28A 4XM4A 3KFQC 1MOLA 2QA43 3CPW2 4R80A 2D1WA 3OWSA 2CWTA 1IDPA 5BVBA 1NDOB 1GYBA 3KZTA 1K8A4 2HMOB 4KFFA 4N6TA 4FR9A 1W2ZA 1K9M4 1QJGA 2UX0A 1F8NA 1ULIB 2F86B 5IG3A 1JN5B 1N9JA 2W0QA 3FKAA 2O3OA 3DMCA 4JRFA 3L0RA 2E2TA 4FCMA 1JJ22 2ML5A 3BB9A 1A2VA 2CHCA 1A90A 2HMJB 3EX9A 4K61A 5IENA 5DREA 4KVHA 2MF7A 1NB5I 1JKGB 3DGMA 4RNYA 1IT7A 1ZX2A 4CDLA 2BMQB 2HMLB 4XBTA 4HVNA 3MG3A 1VQO3 2GU3A 2ZL8A 3FG3A 2Y73A 4FCZA 4Q53A 1GD4A 3IMAB 3BNBA 4RBNA 3AMOB 7STDA 1TFKA 3Q2PA 1Q7Y4 1S5AA 4H3UA 3NM2A 1O7GB 1DMNA 1NU3A 4H61A 3LTCA 4ORLA 1LOXA 4XBYA 2XR8B 3STDA 3WA2X 2W56B 3GZRA 3KSED 3CCL3 1IK3A 1J2BA 1RJOA 3MHEA 2CFDA 2LYXA 2Q07A 3FSDA 3D9RA 1GD3A 1E97A 2HMKB 3SXXA 3CCE3 2RFRA 2XEPA 1Q814 1JN5A 2GXFA 3SLUA 3PXMA 2E2VA 5IF6A 4IPBA 4WHAA 2YX9A 1TU5A 1IU7A 5AIFA 1NB3I 3EBTA 4FMDA 4KZ1A 3NBRA 3BNEA 2XRXB 5A0OB 3EC9A 3CU3A 3OX9A 2OQEC 3S29A 3SOYA 3DY5A 3F40A 1W00A 2SBLA 5I97A 4WFOA 2CG1A 1AV4A 4N6OB 3GRDA 2CIUA 3V98A 3NX0A 1E3RA 3K63A 1LNHA 1M904 3NBBA 1W4NA 1RRLA 3U1WA 1STDA 3AMOA 1KC84 2IUKA 4HM8B 3SX1A 4N6V0 4CCVA 2WGOA 1TUHA 2B24B 2LQVA 2Z6BA 1WQLB 3EE1A 3N8BA 2F98A 2XGNA 3X41A 1OGXA 2W56A 4R9KA 1M9GA 1O7PB 1VQ53 3NHXA 2KCDA 1TIJA 1VQL3 2WGQA 3LXUX 1HKXA 4LMIA 4X2HA 8CHOA 3KE7A 3FLJA 3G713 4WYKA 3BNDA 3OWUA 2BT3A 2KXGA 3J7Yd 3LOYA 3MG1A 3LYGA 2XSHB 3EJVA 3KSPA 1VQ73 2ML6A 3RGAA 1UW1A 3FH1A 3K0ZA 4LEHA 3E99A 1AR0A 5AI1A 2GEYA 4AKYA 3CXC2 3CC43 2MC8A 3N54B 1A67A 1Q42A 3CMA3 1D6ZA 1LVNA 1UI7A 2Y74A 1O7HB 2FNQA 1FA3A 1C7HA 1W6GA 1Y4KA 2B1XB 1WTHA 3Q90A 1K734 4L8PA 2W9PA 4HM1B 2P0MA 5CK6A 2RCDA 5AIHA 1QVF2 6STDA 1RKYA 5EVHA 5IG0A 4G1MB 2C10A 3NM7A 3JUMA 3QK9A 1WMPA 3ECFA 3NBJA 5G2GA 1L5GB 3T0UA 3T8UA 2IA7A 5HGRA 1SIHA 2CFLA 1VQ43 1OF5B 2INXA 1CYVA 4HKVB 5JPUA 1GS3A 3G8ZA 3JUNA 1KQS2 1GY5A 3HIGA 4LSOA 4OVMA 2HMMB 2FGTA 1O7NB 2CFKA 3G0KA 3MWZA 4HM7B 2CFGA 2WOFA 4XDWA 1SJWA 3BNCA 3WOFB 3CCR3 3T8NA 5STDA 2OOVC 4IT7A 5D83A 4HM2B 3CCS3 1Q40B 2JDIH 1WMOA 3GZYB 5IEPA 3HIIA 2GBXB 2YFLB 3I0YA 1Q864 5CLKA 1PFPA 2I9WA 3LMLA 4EBGA 3CME3 1Q824 4L8OA 3F7XA 1LXEA 1O7MB 1JNQA 3X42A 1HU9A 1IQXA 3OV4A 1M1XB 1UUWB 4U13A 3LTBA 1QAKA 4XDVA 3S5CA 2HMNB 4R9LA 2E2UA 5AEUB 3V92A 4I4KA 1E3VA 2L4VA 4MMYB 1YGEA 1N9EA 4KFDA 5LC6A 1IVXA 5IEOA 4QWTA 1STFI 4HM3B 5IG4A 3LZAA 4NHFA 3BLZA 2BMOB 4MEIA 2W6JH 2YFIB 2IMJA 3F8HA 1T5YA 3A76A 5FGOA 3TDGA 1YIJ3 3H51A 3PS8A 4OUQA 2V1LA 3HI7A 3IPTA 4O3VA 2QEX3 4FMBA 1OF5A 4IIAA 3G6E3 2OWPA 2P05A 5AEWB 3EHCA 1YIT3 1D6YA 3D3LA 3NUVA 4BTXA 3CD63 3PCRA 4N6LA 2P38A 3WOEB 3FGYA 5IW9A 1SPUA 4XB5A 4EV2A 1FGRA 1Q40A 3VGNA 2W9QA 2STDA 3CCM3 1JKGA 1TFOA 1VQ83 5FW5A 1Z1SA 4FMCA 3LH4A 2CKFB 3GWRA 4OK0A 1OACA 5CXOA 3GAXA 2WOHA 1G96A 3FF2A 3F9SA 4HM0B 5EEOA 3RDEA 3K5TA 3FG1A 3CCJ3 3S67A 1GY7A 3B4PA 2JQ5A 1W2B2 3HX8A 3CCQ3 3LTDA 1OHPA 4BTWA 2R4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZM A;  2A15 A;  1ISK A;  5KP3 A;  1BUQ A;  4K1V A;  3VSY A;  3B4O A;  1EA2 A;  3GZX B;  2Z76 A;  4FCJ A;  3RGR A;  4PEJ A;  4R1K A;  2QIY A;  3DZL A;  3H3H A;  2BNG A;  5AIG A;  3DXO A;  1U5O A;  1OPY A;  3F14 A;  4XBX A;  2RGQ A;  4WP5 A;  3OXA A;  3M8C A;  3JUO A;  4HZ9 B;  4L7K A;  1ZO2 A;  1GY6 A;  3FZW A;  5AII A;  3JUP A;  4HM6 B;  4LGQ A;  5D81 A;  3OWY A;  3UJM A;  3SOA A;  2Z77 A;  1NWW A;  2GBW B;  2BMR B;  4J9A A;  5KP4 A;  3DM8 A;  3G16 A;  3DUK A;  4HJL B;  3FF0 A;  1EG9 B;  4MJD A;  4X2O A;  1W6Y A;  3UNL A;  3B7C A;  3K7C A;  3B8L A;  1VZZ A;  1CQS A;  3F8X A;  1ASK A;  3MSO A;  3NV0 B;  3WMD A;  2XSO B;  3KKG A;  2W2C A;  5JPP A;  1JB4 A;  3CPO A;  3ROB A;  4HM4 B;  1W01 A;  5BXQ A;  5IG5 A;  1DMM A;  4K1U A;  1DMQ A;  3NXJ A;  3F7S A;  5D82 A;  4WYK B;  2K54 A;  3MKI A;  4GB5 A;  1JB5 A;  3ER7 A;  3EQQ B;  2GEX A;  1TP6 A;  1ULJ B;  2QGU A;  3MYT A;  1JB2 A;  5IER A;  4N3V A;  5CF1 A;  1A2K A;  2PZV A;  3NV0 A;  1OCV A;  3HZP A;  5TGN A;  1K41 A;  4HZB B;  1QMA A;  1W02 A;  1UUV B;  2YFJ B;  2F99 A;  3SED A;  3CNM A;  3EBY A;  3EN1 B;  3EF8 A;  1OUN A;  3MG2 A;  3JUQ A;  2Z7A A;  1OHS A;  3CNX A;  4HM5 B;  3GZB A;  5DRV A;  1OH0 A;  1OGZ A;  3HK4 A;  5KP1 A;  4STD A;  1O7W B;  4WWU C;  1OHO A;  3EN8 A;  4J8T A;  5CF2 A;  4XM4 A;  3OWS A;  1IDP A;  5BVB A;  1NDO B;  1GYB A;  3KZT A;  2HMO B;  1QJG A;  2UX0 A;  1ULI B;  2F86 B;  5IG3 A;  1JN5 B;  3FKA A;  3DMC A;  4FCM A;  3BB9 A;  2CHC A;  2HMJ B;  3EX9 A;  5IEN A;  5DRE A;  4KVH A;  1JKG B;  1ZX2 A;  4CDL A;  2BMQ B;  2HML B;  4XBT A;  4HVN A;  3MG3 A;  4Q53 A;  7STD A;  1S5A A;  4H3U A;  3NM2 A;  1O7G B;  1DMN A;  1NU3 A;  4ORL A;  3STD A;  4XBY A;  2XR8 B;  3GZR A;  3MHE A;  3FSD A;  3D9R A;  1E97 A;  2HMK B;  2RFR A;  1JN5 A;  2GXF A;  5IF6 A;  5AIF A;  3EBT A;  3NBR A;  2XRX B;  3EC9 A;  3CU3 A;  3OX9 A;  3SOY A;  3F40 A;  1W00 A;  3GRD A;  1E3R A;  1STD A;  4HM8 B;  1TUH A;  2B24 B;  1WQL B;  2F98 A;  1OGX A;  4R9K A;  1O7P B;  3NHX A;  1HKX A;  4LMI A;  4X2H A;  8CHO A;  3KE7 A;  3FLJ A;  4WYK A;  3OWU A;  3MG1 A;  3LYG A;  2XSH B;  3EJV A;  3KSP A;  3RGA A;  3FH1 A;  3K0Z A;  4LEH A;  3E99 A;  1AR0 A;  5AI1 A;  2GEY A;  1Q42 A;  1O7H B;  1C7H A;  3Q90 A;  2B1X B;  4L8P A;  4HM1 B;  5CK6 A;  2RCD A;  5AIH A;  6STD A;  5EVH A;  5IG0 A;  3JUM A;  3ECF A;  5G2G A;  3T8U A;  5HGR A;  1OF5 B;  2INX A;  4HKV B;  5JPU A;  1GS3 A;  3G8Z A;  3JUN A;  1GY5 A;  4OVM A;  2HMM B;  3G0K A;  1O7N B;  4HM7 B;  4XDW A;  1SJW A;  3T8N A;  5STD A;  5D83 A;  4HM2 B;  1Q40 B;  3GZY B;  5IEP A;  2GBX B;  2YFL B;  3I0Y A;  5CLK A;  2I9W A;  4L8O A;  3F7X A;  1O7M B;  3OV4 A;  1UUW B;  4U13 A;  4XDV A;  3S5C A;  2HMN B;  4R9L A;  5AEU B;  4I4K A;  1E3V A;  5IEO A;  4HM3 B;  5IG4 A;  3LZA A;  3BLZ A;  2BMO B;  2YFI B;  2IMJ A;  3F8H A;  3A76 A;  3H51 A;  4OUQ A;  3IPT A;  4IIA A;  1OF5 A;  2OWP A;  5AEW B;  3EHC A;  3NUV A;  3FGY A;  4XB5 A;  1Q40 A;  3VGN A;  2STD A;  1JKG A;  5FW5 A;  1Z1S A;  2CKF B;  3GWR A;  5CXO A;  3FF2 A;  3F9S A;  4HM0 B;  1GY7 A;  3B4P A;  2JQ5 A;  3HX8 A;  1OHP A;  2R4I A; 
#chains in the Genus database with same CATH topology
 1BVI A;  4RZM A;  2A15 A;  3SYU A;  4AKZ A;  1ISK A;  1FUS A;  5KP3 A;  3UL5 A;  1BUQ A;  1RLS A;  3IJE B;  4K1V A;  3VSY A;  1FYS A;  1W7C A;  3B4O A;  4O02 B;  1R4C A;  1EA2 A;  3CCV 3;  1UI8 A;  2ZHX B;  2OQE A;  1RTU A;  2Z76 A;  3GZX B;  4FCJ A;  4R4K A;  2KRT A;  3RGR A;  4PEJ A;  1X1U A;  2XF3 A;  4R1K A;  3N9H A;  3GSP A;  3JVC A;  3WDG B;  1LOW A;  3BIR A;  1N5P A;  2QIY A;  3DZL A;  1YVB I;  4N6M A;  3H3H A;  1I2F A;  1FGQ A;  2D42 A;  1IQY A;  1I2E A;  1PY3 A;  1UCL A;  5ELU A;  1ROV A;  1RGG A;  2CFW A;  2BNG A;  5AIG A;  3DXO A;  1WMN A;  1U5O A;  1OPY A;  3DGN A;  2CG0 A;  1JZO A;  2W04 A;  3F14 A;  5AYS C;  2H0G A;  3D4A A;  2FXT A;  3CME 3;  1AVK A;  3DGL A;  3CC7 3;  3WHO A;  3PYJ A;  4XBX A;  2CC3 A;  2RGQ A;  5M1A A;  4N6N B;  1AQZ A;  2K0M A;  1I8V A;  4WP5 A;  1QVG 2;  1UDI I;  3OXA A;  1N8R 4;  1JV2 B;  4MMX B;  1LQM B;  3M8C A;  4O2H A;  3JUO A;  2RSX A;  1RHL A;  4HZ9 B;  1VQ6 3;  1QAL A;  4RNT A;  4L7K A;  1ZO2 A;  1GY6 A;  3FZW A;  2UUG C;  5AII A;  2CWU A;  1YJ9 3;  3LT8 A;  3NQY A;  3JUP A;  4HM6 B;  4GHO A;  4LZI A;  1RN7 A;  2IUJ A;  4LGQ A;  1D6U A;  1EKM A;  5D81 A;  2XH9 A;  3LT9 A;  2P0X A;  3U97 A;  1BAN A;  5ELJ A;  3OWY A;  3FG4 A;  2GU1 A;  3URP A;  2F4Y A;  3UJM A;  4ZM8 A;  1PU4 A;  3SOA A;  1MGR A;  3O8Y A;  2Z77 A;  4JF8 A;  1VQM 3;  4EV5 A;  1JRQ A;  1IQ8 A;  1QAF A;  2CH9 A;  1NWW A;  1YI2 3;  2GBW B;  2BMR B;  4K90 B;  1BNS A;  4J9A A;  1SQW A;  1U8C B;  3QRD A;  3DM8 A;  3G16 A;  3X3X A;  4AEQ A;  5KP4 A;  1NJI 4;  1BRG A;  3DUK A;  1RNB A;  2CWV A;  1RGK A;  1RGH A;  4HJL B;  1W5Z A;  4EC6 A;  1NO3 A;  3FF0 A;  1EG9 B;  5M19 A;  1GMR A;  1MNL A;  3X3Y A;  3DGO A;  3PCS A;  5JBS A;  2BO9 B;  4MJD A;  4X2O A;  4NRE A;  1AY7 A;  2W03 A;  1UUG B;  1W6Y A;  4FMA A;  3UNL A;  3WOD G;  1RGA A;  3B7C A;  2OTJ 3;  1HZ1 A;  1VQN 3;  5BIR A;  1LOV A;  3K9M C;  3K7C A;  3B8L A;  4O8S A;  1LQG C;  1DVD A;  1SAR A;  3KN4 A;  1VZZ A;  4HBR A;  3UL6 A;  1CQS A;  2OOV A;  1CYU A;  3F8X A;  1ASK A;  1AVL A;  1RN4 A;  3I56 3;  3MSO A;  2P09 A;  2OTL 3;  3WA3 A;  3NV0 B;  1KD1 4;  4MMZ B;  1BRJ A;  3WMD A;  4EXR A;  2XSO B;  3KKG A;  1EUI C;  1Q7H A;  2W2C A;  5JPP A;  3FCS B;  1JB4 A;  3CPO A;  2IYJ A;  3ROB A;  4N6U A;  4HM4 B;  1W01 A;  5BXQ A;  1JBS A;  5IG5 A;  1IV7 A;  1DMM A;  4K1U A;  3X40 A;  4BL3 A;  1X1Y A;  3ALA A;  1I0V A;  5LC7 A;  2OCT A;  1DMQ A;  1S72 3;  3NXJ A;  4BTY A;  1RRH A;  3F7S A;  3OW2 2;  1IYY A;  2C11 A;  5D82 A;  3Q1C A;  1VQK 3;  4WYK B;  3D5I A;  1B21 A;  2K54 A;  3PZW A;  2R41 A;  1FUW A;  4HAA A;  2F5W A;  2ZDJ A;  5EQL A;  1B2U A;  3MKI A;  1BSA A;  1W6C A;  6GSP A;  1FGM A;  3X3Z A;  4GB5 A;  4GL6 A;  4CJN A;  1B2M A;  2CW9 A;  3RNT A;  1LOY A;  3UB1 A;  1BRH A;  1JZD A;  1US1 A;  1JB5 A;  3ER7 A;  3PGB A;  4TX4 A;  3EQQ B;  3Q3F A;  2GEX A;  1FUT A;  2M7O A;  1TP6 A;  4EYC A;  1LRA A;  1ULJ B;  2QGU A;  1KWI A;  3MYT A;  1BUJ A;  1IV9 A;  1JB2 A;  1SII A;  4HYZ A;  4KFE A;  1YJW 3;  2WO0 A;  5IER A;  4N3V A;  1V74 A;  5CF1 A;  1VQP 3;  1DYU A;  1A2K A;  2PZV A;  3NV0 A;  3WR2 A;  1M1K 4;  1TTO A;  1OCV A;  3HZP A;  3VF1 A;  5TGN A;  3ZG5 A;  1WNH A;  1IT8 A;  1K41 A;  1IVV A;  3V99 A;  2RBI A;  4HZB B;  1QMA A;  1W02 A;  1UUV B;  2YFJ B;  2F99 A;  3SED A;  3LTA A;  1X1X A;  3CNM A;  3EBY A;  1FGT A;  3SVA A;  1VQ9 3;  3EN1 B;  3S27 A;  3EF8 A;  1RNT A;  2F56 A;  1OUN A;  2H0I A;  3MG2 A;  1BAO A;  2XFS A;  2XFT A;  3KII A;  3JUQ A;  4RNZ A;  1KSI A;  1FGO A;  2Z7A A;  1OHS A;  1EEJ A;  3CNX A;  1PYL A;  3G4S 3;  3NQZ A;  1BRS A;  1K28 A;  4HM5 B;  7RNT A;  2XGL A;  1CEW I;  1GOY A;  3MPH A;  2BHM A;  3GZB A;  3HOH A;  5DRV A;  3EB8 A;  1N5H A;  2PNC A;  1N8Q A;  1B2S A;  1DVC A;  1T3B A;  2CK3 H;  1EQK A;  1OH0 A;  1OGZ A;  3HK4 A;  5KP1 A;  2O9U X;  1O7W B;  2UGI A;  4STD A;  5AYR B;  3CCU 3;  1BSE A;  4WWU C;  1OHO A;  1YHQ 3;  3I55 3;  1IVW A;  3EN8 A;  4J8T A;  5CF2 A;  1IVU A;  1ROA A;  1V58 A;  5G1K A;  3CC2 3;  3S28 A;  1YJN 3;  4XM4 A;  1BSC A;  3KFQ C;  9RNT A;  1MOL A;  2QA4 3;  3CPW 2;  4R80 A;  2CX1 A;  2D1W A;  2HOH A;  3OWS A;  2CWT A;  3AGO A;  1IDP A;  5BVB A;  1NDO B;  5RNT A;  1GYB A;  3KZT A;  1K8A 4;  2HMO B;  4KFF A;  5HOH A;  4N6T A;  4FR9 A;  1W2Z A;  1K9M 4;  1QJG A;  2UX0 A;  1F8N A;  1ULI B;  2F86 B;  5IG3 A;  1RGE A;  1B20 A;  6RNT A;  5GSP A;  1JN5 B;  1N9J A;  2W0Q A;  3FKA A;  2O3O A;  1JBR A;  3DMC A;  4JRF A;  3L0R A;  2E2T A;  1BNR A;  2L1S A;  4FCM A;  4I5Q A;  1JJ2 2;  2ML5 A;  3BB9 A;  1TRQ A;  1A2V A;  1YGW A;  2CHC A;  1RGL A;  1T2H A;  2HMJ B;  1I3F A;  1G0T A;  3EX9 A;  4K61 A;  4LYL B;  5IEN A;  5DRE A;  4KVH A;  1I3I A;  2MF7 A;  1NB5 I;  1BRK A;  1JKG B;  3DGM A;  1C54 A;  4RNY A;  1IT7 A;  1ZX2 A;  4CDL A;  2BMQ B;  2HML B;  3KCH A;  4XBT A;  1BSB A;  1G02 A;  4HVN A;  3MG3 A;  1VQO 3;  2GU3 A;  1FZU A;  1X1W A;  2ZL8 A;  3FG3 A;  2Y73 A;  4FCZ A;  4Q53 A;  1GD4 A;  1Q9E A;  3ZFZ A;  3A5E A;  3BNB A;  3IMA B;  3AMO B;  4RBN A;  1TFK A;  1TJD A;  3Q2P A;  7STD A;  1Q7Y 4;  1S5A A;  1B27 A;  4H3U A;  1BGS A;  3NM2 A;  1O7G B;  1DMN A;  1NU3 A;  4H61 A;  1RN1 A;  3LTC A;  1LOX A;  4ORL A;  2XR8 B;  4XBY A;  3STD A;  3WA2 X;  2W56 B;  1BIR A;  4BL2 A;  4CPK A;  1BOX A;  3GZR A;  3KSE D;  1IK3 A;  3CCL 3;  1J2B A;  4J5G A;  1RJO A;  3MHE A;  1CH0 A;  2CFD A;  2LYX A;  2Q07 A;  1V57 A;  3FSD A;  3D9R A;  1GD3 A;  1E97 A;  2HMK B;  3SXX A;  3CCE 3;  2RFR A;  2XEP A;  1BNG A;  1JN5 A;  1I70 A;  1Q81 4;  2GXF A;  3SLU A;  3PXM A;  1UCK A;  2E2V A;  5IF6 A;  4IPB A;  4WHA A;  2YX9 A;  1TU5 A;  1IU7 A;  5AIF A;  1NB3 I;  3EBT A;  1LNI A;  4FMD A;  4KZ1 A;  1RDS A;  3NBR A;  4DKI A;  1MWU A;  2KF6 A;  2XRX B;  3BNE A;  3D79 A;  5A0O B;  3EC9 A;  3CU3 A;  4KT3 B;  3OX9 A;  1MGW A;  1BNE A;  2OQE C;  3S29 A;  3DY5 A;  3SOY A;  3F40 A;  1W00 A;  2SBL A;  5I97 A;  4WFO A;  2CG1 A;  1AV4 A;  4N6O B;  2SAR A;  2CIU A;  3GRD A;  3V98 A;  3NX0 A;  1E3R A;  1UCI A;  3AHS A;  1RGF A;  3K63 A;  1BU4 A;  1LNH A;  1M90 4;  3NBB A;  1W4N A;  1ZGX A;  3ZG0 A;  1RRL A;  4BU4 A;  3U1W A;  1STD A;  3AHW A;  1MWS A;  3AMO A;  1KC8 4;  2IUK A;  4HM8 B;  3SX1 A;  1MWT A;  2KF5 A;  4N6V 0;  4CCV A;  2WGO A;  1TUH A;  2B24 B;  2LQV A;  3DGY A;  2GSP A;  2Z6B A;  2C4B A;  1WQL B;  3EE1 A;  3N8B A;  2F98 A;  2XGN A;  3X41 A;  4BIR A;  1MWR A;  1OGX A;  2W56 A;  1M9G A;  1O7P B;  4R9K A;  1BNF A;  3NHX A;  2KCD A;  1TIJ A;  1BRN L;  1VQ5 3;  1VQL 3;  2WGQ A;  3LXU X;  1HKX A;  2AAE A;  4LMI A;  4X2H A;  1JBT A;  1T2I A;  8CHO A;  3KE7 A;  3FLJ A;  3G71 3;  3D5G A;  4WYK A;  1ZS7 A;  3BND A;  3OWU A;  2BT3 A;  2KXG A;  3J7Y d;  3LOY A;  3MG1 A;  3LYG A;  2XSH B;  3EJV A;  3KSP A;  1VQ7 3;  1TRP A;  2ML6 A;  3RGA A;  1UW1 A;  3FH1 A;  3K0Z A;  1B2X A;  4LEH A;  3E99 A;  1AR0 A;  5AI1 A;  2GEY A;  4AKY A;  3CXC 2;  2AAD A;  2MC8 A;  3N54 B;  3CC4 3;  1Q42 A;  1A67 A;  1DE3 A;  3CMA 3;  1D6Z A;  1LVN A;  1UI7 A;  4NPB A;  2Y74 A;  1O7H B;  2FNQ A;  1FA3 A;  1C7H A;  1W6G A;  1Y4K A;  2B1X B;  1WTH A;  3Q90 A;  1K73 4;  4L8P A;  1BSD A;  2W9P A;  1I0X A;  3DH2 A;  4HOH A;  4HM1 B;  2P0M A;  1A2P A;  5CK6 A;  2RCD A;  5AIH A;  5M18 A;  1QVF 2;  6STD A;  1RKY A;  5EVH A;  2KAA A;  5IG0 A;  4G1M B;  2C10 A;  8RNT A;  3NM7 A;  3JUM A;  3QK9 A;  1I2G A;  1GSP A;  1WMP A;  3ECF A;  3NBJ A;  5G2G A;  1L5G B;  1YNV X;  3T0U A;  1NNV A;  2IA7 A;  5HGR A;  3T8U A;  1SIH A;  2CFL A;  4EW5 A;  1VQ4 3;  1OF5 B;  2INX A;  1CYV A;  4HKV B;  5JPU A;  1GS3 A;  2BU4 A;  1B2Z A;  3G8Z A;  3JUN A;  1UCJ A;  1KQS 2;  1GY5 A;  3HIG A;  4LSO A;  4OVM A;  2FGT A;  2HMM B;  1O7N B;  2CFK A;  3G0K A;  3MWZ A;  4HM7 B;  1UGI A;  2CFG A;  2BIR A;  2WOF A;  4XDW A;  4J5K A;  3AGN A;  2IY2 A;  1SJW A;  3BNC A;  3WOF B;  3CCR 3;  3T8N A;  5STD A;  2OOV C;  4IT7 A;  1GOU A;  5D83 A;  1BNI A;  4HM2 B;  1Q40 B;  3CCS 3;  2JDI H;  2J8X B;  1WMO A;  3GZY B;  5IEP A;  3HII A;  2GBX B;  2YFL B;  3I0Y A;  1Q86 4;  5CLK A;  1PFP A;  2I9W A;  1RCL A;  1RSN A;  2KF3 A;  2ZA4 A;  3LML A;  4L8O A;  3F7X A;  1LXE A;  4EBG A;  1O7M B;  1Q82 4;  1JNQ A;  3X42 A;  4ILF A;  1HU9 A;  1IQX A;  3OV4 A;  1M1X B;  1UUW B;  4U13 A;  3LTB A;  1QAK A;  4XDV A;  3S5C A;  2HMN B;  1R4Y A;  2RNT A;  2E2U A;  4R9L A;  3V92 A;  5AEU B;  7GSP A;  4I4K A;  1E3V A;  2L4V A;  1A90 A;  4MMY B;  4GSP A;  1YGE A;  5BU4 A;  1N9E A;  4KFD A;  5LC6 A;  1IVX A;  5IEO A;  1HYF A;  4QWT A;  1STF I;  3BU4 A;  4HM3 B;  5IG4 A;  3LZA A;  4NHF A;  3BLZ A;  2BMO B;  4MEI A;  2W6J H;  1DET A;  2YFI B;  2IMJ A;  3F8H A;  1T5Y A;  1GMQ A;  3A76 A;  5FGO A;  3TDG A;  1YIJ 3;  3H51 A;  3PS8 A;  4OUQ A;  2V1L A;  3HI7 A;  3IPT A;  4O3V A;  2QEX 3;  4FMB A;  1OF5 A;  4IIA A;  3G6E 3;  2OWP A;  2P05 A;  5AEW B;  3EHC A;  1RGC A;  1UGH I;  1YIT 3;  1D6Y A;  3D3L A;  3NUV A;  1FW7 A;  4BTX A;  2KF4 A;  3CD6 3;  3PCR A;  4N6L A;  5G1L A;  2P38 A;  3WOE B;  3FGY A;  5IW9 A;  1SPU A;  4XB5 A;  4EV2 A;  1FGR A;  1Q40 A;  2K3D A;  3VGN A;  2W9Q A;  1YVS A;  2STD A;  3CCM 3;  1JKG A;  1BNJ A;  1GMP A;  1GOV A;  1TFO A;  2CX0 A;  1RCK A;  1VQ8 3;  5FW5 A;  1Z1S A;  4FMC A;  3LH4 A;  2F5M A;  2CKF B;  1VQQ A;  3GWR A;  4OK0 A;  1OAC A;  5CXO A;  3GAX A;  2WOH A;  1G96 A;  3FF2 A;  3F9S A;  2H0H A;  4HM0 B;  5EEO A;  1BRI A;  3RDE A;  3K5T A;  3FG1 A;  3CCJ 3;  3S67 A;  1GY7 A;  3B4P A;  1RMS A;  2JQ5 A;  1W2B 2;  1B3S A;  3HX8 A;  3CCQ 3;  3LTD A;  1OHP A;  4BTW A;  2R4I A; 
#chains in the Genus database with same CATH homology
 4RZM A;  2A15 A;  4AKZ A;  1ISK A;  5KP3 A;  3UL5 A;  1BUQ A;  3IJE B;  4K1V A;  3VSY A;  1W7C A;  3B4O A;  4O02 B;  1R4C A;  1EA2 A;  3CCV 3;  1UI8 A;  2OQE A;  3GZX B;  2Z76 A;  4FCJ A;  4R4K A;  2KRT A;  3RGR A;  4PEJ A;  2XF3 A;  4R1K A;  3N9H A;  3JVC A;  3WDG B;  1N5P A;  2QIY A;  3DZL A;  1YVB I;  4N6M A;  3H3H A;  1FGQ A;  2D42 A;  1IQY A;  5ELU A;  1ROV A;  2CFW A;  2BNG A;  5AIG A;  3DXO A;  1WMN A;  1U5O A;  1OPY A;  3DGN A;  2CG0 A;  2W04 A;  3F14 A;  5AYS C;  2FXT A;  1AVK A;  3DGL A;  3CC7 3;  3PYJ A;  4XBX A;  2CC3 A;  2RGQ A;  4N6N B;  2K0M A;  4WP5 A;  1QVG 2;  1N8R 4;  3OXA A;  1JV2 B;  4MMX B;  3M8C A;  4O2H A;  3JUO A;  2RSX A;  4HZ9 B;  1VQ6 3;  1QAL A;  4L7K A;  1ZO2 A;  1GY6 A;  3FZW A;  5AII A;  2CWU A;  1YJ9 3;  3LT8 A;  3NQY A;  3JUP A;  4HM6 B;  4LZI A;  1RN7 A;  2IUJ A;  4LGQ A;  1D6U A;  1EKM A;  5D81 A;  2XH9 A;  3LT9 A;  2P0X A;  3U97 A;  5ELJ A;  3OWY A;  3FG4 A;  2GU1 A;  1PU4 A;  3UJM A;  4ZM8 A;  3SOA A;  3O8Y A;  2Z77 A;  4JF8 A;  1VQM 3;  4EV5 A;  1JRQ A;  1IQ8 A;  1QAF A;  2CH9 A;  1NWW A;  1YI2 3;  2GBW B;  2BMR B;  4K90 B;  4J9A A;  1SQW A;  1U8C B;  3QRD A;  3DM8 A;  3G16 A;  3X3X A;  4AEQ A;  5KP4 A;  1NJI 4;  3DUK A;  2CWV A;  4HJL B;  1W5Z A;  4EC6 A;  1NO3 A;  3FF0 A;  1EG9 B;  1MNL A;  3X3Y A;  3DGO A;  3PCS A;  5JBS A;  2BO9 B;  4MJD A;  4X2O A;  4NRE A;  2W03 A;  1W6Y A;  3UNL A;  4FMA A;  3WOD G;  2OTJ 3;  3B7C A;  1VQN 3;  3K9M C;  3K7C A;  3B8L A;  4O8S A;  1DVD A;  3KN4 A;  4HBR A;  1VZZ A;  3UL6 A;  1CQS A;  2OOV A;  1CYU A;  3F8X A;  1ASK A;  1AVL A;  3I56 3;  3MSO A;  2P09 A;  2OTL 3;  3WA3 A;  3NV0 B;  1KD1 4;  4MMZ B;  3WMD A;  4EXR A;  2XSO B;  3KKG A;  2W2C A;  5JPP A;  3FCS B;  1JB4 A;  3CPO A;  3ROB A;  4N6U A;  4HM4 B;  1W01 A;  5BXQ A;  5IG5 A;  1IV7 A;  1DMM A;  4K1U A;  3X40 A;  3ALA A;  5LC7 A;  2OCT A;  1DMQ A;  1S72 3;  3NXJ A;  4BTY A;  1RRH A;  3F7S A;  3OW2 2;  2C11 A;  5D82 A;  3Q1C A;  1VQK 3;  4WYK B;  2K54 A;  3PZW A;  1FUW A;  2ZDJ A;  5EQL A;  3MKI A;  1W6C A;  1FGM A;  3X3Z A;  4GB5 A;  4GL6 A;  2CW9 A;  3UB1 A;  1US1 A;  1JB5 A;  3ER7 A;  3PGB A;  4TX4 A;  3EQQ B;  2GEX A;  2M7O A;  4EYC A;  1TP6 A;  1ULJ B;  2QGU A;  1KWI A;  3MYT A;  1IV9 A;  1JB2 A;  1SII A;  4HYZ A;  4KFE A;  1YJW 3;  2WO0 A;  5IER A;  4N3V A;  1V74 A;  5CF1 A;  1VQP 3;  1DYU A;  1A2K A;  2PZV A;  3NV0 A;  1M1K 4;  1OCV A;  3HZP A;  3VF1 A;  5TGN A;  1WNH A;  1IT8 A;  1K41 A;  1IVV A;  3V99 A;  4HZB B;  1QMA A;  1W02 A;  1UUV B;  2YFJ B;  2F99 A;  3SED A;  3LTA A;  3CNM A;  3EBY A;  1FGT A;  3SVA A;  1VQ9 3;  3EN1 B;  3S27 A;  3EF8 A;  1OUN A;  3MG2 A;  2XFS A;  2XFT A;  3KII A;  3JUQ A;  4RNZ A;  1KSI A;  1FGO A;  2Z7A A;  1OHS A;  3CNX A;  3G4S 3;  3NQZ A;  1K28 A;  4HM5 B;  2XGL A;  1CEW I;  3MPH A;  2BHM A;  3GZB A;  5DRV A;  3EB8 A;  1N5H A;  2PNC A;  1N8Q A;  1DVC A;  2CK3 H;  1EQK A;  1OH0 A;  1OGZ A;  3HK4 A;  5KP1 A;  2O9U X;  1O7W B;  4STD A;  5AYR B;  3CCU 3;  4WWU C;  1OHO A;  1YHQ 3;  3I55 3;  1IVW A;  3EN8 A;  4J8T A;  5CF2 A;  1IVU A;  1ROA A;  1YJN 3;  3CC2 3;  3S28 A;  4XM4 A;  3KFQ C;  1MOL A;  2QA4 3;  3CPW 2;  4R80 A;  2D1W A;  3OWS A;  2CWT A;  1IDP A;  5BVB A;  1NDO B;  1GYB A;  3KZT A;  1K8A 4;  2HMO B;  4KFF A;  4N6T A;  4FR9 A;  1W2Z A;  1K9M 4;  1QJG A;  2UX0 A;  1F8N A;  1ULI B;  2F86 B;  5IG3 A;  1JN5 B;  1N9J A;  2W0Q A;  3FKA A;  2O3O A;  3DMC A;  4JRF A;  3L0R A;  2E2T A;  4FCM A;  1JJ2 2;  2ML5 A;  3BB9 A;  1A2V A;  2CHC A;  1A90 A;  2HMJ B;  3EX9 A;  4K61 A;  5IEN A;  5DRE A;  4KVH A;  2MF7 A;  1NB5 I;  1JKG B;  3DGM A;  4RNY A;  1IT7 A;  1ZX2 A;  4CDL A;  2BMQ B;  2HML B;  4XBT A;  4HVN A;  3MG3 A;  1VQO 3;  2GU3 A;  2ZL8 A;  3FG3 A;  2Y73 A;  4FCZ A;  4Q53 A;  1GD4 A;  3IMA B;  3BNB A;  4RBN A;  3AMO B;  7STD A;  1TFK A;  3Q2P A;  1Q7Y 4;  1S5A A;  4H3U A;  3NM2 A;  1O7G B;  1DMN A;  1NU3 A;  4H61 A;  3LTC A;  4ORL A;  1LOX A;  4XBY A;  2XR8 B;  3STD A;  3WA2 X;  2W56 B;  3GZR A;  3KSE D;  3CCL 3;  1IK3 A;  1J2B A;  1RJO A;  3MHE A;  2CFD A;  2LYX A;  2Q07 A;  3FSD A;  3D9R A;  1GD3 A;  1E97 A;  2HMK B;  3SXX A;  3CCE 3;  2RFR A;  2XEP A;  1Q81 4;  1JN5 A;  2GXF A;  3SLU A;  3PXM A;  2E2V A;  5IF6 A;  4IPB A;  4WHA A;  2YX9 A;  1TU5 A;  1IU7 A;  5AIF A;  1NB3 I;  3EBT A;  4FMD A;  4KZ1 A;  3NBR A;  3BNE A;  2XRX B;  5A0O B;  3EC9 A;  3CU3 A;  3OX9 A;  2OQE C;  3S29 A;  3SOY A;  3DY5 A;  3F40 A;  1W00 A;  2SBL A;  5I97 A;  4WFO A;  2CG1 A;  1AV4 A;  4N6O B;  3GRD A;  2CIU A;  3V98 A;  3NX0 A;  1E3R A;  3K63 A;  1LNH A;  1M90 4;  3NBB A;  1W4N A;  1RRL A;  3U1W A;  1STD A;  3AMO A;  1KC8 4;  2IUK A;  4HM8 B;  3SX1 A;  4N6V 0;  4CCV A;  2WGO A;  1TUH A;  2B24 B;  2LQV A;  2Z6B A;  1WQL B;  3EE1 A;  3N8B A;  2F98 A;  2XGN A;  3X41 A;  1OGX A;  2W56 A;  4R9K A;  1M9G A;  1O7P B;  1VQ5 3;  3NHX A;  2KCD A;  1TIJ A;  1VQL 3;  2WGQ A;  3LXU X;  1HKX A;  4LMI A;  4X2H A;  8CHO A;  3KE7 A;  3FLJ A;  3G71 3;  4WYK A;  3BND A;  3OWU A;  2BT3 A;  2KXG A;  3J7Y d;  3LOY A;  3MG1 A;  3LYG A;  2XSH B;  3EJV A;  3KSP A;  1VQ7 3;  2ML6 A;  3RGA A;  1UW1 A;  3FH1 A;  3K0Z A;  4LEH A;  3E99 A;  1AR0 A;  5AI1 A;  2GEY A;  4AKY A;  3CXC 2;  3CC4 3;  2MC8 A;  3N54 B;  1A67 A;  1Q42 A;  3CMA 3;  1D6Z A;  1LVN A;  1UI7 A;  2Y74 A;  1O7H B;  2FNQ A;  1FA3 A;  1C7H A;  1W6G A;  1Y4K A;  2B1X B;  1WTH A;  3Q90 A;  1K73 4;  4L8P A;  2W9P A;  4HM1 B;  2P0M A;  5CK6 A;  2RCD A;  5AIH A;  1QVF 2;  6STD A;  1RKY A;  5EVH A;  5IG0 A;  4G1M B;  2C10 A;  3NM7 A;  3JUM A;  3QK9 A;  1WMP A;  3ECF A;  3NBJ A;  5G2G A;  1L5G B;  3T0U A;  3T8U A;  2IA7 A;  5HGR A;  1SIH A;  2CFL A;  1VQ4 3;  1OF5 B;  2INX A;  1CYV A;  4HKV B;  5JPU A;  1GS3 A;  3G8Z A;  3JUN A;  1KQS 2;  1GY5 A;  3HIG A;  4LSO A;  4OVM A;  2HMM B;  2FGT A;  1O7N B;  2CFK A;  3G0K A;  3MWZ A;  4HM7 B;  2CFG A;  2WOF A;  4XDW A;  1SJW A;  3BNC A;  3WOF B;  3CCR 3;  3T8N A;  5STD A;  2OOV C;  4IT7 A;  5D83 A;  4HM2 B;  3CCS 3;  1Q40 B;  2JDI H;  1WMO A;  3GZY B;  5IEP A;  3HII A;  2GBX B;  2YFL B;  3I0Y A;  1Q86 4;  5CLK A;  1PFP A;  2I9W A;  3LML A;  4EBG A;  3CME 3;  1Q82 4;  4L8O A;  3F7X A;  1LXE A;  1O7M B;  1JNQ A;  3X42 A;  1HU9 A;  1IQX A;  3OV4 A;  1M1X B;  1UUW B;  4U13 A;  3LTB A;  1QAK A;  4XDV A;  3S5C A;  2HMN B;  4R9L A;  2E2U A;  5AEU B;  3V92 A;  4I4K A;  1E3V A;  2L4V A;  4MMY B;  1YGE A;  1N9E A;  4KFD A;  5LC6 A;  1IVX A;  5IEO A;  4QWT A;  1STF I;  4HM3 B;  5IG4 A;  3LZA A;  4NHF A;  3BLZ A;  2BMO B;  4MEI A;  2W6J H;  2YFI B;  2IMJ A;  3F8H A;  1T5Y A;  3A76 A;  5FGO A;  3TDG A;  1YIJ 3;  3H51 A;  3PS8 A;  4OUQ A;  2V1L A;  3HI7 A;  3IPT A;  4O3V A;  2QEX 3;  4FMB A;  1OF5 A;  4IIA A;  3G6E 3;  2OWP A;  2P05 A;  5AEW B;  3EHC A;  1YIT 3;  1D6Y A;  3D3L A;  3NUV A;  4BTX A;  3CD6 3;  3PCR A;  4N6L A;  2P38 A;  3WOE B;  3FGY A;  5IW9 A;  1SPU A;  4XB5 A;  4EV2 A;  1FGR A;  1Q40 A;  3VGN A;  2W9Q A;  2STD A;  3CCM 3;  1JKG A;  1TFO A;  1VQ8 3;  5FW5 A;  1Z1S A;  4FMC A;  3LH4 A;  2CKF B;  3GWR A;  4OK0 A;  1OAC A;  5CXO A;  3GAX A;  2WOH A;  1G96 A;  3FF2 A;  3F9S A;  4HM0 B;  5EEO A;  3RDE A;  3K5T A;  3FG1 A;  3CCJ 3;  3S67 A;  1GY7 A;  3B4P A;  2JQ5 A;  1W2B 2;  3HX8 A;  3CCQ 3;  3LTD A;  1OHP A;  4BTW A;  2R4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...