4GB5A

Crystal structure of kfla4162 protein from kribbella flavida
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
DAETDRAEIIELFGRYADIADLKEFTDLPRRVHTDPLTIDFESVTGMPPMTVPLSDYGAALRASFGAFSATHHAITGHVVTIDSDRATIHAHVRAEHWLPAEVAGDGPDRWLVVGFYDNEAVRTADGWRLSSVKLTASYQENAHLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of Kfla4162 protein from Kribbella flavida (CASP Target)
rcsb
source organism Kribbella flavida
molecule tags Structural genomics, unknown function
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gb5A00
2OWPA 3F14A 2HMMB 3FGYA 7STDA 5IG0A 1DMNA 5KP3A 3F9SA 5IEOA 1OF5B 2YFIB 3Q90A 2GEXA 4HM7B 1O7NB 4XB5A 5CK6A 1OF5A 4Q53A 3GZXB 3UNLA 4R1KA 5JPPA 5CXOA 1JB2A 3FSDA 2CKFB 2XSHB 3EQQB 2Z77A 3GWRA 3EHCA 4IIAA 4HM6B 3G16A 4XBXA 4MJDA 4HVNA 5CF2A 3K0ZA 3F40A 1OH0A 1E97A 5D81A 5CF1A 3NXJA 4GB5A 1OGXA 5AIGA 1UUVB 1ZX2A 2GEYA 3EX9A 3CNXA 3VGNA 1A2KA 3JUMA 4L7KA 1GY6A 3OV4A 3DMCA 3H51A 3CPOA 4X2HA 1OGZA 3DXOA 3F7SA 3S5CA 3WMDA 2BMOB 1ISKA 2INXA 1OUNA 4R9LA 3JUQA 5KP1A 4CDLA 1AR0A 1NU3A 3ER7A 4FCMA 4LEHA 1O7MB 1BUQA 5DRVA 3SOYA 4OUQA 1UUWB 1JN5B 2GBXB 4H3UA 2B1XB 1GYBA 3JUOA 3NM2A 3CU3A 3OWSA 1GY7A 1JN5A 1DMQA 4STDA 1Q42A 5JPUA 3HX8A 2QGUA 3DM8A 3OWUA 2F86B 5D83A 2YFJB 4WYKA 3IPTA 2BMRB 2HMLB 3F8XA 1Q40B 4I4KA 4XDVA 4HM4B 3G8ZA 4N3VA 3ECFA 4LGQA 2HMKB 1Q40A 2RCDA 3I0YA 1OPYA 1VZZA 3RGRA 1OHOA 3STDA 3M8CA 3NV0B 3HK4A 5G2GA 5IEPA 3NHXA 1QMAA 3NV0A 3UJMA 1O7GB 3OWYA 1NDOB 3B4PA 4XBTA 4PEJA 3F8HA 5D82A 4XDWA 1W00A 3BLZA 4K1VA 5BXQA 2I9WA 3EN1B 3MSOA 1EG9B 3BB9A 1SJWA 4KVHA 3EBYA 3JUNA 1ULIB 2CHCA 1OCVA 1TUHA 4HKVB 1ZO2A 3LYGA 3FH1A 2IMJA 2STDA 2YFLB 3MG2A 1JB5A 3FKAA 4J8TA 1JB4A 8CHOA 1E3VA 3EF8A 5EVHA 1O7WB 3T8NA 4X2OA 2HMOB 3LZAA 3B4OA 2F99A 3EN8A 4HM2B 4WWUC 3KE7A 1E3RA 3FF0A 3RGAA 5AEUB 2UX0A 5AIHA 1OHPA 4WYKB 3B7CA 2Z76A 4R9KA 2XR8B 1ASKA 1DMMA 4HM5B 5DREA 3T8UA 5BVBA 1GS3A 2JQ5A 2K54A 1GY5A 6STDA 1NWWA 5KP4A 3EBTA 3FZWA 3G0KA 5AEWB 4L8OA 2HMJB 2BNGA 4WP5A 3DUKA 2W2CA 2B24B 3OXAA 3MYTA 3B8LA 4XBYA 4XM4A 5IG3A 2QIYA 4HM3B 2RGQA 1O7PB 3GZRA 2F98A 3MG3A 5TGNA 1K41A 2Z7AA 3E99A 3GZYB 1ULJB 5STDA 4RZMA 3KSPA 1U5OA 3EJVA 2HMNB 3CNMA 1W6YA 2XSOB 3ROBA 5IF6A 2GXFA 3HZPA 3KKGA 2R4IA 2BMQB 1Z1SA 3K7CA 4LMIA 5AIFA 2PZVA 3FF2A 3EC9A 5FW5A 4K1UA 5IENA 3KZTA 3GZBA 3SOAA 3SEDA 3FLJA 4HJLB 5HGRA 1CQSA 3VSYA 3JUPA 4HZ9B 1TP6A 3OX9A 2RFRA 4HM8B 1S5AA 3A76A 3MKIA 4HZBB 3NBRA 3D9RA 1WQLB 5CLKA 1C7HA 3MHEA 3F7XA 1W01A 2GBWB 2A15A 3DZLA 4ORLA 3NUVA 1O7HB 4FCJA 3MG1A 5IERA 5AI1A 5AIIA 4HM0B 3GRDA 1IDPA 2XRXB 3H3HA 1EA2A 4OVMA 4U13A 1JKGB 1QJGA 5IG4A 4HM1B 1HKXA 1OHSA 4J9AA 1JKGA 1STDA 4L8PA 1W02A 5IG5A
chains in the Genus database with same CATH superfamily
3ZG5A 2WOHA 2KF3A 2R41A 4KFFA 2OWPA 1GD3A 1RSNA 2GU3A 2HMMB 2RBIA 3F14A 3FGYA 4RBNA 3V98A 3ZFZA 1UI8A 4CCVA 5IG0A 7STDA 1YJ93 1DMNA 5KP3A 2M7OA 4WHAA 3NBJA 1AQZA 1BUJA 3F9SA 5IEOA 4CJNA 1RKYA 1RTUA 1OF5B 2P09A 1TFOA 2RNTA 3S29A 2K3DA 2F56A 2YFIB 2C4BA 3I553 4WFOA 3Q90A 1JRQA 2OCTA 2GEXA 2C10A 3BNEA 4HM7B 1JJ22 5BIRA 1I8VA 1GD4A 1O7NB 2YX9A 4XB5A 1I0XA 1BANA 1GMQA 1OF5A 4Q53A 5CK6A 2OQEA 3CXC2 1QVF2 3GZXB 3UNLA 2UGIA 4R1KA 3RDEA 1OACA 5JPPA 1S723 5CXOA 1B21A 1I3IA 3Q3FA 1JB2A 1RN1A 2KF4A 3FSDA 4TX4A 2CKFB 2XSHB 3DGYA 3EQQB 1IV7A 2Z77A 3GWRA 4LZIA 1LQMB 2H0IA 3EHCA 1SPUA 5ELJA 1BSCA 2CFGA 4IIAA 1FW7A 4HM6B 4KT3B 3FCSB 4EC6A 3G16A 1RGLA 2GU1A 3KCHA 1FUTA 5RNTA 4XBXA 4MJDA 4HVNA 4KFEA 5CF2A 1FGTA 3K0ZA 3MWZA 5I97A 1LOWA 3F40A 3EB8A 1N9JA 4H61A 1OH0A 1E97A 5D81A 1KWIA 5CF1A 3BNCA 1FGOA 1L5GB 3NXJA 1EUIC 1KD14 3X3YA 1RGGA 1I3FA 3X41A 4BIRA 3PGBA 4GB5A 1OGXA 2QA43 1BGSA 5AIGA 1UUVB 3AHWA 1AV4A 1ZX2A 2GEYA 1TIJA 3EX9A 3CNXA 2CFKA 2FXTA 3VGNA 2CC3A 1VQO3 1YVBI 1A2KA 2AAEA 1X1YA 3TDGA 1FYSA 3BNDA 1BSEA 2LYXA 3JUMA 1UCKA 1Q7HA 2O9UX 1GY6A 2MF7A 4L7KA 1TFKA 3UL6A 1R4CA 3OV4A 3DMCA 3H51A 1J2BA 3LMLA 3CPOA 4X2HA 4K90B 1OGZA 2QEX3 2D1WA 3SLUA 1LOVA 1FGRA 2W9PA 3N54B 1BNRA 3DXOA 3F7SA 3S5CA 1BSDA 1LQGC 3WMDA 1G96A 2BMOB 1ISKA 3QRDA 2CIUA 1IVVA 4R80A 2INXA 1VQN3 1OUNA 4R9LA 3JUQA 5KP1A 4CDLA 1M904 1AR0A 1HU9A 1NU3A 3ER7A 1FA3A 4FCMA 1YJN3 1T2HA 2JDIH 4LEHA 5G1KA 1Q814 4O3VA 1NO3A 4HBRA 1O7MB 1BIRA 1BUQA 5DRVA 1BNGA 4OUQA 3SOYA 2V1LA 1UUWB 1JN5B 3PS8A 1MWUA 2GBXB 2L4VA 2XFTA 4H3UA 3SYUA 3PCRA 1FGQA 2AADA 2P05A 3V92A 2E2VA 2B1XB 1A90A 1GYBA 3JUOA 1N9EA 3NM2A 4HAAA 3CU3A 3CCU3 4BL3A 1RMSA 1T2IA 3OWSA 1B2MA 1GY7A 1JN5A 1K9M4 2KCDA 1NB5I 1CYUA 1F8NA 1DMQA 2CFDA 4STDA 2BIRA 1I70A 4KZ1A 4N6UA 1Q42A 5JPUA 3HX8A 2L1SA 3X42A 3CCJ3 2MC8A 3FG4A 1KQS2 2CG0A 1IQXA 4NREA 2OTL3 2QGUA 1IVWA 2WOFA 3ZG0A 3PXMA 3DM8A 4BTXA 3OWUA 4GL6A 2F86B 3CC23 3HIIA 3CCV3 5D83A 1G0TA 2XGNA 2YFJB 4ILFA 1YNVX 2KXGA 1UCIA 2W56B 3DGOA 4WYKA 5BU4A 3IPTA 2XFSA 4AKYA 2BMRB 2HMLB 1BU4A 2ML5A 3F8XA 2F4YA 2IYJA 1VQP3 2Q07A 1Q40B 3G4S3 4HYZA 4I4KA 5GSPA 3WOFB 4XDVA 4HM4B 2W56A 3SX1A 3CPW2 9RNTA 1JBRA 1IV9A 3G8ZA 4N3VA 1RCLA 2CK3H 3ECFA 1R4YA 4LGQA 5LC7A 2HMKB 1FGMA 1HZ1A 1Q40A 3K5TA 2RCDA 3I0YA 1OPYA 1RRHA 1VZZA 2W0QA 3RGRA 2E2UA 4N6TA 2H0GA 3U1WA 4RNZA 2WO0A 2W9QA 3CMA3 1GOUA 2H0HA 1YJW3 1W5ZA 3KN4A 1RLSA 4HOHA 1PFPA 4N6OB 4FMDA 4IT7A 1OHOA 1B2SA 3M8CA 3NV0B 5EEOA 3STDA 1VQ63 5ELUA 2BU4A 3HK4A 3X40A 2KRTA 1YHQ3 6GSPA 3HI7A 1EEJA 5G2GA 5IEPA 3IJEB 3NHXA 1I2GA 1DETA 1QAFA 2F5WA 3QK9A 1V57A 1W6CA 1VQ43 1QMAA 3NV0A 3UJMA 2Y73A 1O7GB 1YGWA 1WMNA 1ZGXA 3OWYA 1NDOB 3Q1CA 2E2TA 4N6NB 3B4PA 2F5MA 4XBTA 4PEJA 3K63A 3GAXA 3F8HA 5D82A 4XDWA 3VF1A 1RRLA 1W00A 3BLZA 4K1VA 2IUJA 5BXQA 1SIHA 4R4KA 1RGAA 2I9WA 2ZHXB 3UL5A 3EN1B 3URPA 3X3XA 1BVIA 1TRPA 1BAOA 3MSOA 4AKZA 1EG9B 2W6JH 3KFQC 3NQZA 3BB9A 1SJWA 4MMYB 4KVHA 1MNLA 3EBYA 3MPHA 3JUNA 1NNVA 1ULIB 1VQK3 1EKMA 2CHCA 1GSPA 4FMAA 4IPBA 3S28A 1OCVA 1TUHA 2C11A 2IY2A 4MEIA 5FGOA 1RNTA 4HKVB 1N5HA 1ZO2A 1LXEA 3LYGA 3FH1A 3LT9A 2IMJA 4J5GA 3U97A 2STDA 2YFLB 3LH4A 4FR9A 2W03A 3MG2A 4I5QA 2CFLA 1JB5A 3FKAA 2HOHA 2W04A 4J8TA 1JB4A 8CHOA 1YIT3 1PYLA 1DYUA 1JV2B 1IT8A 1E3VA 1K734 1UGHI 1MWTA 1AY7A 3DGLA 2ZDJA 3EF8A 5EVHA 1VQ53 1BNSA 3CME3 1O7WB 1B27A 2BHMA 1IVUA 3T8NA 4X2OA 2CWVA 2HMOB 3A5EA 3LZAA 3B4OA 1GOVA 1G02A 3KIIA 3BNBA 2F99A 1B3SA 1B2UA 2XH9A 3EN8A 4HM2B 3WA3A 4WWUC 3KE7A 8RNTA 3DGNA 3WHOA 1E3RA 2KF5A 1FZUA 4N6LA 1WMPA 2IUKA 4GHOA 4OK0A 1B2XA 1RCKA 3AHSA 4K61A 3FF0A 4BL2A 3S27A 1Y4KA 1BRKA 1RNBA 3N8BA 1JZDA 5LC6A 3Q2PA 1A2VA 3AGNA 3RGAA 3WODG 2CWTA 3DGMA 4MMXB 1Q9EA 4EW5A 2UX0A 5AEUB 3CCQ3 3LTCA 1RGCA 5AIHA 1IVXA 1UUGB 1W7CA 2CX0A 2IA7A 1OHPA 4AEQA 3S67A 4RNYA 4WYKB 5M18A 1BRNL 1JBTA 1B2ZA 2FNQA 1TJDA 3B7CA 3PZWA 1N8QA 2WGOA 2Z76A 1IYYA 6RNTA 3WDGB 2XGLA 1D6UA 4R9KA 2XR8B 5AYSC 1BSAA 1GMRA 1QAKA 3SVAA 3PYJA 1C54A 1ASKA 1DMMA 1D6ZA 3KSED 1IQYA 4HM5B 1BNFA 2K0MA 5DREA 3T8UA 4MMZB 4GSPA 1VQ83 5BVBA 4G1MB 1GS3A 1RGKA 2JQ5A 2K54A 4FMBA 1VQQA 1GY5A 1NWWA 4JRFA 1BRGA 6STDA 5KP4A 3EBTA 2CW9A 1W6GA 3FZWA 1Q824 3G0KA 3V99A 5AEWB 4L8OA 1UCLA 2SBLA 2HMJB 2BNGA 4WP5A 1BRJA 2D42A 1TRQA 3DUKA 2Y74A 1K8A4 2W2CA 1JNQA 1I0VA 2P0XA 2B24B 3K9MC 3D5IA 3OXAA 1TU5A 3MYTA 1VQL3 3B8LA 1T3BA 2LQVA 1DVDA 1UW1A 1I2FA 1STFI 2ML6A 1KC84 1D6YA 3EE1A 4BU4A 1BSBA 4XBYA 1LVNA 1I2EA 1RJOA 4XM4A 5IG3A 1PY3A 1RN7A 1BRIA 2QIYA 1MGWA 4HM3B 4ZM8A 2RGQA 3JVCA 1O7PB 1X1WA 3GZRA 2F98A 3UB1A 3MG3A 1DE3A 2BT3A 3CCR3 1MOLA 5TGNA 1X1UA 1DVCA 1K41A 3RNTA 2Z7AA 2WGQA 3E99A 3GZYB 4BTWA 1ULJB 2CFWA 3IMAB 1AVKA 1MGRA 1RHLA 3CC73 2BO9B 1SIIA 5STDA 1QVG2 1ZS7A 3NQYA 5AYRB 4EV2A 3DH2A 4O2HA 1PU4A 3HIGA 4RZMA 3LT8A 3KSPA 1CH0A 1UI7A 1U5OA 3EJVA 2HMNB 2ZA4A 1YGEA 2KAAA 3OW22 1U8CB 3CNMA 1RGHA 1NB3I 1W6YA 1ROVA 3WOEB 5EQLA 4N6V0 5JBSA 1SQWA 2P0MA 2XSOB 3ROBA 2OOVC 5IF6A 3FG1A 1LRAA 4EYCA 1BRSA 1US1A 4NPBA 1UGIA 2GXFA 1CYVA 1IQ8A 2GSPA 3D3LA 3D79A 3HZPA 4BTYA 1A2PA 3AMOB 3D4AA 3KKGA 1VQM3 3DY5A 2R4IA 2BMQB 5IG5A 3X3ZA 1Z1SA 4O02B 1LOXA 1X1XA 3K7CA 4LMIA 1HYFA 5AIFA 3BIRA 3SXXA 1SARA 1M1K4 2PZVA 1VQ73 3FF2A 1JBSA 2XF3A 1W2ZA 3EC9A 5FW5A 4K1UA 5A0OB 3AMOA 3LOYA 3KZTA 4FMCA 3T0UA 1MWRA 4CPKA 5IENA 2SARA 3GZBA 3LXUX 3SOAA 3J7Yd 1A67A 2UUGC 3ALAA 2OOVA 1VQ93 2CWUA 3SEDA 1WTHA 3FLJA 1EQKA 4HJLB 4NHFA 3GSPA 3WA2X 1W2B2 3NM7A 1BOXA 1BRHA 1RDSA 5HOHA 1GMPA 1UCJA 3G713 1RGFA 1MWSA 5HGRA 1LNIA 5IW9A 1CQSA 3VSYA 1NJI4 3JUPA 4HZ9B 1AVLA 1TP6A 3LTAA 3OX9A 1Q864 1V74A 3LTDA 7GSPA 2RFRA 1W4NA 2CH9A 2OTJ3 5G1LA 4HM8B 4KFDA 2FGTA 1YI23 1N5PA 1S5AA 3N9HA 4O8SA 1FUSA 3A76A 2CX1A 3MKIA 1RGEA 1IU7A 2Z6BA 4EV5A 2ZL8A 1JZOA 4HZBB 2O3OA 1M9GA 3O8YA 4N6MA 4EBGA 3BU4A 3NBRA 1LOYA 3D9RA 1WQLB 2P38A 5CLKA 2PNCA 3FG3A 2RSXA 3HOHA 3WR2A 4EXRA 1IT7A 1C7HA 3MHEA 3CCL3 4LSOA 3LTBA 4RNTA 3F7XA 3CCM3 1TTOA 1W01A 2XEPA 4QWTA 4LYLB 2GBWB 1ROAA 4JF8A 1FUWA 7RNTA 2A15A 1UDII 1GOYA 1T5YA 1WNHA 3DZLA 5M1AA 4ORLA 3NUVA 1CEWI 1O7HB 4FCJA 2KF6A 3MG1A 1RN4A 5IERA 1N8R4 2J8XB 5AI1A 1K28A 5AIIA 1V58A 4HM0B 3GRDA 3G6E3 1IDPA 2XRXB 3H3HA 3L0RA 3CCS3 1Q7Y4 3CD63 1BNEA 1EA2A 5M19A 4OVMA 3I563 4U13A 3PCSA 2CG1A 1JKGB 4J5KA 1QJGA 3AGOA 1LNHA 5IG4A 1IK3A 4HM1B 1B20A 1M1XB 1BNJA 4FCZA 4DKIA 1HKXA 1KSIA 1YIJ3 3CC43 3NBBA 3CCE3 1BNIA 1OHSA 4J9AA 1JKGA 1STDA 3D5GA 3NX0A 1QALA 1WMOA 4L8PA 1W02A 2OQEC 1YVSA
chains in the Genus database with same CATH topology
2WOHA 4KFFA 2OWPA 1GD3A 2GU3A 2HMMB 3F14A 3FGYA 4RBNA 3V98A 4CCVA 1UI8A 7STDA 5IG0A 1YJ93 1DMNA 5KP3A 2M7OA 4WHAA 3NBJA 3F9SA 5IEOA 1RKYA 1OF5B 2P09A 1TFOA 3S29A 2YFIB 3I553 4WFOA 3Q90A 1JRQA 2OCTA 2GEXA 2C10A 3BNEA 4HM7B 1JJ22 1GD4A 1O7NB 2YX9A 4XB5A 2OQEA 5CK6A 3CXC2 1OF5A 4Q53A 1QVF2 3GZXB 3UNLA 4R1KA 3RDEA 1OACA 5JPPA 1S723 5CXOA 1JB2A 3FSDA 4TX4A 2CKFB 2XSHB 3EQQB 1IV7A 2Z77A 3GWRA 4LZIA 3EHCA 1SPUA 5ELJA 4IIAA 2CFGA 4HM6B 3FCSB 4EC6A 3G16A 2GU1A 4XBXA 4MJDA 4HVNA 4KFEA 5CF2A 1FGTA 3K0ZA 3MWZA 5I97A 3F40A 3EB8A 1N9JA 4H61A 1OH0A 1E97A 5D81A 1KWIA 5CF1A 3BNCA 1FGOA 1L5GB 3NXJA 1KD14 3X3YA 3X41A 3PGBA 4GB5A 1OGXA 2QA43 5AIGA 1UUVB 1AV4A 1ZX2A 2GEYA 1TIJA 3EX9A 3CNXA 2CFKA 2FXTA 3VGNA 2CC3A 1VQO3 1YVBI 1A2KA 3TDGA 3BNDA 2LYXA 3JUMA 4L7KA 5AYSC 2O9UX 1GY6A 2MF7A 1J2BA 1TFKA 3UL6A 1R4CA 3OV4A 3DMCA 3H51A 3LMLA 3CPOA 4X2HA 4K90B 1OGZA 2QEX3 2D1WA 3SLUA 1FGRA 2W9PA 3N54B 3DXOA 3F7SA 3S5CA 3WMDA 1G96A 2BMOB 1ISKA 3QRDA 2CIUA 1IVVA 4R80A 2INXA 1VQN3 1OUNA 4R9LA 3JUQA 5KP1A 4CDLA 1M904 1AR0A 1HU9A 1NU3A 3ER7A 1FA3A 4FCMA 1YJN3 4LEHA 2JDIH 1Q814 4O3VA 1NO3A 4HBRA 1O7MB 1BUQA 5DRVA 3SOYA 4OUQA 2V1LA 1UUWB 1JN5B 3PS8A 2GBXB 2L4VA 2XFTA 4H3UA 3PCRA 1FGQA 2P05A 3V92A 2E2VA 2B1XB 1A90A 1GYBA 3JUOA 1N9EA 3NM2A 3CU3A 3CCU3 3OWSA 1GY7A 1JN5A 1K9M4 2KCDA 1NB5I 1CYUA 1F8NA 1DMQA 2CFDA 4STDA 4KZ1A 4N6UA 1Q42A 5JPUA 3HX8A 3X42A 3CCJ3 2MC8A 3FG4A 1KQS2 2CG0A 1IQXA 4NREA 2OTL3 2QGUA 1IVWA 2WOFA 3PXMA 3DM8A 4BTXA 3OWUA 4GL6A 2F86B 3CC23 3HIIA 3CCV3 5D83A 2YFJB 2XGNA 2KXGA 2W56B 3DGOA 4WYKA 3IPTA 2XFSA 4AKYA 2BMRB 2HMLB 3F8XA 2ML5A 1VQP3 2Q07A 1Q40B 3G4S3 4HYZA 4I4KA 3WOFB 4XDVA 4HM4B 2W56A 3SX1A 3CPW2 1IV9A 3G8ZA 4N3VA 2CK3H 3ECFA 5LC7A 4LGQA 2HMKB 1FGMA 3K5TA 1Q40A 2RCDA 3I0YA 1OPYA 1RRHA 1VZZA 2W0QA 3RGRA 2E2UA 4N6TA 3U1WA 4RNZA 2WO0A 2W9QA 3CMA3 1YJW3 1W5ZA 3KN4A 1PFPA 4N6OB 4FMDA 4IT7A 1OHOA 3STDA 3M8CA 3NV0B 5EEOA 1VQ63 5ELUA 3HK4A 3X40A 2KRTA 1YHQ3 3HI7A 5G2GA 5IEPA 3IJEB 3NHXA 1QAFA 3QK9A 1W6CA 1VQ43 1QMAA 3NV0A 3UJMA 2Y73A 1O7GB 1WMNA 3OWYA 1NDOB 3Q1CA 2E2TA 4N6NB 3B4PA 4XBTA 4PEJA 3K63A 3GAXA 3F8HA 5D82A 4XDWA 3VF1A 1RRLA 1W00A 3BLZA 4K1VA 2IUJA 5BXQA 1SIHA 4R4KA 2I9WA 3UL5A 3EN1B 3X3XA 3MSOA 4AKZA 1EG9B 2W6JH 3KFQC 3NQZA 3BB9A 1SJWA 4MMYB 4KVHA 1MNLA 3EBYA 3MPHA 3JUNA 1VQK3 1ULIB 1EKMA 2CHCA 4FMAA 4IPBA 3S28A 1OCVA 1TUHA 2C11A 4MEIA 5FGOA 4HKVB 1N5HA 1ZO2A 1LXEA 3LYGA 3FH1A 3LT9A 2IMJA 3U97A 2STDA 2YFLB 3LH4A 4FR9A 2W03A 3MG2A 2CFLA 1JB5A 3FKAA 2W04A 4J8TA 1JB4A 8CHOA 1YIT3 1DYUA 1IT8A 1JV2B 1E3VA 1K734 3DGLA 2ZDJA 3EF8A 5EVHA 1VQ53 3CME3 1O7WB 2BHMA 1IVUA 3T8NA 4X2OA 2CWVA 2HMOB 3LZAA 3B4OA 3KIIA 3BNBA 2F99A 2XH9A 3EN8A 4HM2B 3WA3A 4WWUC 3KE7A 3DGNA 1E3RA 4N6LA 1WMPA 2IUKA 4OK0A 4K61A 3FF0A 3S27A 1Y4KA 3N8BA 5LC6A 3Q2PA 1A2VA 3RGAA 3WODG 2CWTA 3DGMA 4MMXB 5AEUB 3CCQ3 2UX0A 3LTCA 5AIHA 1IVXA 1W7CA 2IA7A 1OHPA 4AEQA 3S67A 4RNYA 4WYKB 2FNQA 3PZWA 3B7CA 1N8QA 2WGOA 2Z76A 3WDGB 2XGLA 1D6UA 4R9KA 2XR8B 1QAKA 3SVAA 3PYJA 1ASKA 1DMMA 1D6ZA 3KSED 1IQYA 4HM5B 2K0MA 5DREA 3T8UA 4MMZB 1VQ83 5BVBA 4G1MB 1GS3A 2JQ5A 2K54A 4FMBA 1GY5A 4JRFA 1NWWA 6STDA 5KP4A 3EBTA 2CW9A 1W6GA 3FZWA 1Q824 3G0KA 3V99A 5AEWB 4L8OA 2SBLA 2HMJB 2BNGA 4WP5A 2D42A 3DUKA 2Y74A 1K8A4 2W2CA 1JNQA 2P0XA 2B24B 3K9MC 3OXAA 1TU5A 3MYTA 1VQL3 3B8LA 2LQVA 1DVDA 1UW1A 1STFI 2ML6A 1KC84 1D6YA 3EE1A 4XBYA 1LVNA 1RJOA 4XM4A 5IG3A 1RN7A 2QIYA 4HM3B 4ZM8A 2RGQA 3JVCA 1O7PB 3GZRA 3UB1A 2F98A 3MG3A 2BT3A 3CCR3 1MOLA 5TGNA 1DVCA 1K41A 2Z7AA 2WGQA 3E99A 3GZYB 4BTWA 1ULJB 2CFWA 3IMAB 1AVKA 3CC73 1QVG2 2BO9B 1SIIA 5STDA 3NQYA 5AYRB 4EV2A 4O2HA 1PU4A 3HIGA 4RZMA 3LT8A 3KSPA 1UI7A 1U5OA 3EJVA 2HMNB 1YGEA 3OW22 1U8CB 3CNMA 1W6YA 1NB3I 1ROVA 3WOEB 5EQLA 4N6V0 5JBSA 1SQWA 2P0MA 2XSOB 3ROBA 2OOVC 5IF6A 3FG1A 4EYCA 1US1A 2GXFA 1CYVA 1IQ8A 3D3LA 3HZPA 4BTYA 3AMOB 3KKGA 1VQM3 3DY5A 2R4IA 2BMQB 5IG5A 3X3ZA 1Z1SA 4O02B 1LOXA 3K7CA 4LMIA 5AIFA 3SXXA 1M1K4 2PZVA 1VQ73 3FF2A 2XF3A 1W2ZA 3EC9A 5FW5A 4K1UA 5A0OB 3AMOA 3LOYA 3KZTA 4FMCA 3T0UA 5IENA 3GZBA 3LXUX 3SOAA 3J7Yd 1A67A 3ALAA 2OOVA 1VQ93 2CWUA 3SEDA 1WTHA 3FLJA 1EQKA 4HJLB 4NHFA 3WA2X 1W2B2 3NM7A 3G713 5HGRA 5IW9A 1CQSA 3VSYA 1NJI4 3JUPA 4HZ9B 1AVLA 1TP6A 3LTAA 3OX9A 1Q864 1V74A 3LTDA 2RFRA 1W4NA 2CH9A 2OTJ3 4HM8B 4KFDA 2FGTA 1YI23 1N5PA 1S5AA 3N9HA 4O8SA 3A76A 3MKIA 1IU7A 2Z6BA 4EV5A 2ZL8A 4HZBB 2O3OA 1M9GA 3O8YA 4N6MA 4EBGA 3NBRA 3D9RA 1WQLB 2P38A 5CLKA 2PNCA 3FG3A 2RSXA 4EXRA 3CCL3 1IT7A 1C7HA 3MHEA 4LSOA 3LTBA 3F7XA 3CCM3 1W01A 2XEPA 4QWTA 2GBWB 1ROAA 4JF8A 1FUWA 2A15A 1T5YA 1WNHA 3DZLA 4ORLA 3NUVA 1CEWI 1O7HB 4FCJA 3MG1A 5IERA 1N8R4 5AI1A 1K28A 5AIIA 4HM0B 3GRDA 3G6E3 1IDPA 2XRXB 3H3HA 3L0RA 3CCS3 1Q7Y4 3CD63 1EA2A 3I563 4OVMA 4U13A 3PCSA 2CG1A 1JKGB 1QJGA 1LNHA 5IG4A 1IK3A 4HM1B 1M1XB 4FCZA 1YIJ3 1HKXA 1KSIA 3CC43 3NBBA 3CCE3 1OHSA 4J9AA 1JKGA 1STDA 3NX0A 1QALA 1WMOA 4L8PA 1W02A 2OQEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWP A;  3F14 A;  2HMM B;  3FGY A;  7STD A;  5IG0 A;  1DMN A;  5KP3 A;  3F9S A;  5IEO A;  1OF5 B;  2YFI B;  3Q90 A;  2GEX A;  4HM7 B;  1O7N B;  4XB5 A;  5CK6 A;  1OF5 A;  4Q53 A;  3GZX B;  3UNL A;  4R1K A;  5JPP A;  5CXO A;  1JB2 A;  3FSD A;  2CKF B;  2XSH B;  3EQQ B;  2Z77 A;  3GWR A;  3EHC A;  4IIA A;  4HM6 B;  3G16 A;  4XBX A;  4MJD A;  4HVN A;  5CF2 A;  3K0Z A;  3F40 A;  1OH0 A;  1E97 A;  5D81 A;  5CF1 A;  3NXJ A;  4GB5 A;  1OGX A;  5AIG A;  1UUV B;  1ZX2 A;  2GEY A;  3EX9 A;  3CNX A;  3VGN A;  1A2K A;  3JUM A;  4L7K A;  1GY6 A;  3OV4 A;  3DMC A;  3H51 A;  3CPO A;  4X2H A;  1OGZ A;  3DXO A;  3F7S A;  3S5C A;  3WMD A;  2BMO B;  1ISK A;  2INX A;  1OUN A;  4R9L A;  3JUQ A;  5KP1 A;  4CDL A;  1AR0 A;  1NU3 A;  3ER7 A;  4FCM A;  4LEH A;  1O7M B;  1BUQ A;  5DRV A;  3SOY A;  4OUQ A;  1UUW B;  1JN5 B;  2GBX B;  4H3U A;  2B1X B;  1GYB A;  3JUO A;  3NM2 A;  3CU3 A;  3OWS A;  1GY7 A;  1JN5 A;  1DMQ A;  4STD A;  1Q42 A;  5JPU A;  3HX8 A;  2QGU A;  3DM8 A;  3OWU A;  2F86 B;  5D83 A;  2YFJ B;  4WYK A;  3IPT A;  2BMR B;  2HML B;  3F8X A;  1Q40 B;  4I4K A;  4XDV A;  4HM4 B;  3G8Z A;  4N3V A;  3ECF A;  4LGQ A;  2HMK B;  1Q40 A;  2RCD A;  3I0Y A;  1OPY A;  1VZZ A;  3RGR A;  1OHO A;  3STD A;  3M8C A;  3NV0 B;  3HK4 A;  5G2G A;  5IEP A;  3NHX A;  1QMA A;  3NV0 A;  3UJM A;  1O7G B;  3OWY A;  1NDO B;  3B4P A;  4XBT A;  4PEJ A;  3F8H A;  5D82 A;  4XDW A;  1W00 A;  3BLZ A;  4K1V A;  5BXQ A;  2I9W A;  3EN1 B;  3MSO A;  1EG9 B;  3BB9 A;  1SJW A;  4KVH A;  3EBY A;  3JUN A;  1ULI B;  2CHC A;  1OCV A;  1TUH A;  4HKV B;  1ZO2 A;  3LYG A;  3FH1 A;  2IMJ A;  2STD A;  2YFL B;  3MG2 A;  1JB5 A;  3FKA A;  4J8T A;  1JB4 A;  8CHO A;  1E3V A;  3EF8 A;  5EVH A;  1O7W B;  3T8N A;  4X2O A;  2HMO B;  3LZA A;  3B4O A;  2F99 A;  3EN8 A;  4HM2 B;  4WWU C;  3KE7 A;  1E3R A;  3FF0 A;  3RGA A;  5AEU B;  2UX0 A;  5AIH A;  1OHP A;  4WYK B;  3B7C A;  2Z76 A;  4R9K A;  2XR8 B;  1ASK A;  1DMM A;  4HM5 B;  5DRE A;  3T8U A;  5BVB A;  1GS3 A;  2JQ5 A;  2K54 A;  1GY5 A;  6STD A;  1NWW A;  5KP4 A;  3EBT A;  3FZW A;  3G0K A;  5AEW B;  4L8O A;  2HMJ B;  2BNG A;  4WP5 A;  3DUK A;  2W2C A;  2B24 B;  3OXA A;  3MYT A;  3B8L A;  4XBY A;  4XM4 A;  5IG3 A;  2QIY A;  4HM3 B;  2RGQ A;  1O7P B;  3GZR A;  2F98 A;  3MG3 A;  5TGN A;  1K41 A;  2Z7A A;  3E99 A;  3GZY B;  1ULJ B;  5STD A;  4RZM A;  3KSP A;  1U5O A;  3EJV A;  2HMN B;  3CNM A;  1W6Y A;  2XSO B;  3ROB A;  5IF6 A;  2GXF A;  3HZP A;  3KKG A;  2R4I A;  2BMQ B;  1Z1S A;  3K7C A;  4LMI A;  5AIF A;  2PZV A;  3FF2 A;  3EC9 A;  5FW5 A;  4K1U A;  5IEN A;  3KZT A;  3GZB A;  3SOA A;  3SED A;  3FLJ A;  4HJL B;  5HGR A;  1CQS A;  3VSY A;  3JUP A;  4HZ9 B;  1TP6 A;  3OX9 A;  2RFR A;  4HM8 B;  1S5A A;  3A76 A;  3MKI A;  4HZB B;  3NBR A;  3D9R A;  1WQL B;  5CLK A;  1C7H A;  3MHE A;  3F7X A;  1W01 A;  2GBW B;  2A15 A;  3DZL A;  4ORL A;  3NUV A;  1O7H B;  4FCJ A;  3MG1 A;  5IER A;  5AI1 A;  5AII A;  4HM0 B;  3GRD A;  1IDP A;  2XRX B;  3H3H A;  1EA2 A;  4OVM A;  4U13 A;  1JKG B;  1QJG A;  5IG4 A;  4HM1 B;  1HKX A;  1OHS A;  4J9A A;  1JKG A;  1STD A;  4L8P A;  1W02 A;  5IG5 A; 
#chains in the Genus database with same CATH topology
 3ZG5 A;  2WOH A;  2KF3 A;  2R41 A;  4KFF A;  2OWP A;  1GD3 A;  1RSN A;  2GU3 A;  2HMM B;  2RBI A;  3F14 A;  3FGY A;  4RBN A;  3V98 A;  3ZFZ A;  1UI8 A;  4CCV A;  5IG0 A;  7STD A;  1YJ9 3;  1DMN A;  5KP3 A;  2M7O A;  4WHA A;  3NBJ A;  1AQZ A;  1BUJ A;  3F9S A;  5IEO A;  4CJN A;  1RKY A;  1RTU A;  1OF5 B;  2P09 A;  1TFO A;  2RNT A;  3S29 A;  2K3D A;  2F56 A;  2YFI B;  2C4B A;  3I55 3;  4WFO A;  3Q90 A;  1JRQ A;  2OCT A;  2GEX A;  2C10 A;  3BNE A;  4HM7 B;  1JJ2 2;  5BIR A;  1I8V A;  1GD4 A;  1O7N B;  2YX9 A;  4XB5 A;  1I0X A;  1BAN A;  1GMQ A;  1OF5 A;  4Q53 A;  5CK6 A;  2OQE A;  3CXC 2;  1QVF 2;  3GZX B;  3UNL A;  2UGI A;  4R1K A;  3RDE A;  1OAC A;  5JPP A;  1S72 3;  5CXO A;  1B21 A;  1I3I A;  3Q3F A;  1JB2 A;  1RN1 A;  2KF4 A;  3FSD A;  4TX4 A;  2CKF B;  2XSH B;  3DGY A;  3EQQ B;  1IV7 A;  2Z77 A;  3GWR A;  4LZI A;  1LQM B;  2H0I A;  3EHC A;  1SPU A;  5ELJ A;  1BSC A;  2CFG A;  4IIA A;  1FW7 A;  4HM6 B;  4KT3 B;  3FCS B;  4EC6 A;  3G16 A;  1RGL A;  2GU1 A;  3KCH A;  1FUT A;  5RNT A;  4XBX A;  4MJD A;  4HVN A;  4KFE A;  5CF2 A;  1FGT A;  3K0Z A;  3MWZ A;  5I97 A;  1LOW A;  3F40 A;  3EB8 A;  1N9J A;  4H61 A;  1OH0 A;  1E97 A;  5D81 A;  1KWI A;  5CF1 A;  3BNC A;  1FGO A;  1L5G B;  3NXJ A;  1EUI C;  1KD1 4;  3X3Y A;  1RGG A;  1I3F A;  3X41 A;  4BIR A;  3PGB A;  4GB5 A;  1OGX A;  2QA4 3;  1BGS A;  5AIG A;  1UUV B;  3AHW A;  1AV4 A;  1ZX2 A;  2GEY A;  1TIJ A;  3EX9 A;  3CNX A;  2CFK A;  2FXT A;  3VGN A;  2CC3 A;  1VQO 3;  1YVB I;  1A2K A;  2AAE A;  1X1Y A;  3TDG A;  1FYS A;  3BND A;  1BSE A;  2LYX A;  3JUM A;  1UCK A;  1Q7H A;  2O9U X;  1GY6 A;  2MF7 A;  4L7K A;  1TFK A;  3UL6 A;  1R4C A;  3OV4 A;  3DMC A;  3H51 A;  1J2B A;  3LML A;  3CPO A;  4X2H A;  4K90 B;  1OGZ A;  2QEX 3;  2D1W A;  3SLU A;  1LOV A;  1FGR A;  2W9P A;  3N54 B;  1BNR A;  3DXO A;  3F7S A;  3S5C A;  1BSD A;  1LQG C;  3WMD A;  1G96 A;  2BMO B;  1ISK A;  3QRD A;  2CIU A;  1IVV A;  4R80 A;  2INX A;  1VQN 3;  1OUN A;  4R9L A;  3JUQ A;  5KP1 A;  4CDL A;  1M90 4;  1AR0 A;  1HU9 A;  1NU3 A;  3ER7 A;  1FA3 A;  4FCM A;  1YJN 3;  1T2H A;  2JDI H;  4LEH A;  5G1K A;  1Q81 4;  4O3V A;  1NO3 A;  4HBR A;  1O7M B;  1BIR A;  1BUQ A;  5DRV A;  1BNG A;  4OUQ A;  3SOY A;  2V1L A;  1UUW B;  1JN5 B;  3PS8 A;  1MWU A;  2GBX B;  2L4V A;  2XFT A;  4H3U A;  3SYU A;  3PCR A;  1FGQ A;  2AAD A;  2P05 A;  3V92 A;  2E2V A;  2B1X B;  1A90 A;  1GYB A;  3JUO A;  1N9E A;  3NM2 A;  4HAA A;  3CU3 A;  3CCU 3;  4BL3 A;  1RMS A;  1T2I A;  3OWS A;  1B2M A;  1GY7 A;  1JN5 A;  1K9M 4;  2KCD A;  1NB5 I;  1CYU A;  1F8N A;  1DMQ A;  2CFD A;  4STD A;  2BIR A;  1I70 A;  4KZ1 A;  4N6U A;  1Q42 A;  5JPU A;  3HX8 A;  2L1S A;  3X42 A;  3CCJ 3;  2MC8 A;  3FG4 A;  1KQS 2;  2CG0 A;  1IQX A;  4NRE A;  2OTL 3;  2QGU A;  1IVW A;  2WOF A;  3ZG0 A;  3PXM A;  3DM8 A;  4BTX A;  3OWU A;  4GL6 A;  2F86 B;  3CC2 3;  3HII A;  3CCV 3;  5D83 A;  1G0T A;  2XGN A;  2YFJ B;  4ILF A;  1YNV X;  2KXG A;  1UCI A;  2W56 B;  3DGO A;  4WYK A;  5BU4 A;  3IPT A;  2XFS A;  4AKY A;  2BMR B;  2HML B;  1BU4 A;  2ML5 A;  3F8X A;  2F4Y A;  2IYJ A;  1VQP 3;  2Q07 A;  1Q40 B;  3G4S 3;  4HYZ A;  4I4K A;  5GSP A;  3WOF B;  4XDV A;  4HM4 B;  2W56 A;  3SX1 A;  3CPW 2;  9RNT A;  1JBR A;  1IV9 A;  3G8Z A;  4N3V A;  1RCL A;  2CK3 H;  3ECF A;  1R4Y A;  4LGQ A;  5LC7 A;  2HMK B;  1FGM A;  1HZ1 A;  1Q40 A;  3K5T A;  2RCD A;  3I0Y A;  1OPY A;  1RRH A;  1VZZ A;  2W0Q A;  3RGR A;  2E2U A;  4N6T A;  2H0G A;  3U1W A;  4RNZ A;  2WO0 A;  2W9Q A;  3CMA 3;  1GOU A;  2H0H A;  1YJW 3;  1W5Z A;  3KN4 A;  1RLS A;  4HOH A;  1PFP A;  4N6O B;  4FMD A;  4IT7 A;  1OHO A;  1B2S A;  3M8C A;  3NV0 B;  5EEO A;  3STD A;  1VQ6 3;  5ELU A;  2BU4 A;  3HK4 A;  3X40 A;  2KRT A;  1YHQ 3;  6GSP A;  3HI7 A;  1EEJ A;  5G2G A;  5IEP A;  3IJE B;  3NHX A;  1I2G A;  1DET A;  1QAF A;  2F5W A;  3QK9 A;  1V57 A;  1W6C A;  1VQ4 3;  1QMA A;  3NV0 A;  3UJM A;  2Y73 A;  1O7G B;  1YGW A;  1WMN A;  1ZGX A;  3OWY A;  1NDO B;  3Q1C A;  2E2T A;  4N6N B;  3B4P A;  2F5M A;  4XBT A;  4PEJ A;  3K63 A;  3GAX A;  3F8H A;  5D82 A;  4XDW A;  3VF1 A;  1RRL A;  1W00 A;  3BLZ A;  4K1V A;  2IUJ A;  5BXQ A;  1SIH A;  4R4K A;  1RGA A;  2I9W A;  2ZHX B;  3UL5 A;  3EN1 B;  3URP A;  3X3X A;  1BVI A;  1TRP A;  1BAO A;  3MSO A;  4AKZ A;  1EG9 B;  2W6J H;  3KFQ C;  3NQZ A;  3BB9 A;  1SJW A;  4MMY B;  4KVH A;  1MNL A;  3EBY A;  3MPH A;  3JUN A;  1NNV A;  1ULI B;  1VQK 3;  1EKM A;  2CHC A;  1GSP A;  4FMA A;  4IPB A;  3S28 A;  1OCV A;  1TUH A;  2C11 A;  2IY2 A;  4MEI A;  5FGO A;  1RNT A;  4HKV B;  1N5H A;  1ZO2 A;  1LXE A;  3LYG A;  3FH1 A;  3LT9 A;  2IMJ A;  4J5G A;  3U97 A;  2STD A;  2YFL B;  3LH4 A;  4FR9 A;  2W03 A;  3MG2 A;  4I5Q A;  2CFL A;  1JB5 A;  3FKA A;  2HOH A;  2W04 A;  4J8T A;  1JB4 A;  8CHO A;  1YIT 3;  1PYL A;  1DYU A;  1JV2 B;  1IT8 A;  1E3V A;  1K73 4;  1UGH I;  1MWT A;  1AY7 A;  3DGL A;  2ZDJ A;  3EF8 A;  5EVH A;  1VQ5 3;  1BNS A;  3CME 3;  1O7W B;  1B27 A;  2BHM A;  1IVU A;  3T8N A;  4X2O A;  2CWV A;  2HMO B;  3A5E A;  3LZA A;  3B4O A;  1GOV A;  1G02 A;  3KII A;  3BNB A;  2F99 A;  1B3S A;  1B2U A;  2XH9 A;  3EN8 A;  4HM2 B;  3WA3 A;  4WWU C;  3KE7 A;  8RNT A;  3DGN A;  3WHO A;  1E3R A;  2KF5 A;  1FZU A;  4N6L A;  1WMP A;  2IUK A;  4GHO A;  4OK0 A;  1B2X A;  1RCK A;  3AHS A;  4K61 A;  3FF0 A;  4BL2 A;  3S27 A;  1Y4K A;  1BRK A;  1RNB A;  3N8B A;  1JZD A;  5LC6 A;  3Q2P A;  1A2V A;  3AGN A;  3RGA A;  3WOD G;  2CWT A;  3DGM A;  4MMX B;  1Q9E A;  4EW5 A;  2UX0 A;  5AEU B;  3CCQ 3;  3LTC A;  1RGC A;  5AIH A;  1IVX A;  1UUG B;  1W7C A;  2CX0 A;  2IA7 A;  1OHP A;  4AEQ A;  3S67 A;  4RNY A;  4WYK B;  5M18 A;  1BRN L;  1JBT A;  1B2Z A;  2FNQ A;  1TJD A;  3B7C A;  3PZW A;  1N8Q A;  2WGO A;  2Z76 A;  1IYY A;  6RNT A;  3WDG B;  2XGL A;  1D6U A;  4R9K A;  2XR8 B;  5AYS C;  1BSA A;  1GMR A;  1QAK A;  3SVA A;  3PYJ A;  1C54 A;  1ASK A;  1DMM A;  1D6Z A;  3KSE D;  1IQY A;  4HM5 B;  1BNF A;  2K0M A;  5DRE A;  3T8U A;  4MMZ B;  4GSP A;  1VQ8 3;  5BVB A;  4G1M B;  1GS3 A;  1RGK A;  2JQ5 A;  2K54 A;  4FMB A;  1VQQ A;  1GY5 A;  1NWW A;  4JRF A;  1BRG A;  6STD A;  5KP4 A;  3EBT A;  2CW9 A;  1W6G A;  3FZW A;  1Q82 4;  3G0K A;  3V99 A;  5AEW B;  4L8O A;  1UCL A;  2SBL A;  2HMJ B;  2BNG A;  4WP5 A;  1BRJ A;  2D42 A;  1TRQ A;  3DUK A;  2Y74 A;  1K8A 4;  2W2C A;  1JNQ A;  1I0V A;  2P0X A;  2B24 B;  3K9M C;  3D5I A;  3OXA A;  1TU5 A;  3MYT A;  1VQL 3;  3B8L A;  1T3B A;  2LQV A;  1DVD A;  1UW1 A;  1I2F A;  1STF I;  2ML6 A;  1KC8 4;  1D6Y A;  3EE1 A;  4BU4 A;  1BSB A;  4XBY A;  1LVN A;  1I2E A;  1RJO A;  4XM4 A;  5IG3 A;  1PY3 A;  1RN7 A;  1BRI A;  2QIY A;  1MGW A;  4HM3 B;  4ZM8 A;  2RGQ A;  3JVC A;  1O7P B;  1X1W A;  3GZR A;  2F98 A;  3UB1 A;  3MG3 A;  1DE3 A;  2BT3 A;  3CCR 3;  1MOL A;  5TGN A;  1X1U A;  1DVC A;  1K41 A;  3RNT A;  2Z7A A;  2WGQ A;  3E99 A;  3GZY B;  4BTW A;  1ULJ B;  2CFW A;  3IMA B;  1AVK A;  1MGR A;  1RHL A;  3CC7 3;  2BO9 B;  1SII A;  5STD A;  1QVG 2;  1ZS7 A;  3NQY A;  5AYR B;  4EV2 A;  3DH2 A;  4O2H A;  1PU4 A;  3HIG A;  4RZM A;  3LT8 A;  3KSP A;  1CH0 A;  1UI7 A;  1U5O A;  3EJV A;  2HMN B;  2ZA4 A;  1YGE A;  2KAA A;  3OW2 2;  1U8C B;  3CNM A;  1RGH A;  1NB3 I;  1W6Y A;  1ROV A;  3WOE B;  5EQL A;  4N6V 0;  5JBS A;  1SQW A;  2P0M A;  2XSO B;  3ROB A;  2OOV C;  5IF6 A;  3FG1 A;  1LRA A;  4EYC A;  1BRS A;  1US1 A;  4NPB A;  1UGI A;  2GXF A;  1CYV A;  1IQ8 A;  2GSP A;  3D3L A;  3D79 A;  3HZP A;  4BTY A;  1A2P A;  3AMO B;  3D4A A;  3KKG A;  1VQM 3;  3DY5 A;  2R4I A;  2BMQ B;  5IG5 A;  3X3Z A;  1Z1S A;  4O02 B;  1LOX A;  1X1X A;  3K7C A;  4LMI A;  1HYF A;  5AIF A;  3BIR A;  3SXX A;  1SAR A;  1M1K 4;  2PZV A;  1VQ7 3;  3FF2 A;  1JBS A;  2XF3 A;  1W2Z A;  3EC9 A;  5FW5 A;  4K1U A;  5A0O B;  3AMO A;  3LOY A;  3KZT A;  4FMC A;  3T0U A;  1MWR A;  4CPK A;  5IEN A;  2SAR A;  3GZB A;  3LXU X;  3SOA A;  3J7Y d;  1A67 A;  2UUG C;  3ALA A;  2OOV A;  1VQ9 3;  2CWU A;  3SED A;  1WTH A;  3FLJ A;  1EQK A;  4HJL B;  4NHF A;  3GSP A;  3WA2 X;  1W2B 2;  3NM7 A;  1BOX A;  1BRH A;  1RDS A;  5HOH A;  1GMP A;  1UCJ A;  3G71 3;  1RGF A;  1MWS A;  5HGR A;  1LNI A;  5IW9 A;  1CQS A;  3VSY A;  1NJI 4;  3JUP A;  4HZ9 B;  1AVL A;  1TP6 A;  3LTA A;  3OX9 A;  1Q86 4;  1V74 A;  3LTD A;  7GSP A;  2RFR A;  1W4N A;  2CH9 A;  2OTJ 3;  5G1L A;  4HM8 B;  4KFD A;  2FGT A;  1YI2 3;  1N5P A;  1S5A A;  3N9H A;  4O8S A;  1FUS A;  3A76 A;  2CX1 A;  3MKI A;  1RGE A;  1IU7 A;  2Z6B A;  4EV5 A;  2ZL8 A;  1JZO A;  4HZB B;  2O3O A;  1M9G A;  3O8Y A;  4N6M A;  4EBG A;  3BU4 A;  3NBR A;  1LOY A;  3D9R A;  1WQL B;  2P38 A;  5CLK A;  2PNC A;  3FG3 A;  2RSX A;  3HOH A;  3WR2 A;  4EXR A;  1IT7 A;  1C7H A;  3MHE A;  3CCL 3;  4LSO A;  3LTB A;  4RNT A;  3F7X A;  3CCM 3;  1TTO A;  1W01 A;  2XEP A;  4QWT A;  4LYL B;  2GBW B;  1ROA A;  4JF8 A;  1FUW A;  7RNT A;  2A15 A;  1UDI I;  1GOY A;  1T5Y A;  1WNH A;  3DZL A;  5M1A A;  4ORL A;  3NUV A;  1CEW I;  1O7H B;  4FCJ A;  2KF6 A;  3MG1 A;  1RN4 A;  5IER A;  1N8R 4;  2J8X B;  5AI1 A;  1K28 A;  5AII A;  1V58 A;  4HM0 B;  3GRD A;  3G6E 3;  1IDP A;  2XRX B;  3H3H A;  3L0R A;  3CCS 3;  1Q7Y 4;  3CD6 3;  1BNE A;  1EA2 A;  5M19 A;  4OVM A;  3I56 3;  4U13 A;  3PCS A;  2CG1 A;  1JKG B;  4J5K A;  1QJG A;  3AGO A;  1LNH A;  5IG4 A;  1IK3 A;  4HM1 B;  1B20 A;  1M1X B;  1BNJ A;  4FCZ A;  4DKI A;  1HKX A;  1KSI A;  1YIJ 3;  3CC4 3;  3NBB A;  3CCE 3;  1BNI A;  1OHS A;  4J9A A;  1JKG A;  1STD A;  3D5G A;  3NX0 A;  1QAL A;  1WMO A;  4L8P A;  1W02 A;  2OQE C;  1YVS A; 
#chains in the Genus database with same CATH homology
 2WOH A;  4KFF A;  2OWP A;  1GD3 A;  2GU3 A;  2HMM B;  3F14 A;  3FGY A;  4RBN A;  3V98 A;  4CCV A;  1UI8 A;  7STD A;  5IG0 A;  1YJ9 3;  1DMN A;  5KP3 A;  2M7O A;  4WHA A;  3NBJ A;  3F9S A;  5IEO A;  1RKY A;  1OF5 B;  2P09 A;  1TFO A;  3S29 A;  2YFI B;  3I55 3;  4WFO A;  3Q90 A;  1JRQ A;  2OCT A;  2GEX A;  2C10 A;  3BNE A;  4HM7 B;  1JJ2 2;  1GD4 A;  1O7N B;  2YX9 A;  4XB5 A;  2OQE A;  5CK6 A;  3CXC 2;  1OF5 A;  4Q53 A;  1QVF 2;  3GZX B;  3UNL A;  4R1K A;  3RDE A;  1OAC A;  5JPP A;  1S72 3;  5CXO A;  1JB2 A;  3FSD A;  4TX4 A;  2CKF B;  2XSH B;  3EQQ B;  1IV7 A;  2Z77 A;  3GWR A;  4LZI A;  3EHC A;  1SPU A;  5ELJ A;  4IIA A;  2CFG A;  4HM6 B;  3FCS B;  4EC6 A;  3G16 A;  2GU1 A;  4XBX A;  4MJD A;  4HVN A;  4KFE A;  5CF2 A;  1FGT A;  3K0Z A;  3MWZ A;  5I97 A;  3F40 A;  3EB8 A;  1N9J A;  4H61 A;  1OH0 A;  1E97 A;  5D81 A;  1KWI A;  5CF1 A;  3BNC A;  1FGO A;  1L5G B;  3NXJ A;  1KD1 4;  3X3Y A;  3X41 A;  3PGB A;  4GB5 A;  1OGX A;  2QA4 3;  5AIG A;  1UUV B;  1AV4 A;  1ZX2 A;  2GEY A;  1TIJ A;  3EX9 A;  3CNX A;  2CFK A;  2FXT A;  3VGN A;  2CC3 A;  1VQO 3;  1YVB I;  1A2K A;  3TDG A;  3BND A;  2LYX A;  3JUM A;  4L7K A;  5AYS C;  2O9U X;  1GY6 A;  2MF7 A;  1J2B A;  1TFK A;  3UL6 A;  1R4C A;  3OV4 A;  3DMC A;  3H51 A;  3LML A;  3CPO A;  4X2H A;  4K90 B;  1OGZ A;  2QEX 3;  2D1W A;  3SLU A;  1FGR A;  2W9P A;  3N54 B;  3DXO A;  3F7S A;  3S5C A;  3WMD A;  1G96 A;  2BMO B;  1ISK A;  3QRD A;  2CIU A;  1IVV A;  4R80 A;  2INX A;  1VQN 3;  1OUN A;  4R9L A;  3JUQ A;  5KP1 A;  4CDL A;  1M90 4;  1AR0 A;  1HU9 A;  1NU3 A;  3ER7 A;  1FA3 A;  4FCM A;  1YJN 3;  4LEH A;  2JDI H;  1Q81 4;  4O3V A;  1NO3 A;  4HBR A;  1O7M B;  1BUQ A;  5DRV A;  3SOY A;  4OUQ A;  2V1L A;  1UUW B;  1JN5 B;  3PS8 A;  2GBX B;  2L4V A;  2XFT A;  4H3U A;  3PCR A;  1FGQ A;  2P05 A;  3V92 A;  2E2V A;  2B1X B;  1A90 A;  1GYB A;  3JUO A;  1N9E A;  3NM2 A;  3CU3 A;  3CCU 3;  3OWS A;  1GY7 A;  1JN5 A;  1K9M 4;  2KCD A;  1NB5 I;  1CYU A;  1F8N A;  1DMQ A;  2CFD A;  4STD A;  4KZ1 A;  4N6U A;  1Q42 A;  5JPU A;  3HX8 A;  3X42 A;  3CCJ 3;  2MC8 A;  3FG4 A;  1KQS 2;  2CG0 A;  1IQX A;  4NRE A;  2OTL 3;  2QGU A;  1IVW A;  2WOF A;  3PXM A;  3DM8 A;  4BTX A;  3OWU A;  4GL6 A;  2F86 B;  3CC2 3;  3HII A;  3CCV 3;  5D83 A;  2YFJ B;  2XGN A;  2KXG A;  2W56 B;  3DGO A;  4WYK A;  3IPT A;  2XFS A;  4AKY A;  2BMR B;  2HML B;  3F8X A;  2ML5 A;  1VQP 3;  2Q07 A;  1Q40 B;  3G4S 3;  4HYZ A;  4I4K A;  3WOF B;  4XDV A;  4HM4 B;  2W56 A;  3SX1 A;  3CPW 2;  1IV9 A;  3G8Z A;  4N3V A;  2CK3 H;  3ECF A;  5LC7 A;  4LGQ A;  2HMK B;  1FGM A;  3K5T A;  1Q40 A;  2RCD A;  3I0Y A;  1OPY A;  1RRH A;  1VZZ A;  2W0Q A;  3RGR A;  2E2U A;  4N6T A;  3U1W A;  4RNZ A;  2WO0 A;  2W9Q A;  3CMA 3;  1YJW 3;  1W5Z A;  3KN4 A;  1PFP A;  4N6O B;  4FMD A;  4IT7 A;  1OHO A;  3STD A;  3M8C A;  3NV0 B;  5EEO A;  1VQ6 3;  5ELU A;  3HK4 A;  3X40 A;  2KRT A;  1YHQ 3;  3HI7 A;  5G2G A;  5IEP A;  3IJE B;  3NHX A;  1QAF A;  3QK9 A;  1W6C A;  1VQ4 3;  1QMA A;  3NV0 A;  3UJM A;  2Y73 A;  1O7G B;  1WMN A;  3OWY A;  1NDO B;  3Q1C A;  2E2T A;  4N6N B;  3B4P A;  4XBT A;  4PEJ A;  3K63 A;  3GAX A;  3F8H A;  5D82 A;  4XDW A;  3VF1 A;  1RRL A;  1W00 A;  3BLZ A;  4K1V A;  2IUJ A;  5BXQ A;  1SIH A;  4R4K A;  2I9W A;  3UL5 A;  3EN1 B;  3X3X A;  3MSO A;  4AKZ A;  1EG9 B;  2W6J H;  3KFQ C;  3NQZ A;  3BB9 A;  1SJW A;  4MMY B;  4KVH A;  1MNL A;  3EBY A;  3MPH A;  3JUN A;  1VQK 3;  1ULI B;  1EKM A;  2CHC A;  4FMA A;  4IPB A;  3S28 A;  1OCV A;  1TUH A;  2C11 A;  4MEI A;  5FGO A;  4HKV B;  1N5H A;  1ZO2 A;  1LXE A;  3LYG A;  3FH1 A;  3LT9 A;  2IMJ A;  3U97 A;  2STD A;  2YFL B;  3LH4 A;  4FR9 A;  2W03 A;  3MG2 A;  2CFL A;  1JB5 A;  3FKA A;  2W04 A;  4J8T A;  1JB4 A;  8CHO A;  1YIT 3;  1DYU A;  1IT8 A;  1JV2 B;  1E3V A;  1K73 4;  3DGL A;  2ZDJ A;  3EF8 A;  5EVH A;  1VQ5 3;  3CME 3;  1O7W B;  2BHM A;  1IVU A;  3T8N A;  4X2O A;  2CWV A;  2HMO B;  3LZA A;  3B4O A;  3KII A;  3BNB A;  2F99 A;  2XH9 A;  3EN8 A;  4HM2 B;  3WA3 A;  4WWU C;  3KE7 A;  3DGN A;  1E3R A;  4N6L A;  1WMP A;  2IUK A;  4OK0 A;  4K61 A;  3FF0 A;  3S27 A;  1Y4K A;  3N8B A;  5LC6 A;  3Q2P A;  1A2V A;  3RGA A;  3WOD G;  2CWT A;  3DGM A;  4MMX B;  5AEU B;  3CCQ 3;  2UX0 A;  3LTC A;  5AIH A;  1IVX A;  1W7C A;  2IA7 A;  1OHP A;  4AEQ A;  3S67 A;  4RNY A;  4WYK B;  2FNQ A;  3PZW A;  3B7C A;  1N8Q A;  2WGO A;  2Z76 A;  3WDG B;  2XGL A;  1D6U A;  4R9K A;  2XR8 B;  1QAK A;  3SVA A;  3PYJ A;  1ASK A;  1DMM A;  1D6Z A;  3KSE D;  1IQY A;  4HM5 B;  2K0M A;  5DRE A;  3T8U A;  4MMZ B;  1VQ8 3;  5BVB A;  4G1M B;  1GS3 A;  2JQ5 A;  2K54 A;  4FMB A;  1GY5 A;  4JRF A;  1NWW A;  6STD A;  5KP4 A;  3EBT A;  2CW9 A;  1W6G A;  3FZW A;  1Q82 4;  3G0K A;  3V99 A;  5AEW B;  4L8O A;  2SBL A;  2HMJ B;  2BNG A;  4WP5 A;  2D42 A;  3DUK A;  2Y74 A;  1K8A 4;  2W2C A;  1JNQ A;  2P0X A;  2B24 B;  3K9M C;  3OXA A;  1TU5 A;  3MYT A;  1VQL 3;  3B8L A;  2LQV A;  1DVD A;  1UW1 A;  1STF I;  2ML6 A;  1KC8 4;  1D6Y A;  3EE1 A;  4XBY A;  1LVN A;  1RJO A;  4XM4 A;  5IG3 A;  1RN7 A;  2QIY A;  4HM3 B;  4ZM8 A;  2RGQ A;  3JVC A;  1O7P B;  3GZR A;  3UB1 A;  2F98 A;  3MG3 A;  2BT3 A;  3CCR 3;  1MOL A;  5TGN A;  1DVC A;  1K41 A;  2Z7A A;  2WGQ A;  3E99 A;  3GZY B;  4BTW A;  1ULJ B;  2CFW A;  3IMA B;  1AVK A;  3CC7 3;  1QVG 2;  2BO9 B;  1SII A;  5STD A;  3NQY A;  5AYR B;  4EV2 A;  4O2H A;  1PU4 A;  3HIG A;  4RZM A;  3LT8 A;  3KSP A;  1UI7 A;  1U5O A;  3EJV A;  2HMN B;  1YGE A;  3OW2 2;  1U8C B;  3CNM A;  1W6Y A;  1NB3 I;  1ROV A;  3WOE B;  5EQL A;  4N6V 0;  5JBS A;  1SQW A;  2P0M A;  2XSO B;  3ROB A;  2OOV C;  5IF6 A;  3FG1 A;  4EYC A;  1US1 A;  2GXF A;  1CYV A;  1IQ8 A;  3D3L A;  3HZP A;  4BTY A;  3AMO B;  3KKG A;  1VQM 3;  3DY5 A;  2R4I A;  2BMQ B;  5IG5 A;  3X3Z A;  1Z1S A;  4O02 B;  1LOX A;  3K7C A;  4LMI A;  5AIF A;  3SXX A;  1M1K 4;  2PZV A;  1VQ7 3;  3FF2 A;  2XF3 A;  1W2Z A;  3EC9 A;  5FW5 A;  4K1U A;  5A0O B;  3AMO A;  3LOY A;  3KZT A;  4FMC A;  3T0U A;  5IEN A;  3GZB A;  3LXU X;  3SOA A;  3J7Y d;  1A67 A;  3ALA A;  2OOV A;  1VQ9 3;  2CWU A;  3SED A;  1WTH A;  3FLJ A;  1EQK A;  4HJL B;  4NHF A;  3WA2 X;  1W2B 2;  3NM7 A;  3G71 3;  5HGR A;  5IW9 A;  1CQS A;  3VSY A;  1NJI 4;  3JUP A;  4HZ9 B;  1AVL A;  1TP6 A;  3LTA A;  3OX9 A;  1Q86 4;  1V74 A;  3LTD A;  2RFR A;  1W4N A;  2CH9 A;  2OTJ 3;  4HM8 B;  4KFD A;  2FGT A;  1YI2 3;  1N5P A;  1S5A A;  3N9H A;  4O8S A;  3A76 A;  3MKI A;  1IU7 A;  2Z6B A;  4EV5 A;  2ZL8 A;  4HZB B;  2O3O A;  1M9G A;  3O8Y A;  4N6M A;  4EBG A;  3NBR A;  3D9R A;  1WQL B;  2P38 A;  5CLK A;  2PNC A;  3FG3 A;  2RSX A;  4EXR A;  3CCL 3;  1IT7 A;  1C7H A;  3MHE A;  4LSO A;  3LTB A;  3F7X A;  3CCM 3;  1W01 A;  2XEP A;  4QWT A;  2GBW B;  1ROA A;  4JF8 A;  1FUW A;  2A15 A;  1T5Y A;  1WNH A;  3DZL A;  4ORL A;  3NUV A;  1CEW I;  1O7H B;  4FCJ A;  3MG1 A;  5IER A;  1N8R 4;  5AI1 A;  1K28 A;  5AII A;  4HM0 B;  3GRD A;  3G6E 3;  1IDP A;  2XRX B;  3H3H A;  3L0R A;  3CCS 3;  1Q7Y 4;  3CD6 3;  1EA2 A;  3I56 3;  4OVM A;  4U13 A;  3PCS A;  2CG1 A;  1JKG B;  1QJG A;  1LNH A;  5IG4 A;  1IK3 A;  4HM1 B;  1M1X B;  4FCZ A;  1YIJ 3;  1HKX A;  1KSI A;  3CC4 3;  3NBB A;  3CCE 3;  1OHS A;  4J9A A;  1JKG A;  1STD A;  3NX0 A;  1QAL A;  1WMO A;  4L8P A;  1W02 A;  2OQE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...