4GB5A

Crystal structure of kfla4162 protein from kribbella flavida
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
DAETDRAEIIELFGRYADIADLKEFTDLPRRVHTDPLTIDFESVTGMPPMTVPLSDYGAALRASFGAFSATHHAITGHVVTIDSDRATIHAHVRAEHWLPAEVAGDGPDRWLVVGFYDNEAVRTADGWRLSSVKLTASYQENAHLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Kfla4162 protein from Kribbella flavida (CASP Target)
rcsb
source organism Kribbella flavida
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gb5A00
3F8HA 3GZYB 1NWWA 1JN5B 1E3RA 1EG9B 1O7WB 2Z7AA 1O7MB 2XR8B 3DUKA 3EBTA 1JB5A 3FH1A 3KZTA 2XSHB 3OX9A 4LMIA 1UUVB 4MJDA 4R9LA 4XDVA 5IEOA 3RGRA 3RGAA 3WMDA 3KKGA 3JUPA 3CU3A 3F14A 2W2CA 2XSOB 1JN5A 1GY6A 1ZX2A 2R4IA 3F40A 3NXJA 5CLKA 1VZZA 3E99A 4HM3B 7STDA 5IF6A 1CQSA 1OF5A 1OGXA 2K54A 3IPTA 5TGNA 4HM6B 3D9RA 3OWYA 2Z77A 4WYKA 4XBXA 1GYBA 3FF0A 1A2KA 3K0ZA 4FCJA 1Z1SA 2YFJB 4WWUC 3GRDA 5DREA 3K7CA 4XB5A 1TP6A 1GY7A 1WQLB 2YFIB 3B8LA 3ER7A 2CHCA 4L7KA 4L8PA 3GZRA 3OWUA 4K1UA 1C7HA 4HVNA 4N3VA 2JQ5A 5KP3A 4CDLA 3T8NA 5D83A 1DMMA 1QMAA 1AR0A 3EF8A 1GS3A 4HM8B 4XM4A 5IG4A 3LZAA 3H3HA 2GBWB 3S5CA 3UJMA 4HM1B 3DZLA 1UUWB 4OUQA 5IERA 1HKXA 4K1VA 1DMQA 2YFLB 5IG3A 2QGUA 3OWSA 3KSPA 4STDA 3OV4A 2HMNB 1S5AA 1Q40A 4IIAA 4RZMA 2HMOB 4HM4B 1W01A 1JB4A 3F9SA 2B1XB 2GEYA 3HX8A 4I4KA 5BVBA 1Q40B 1OH0A 3EJVA 4PEJA 3NHXA 1OPYA 1OUNA 4R1KA 3MG3A 4XBTA 1K41A 1U5OA 4XBYA 1ISKA 2RCDA 3ECFA 4HZ9B 5KP1A 3GWRA 1DMNA 2OWPA 1JKGB 4HM7B 3FF2A 3MKIA 3GZXB 3F7XA 1TUHA 2BMRB 3B4OA 3DXOA 1IDPA 1ULJB 4HKVB 5AIFA 3SOYA 2F86B 5AIGA 5DRVA 1OHSA 3EN8A 3JUQA 1ULIB 2B24B 3VGNA 1STDA 4X2OA 3UNLA 5JPPA 3G0KA 3FZWA 4J9AA 4Q53A 4XDWA 1GY5A 1W6YA 2F99A 3BB9A 5HGRA 3STDA 2BNGA 5IENA 1O7HB 3NV0A 4X2HA 3FLJA 4L8OA 8CHOA 4ORLA 1NU3A 1QJGA 2GEXA 2XRXB 3F7SA 1ZO2A 5AEUB 3G8ZA 1OF5B 4WP5A 6STDA 2Z76A 3EHCA 3NM2A 4U13A 3T8UA 3NBRA 3EN1B 2INXA 1W00A 5D81A 5D82A 3B4PA 2RFRA 3H51A 4R9KA 3EC9A 1JKGA 3Q90A 3M8CA 2A15A 2QIYA 3A76A 4FCMA 4J8TA 5STDA 3SOAA 5BXQA 5IEPA 3FKAA 1BUQA 3EX9A 1W02A 4LGQA 3DMCA 3F8XA 4HJLB 3JUMA 3KE7A 5CK6A 1O7GB 3EBYA 5KP4A 3GZBA 3NUVA 3LYGA 2I9WA 2PZVA 1JB2A 2RGQA 3OXAA 3FSDA 3JUNA 5CXOA 1OHPA 1OHOA 3EQQB 1SJWA 3MG1A 2CKFB 3I0YA 1Q42A 1NDOB 3MHEA 3MG2A 3MSOA 4KVHA 2STDA 3MYTA 4H3UA 3JUOA 4HM2B 3ROBA 2BMQB 5AIIA 3B7CA 5AEWB 5AI1A 4WYKB 1E3VA 5EVHA 4GB5A 1O7NB 2UX0A 1O7PB 5G2GA 1OCVA 4HM0B 3BLZA 2IMJA 1EA2A 3HZPA 4LEHA 5IG0A 2HMMB 3CNMA 4OVMA 5CF2A 5AIHA 5JPUA 3G16A 3CPOA 1OGZA 3CNXA 4HZBB 3NV0B 2GBXB 2GXFA 2HMLB 3DM8A 4HM5B 1E97A 1ASKA 3FGYA 3VSYA 5CF1A 5IG5A 5FW5A 3HK4A 3SEDA 2F98A 2BMOB 2HMJB 2HMKB
chains in the Genus database with same CATH superfamily
3GZYB 1BSDA 1EG9B 1O7WB 3DUKA 3KZTA 3AHWA 1BIRA 1EQKA 3OX9A 4XDVA 1M9GA 3WMDA 1UUVB 1W6GA 4O2HA 1K8A4 3F14A 3NXJA 1GY6A 1N9EA 1FUWA 1RGEA 1BNEA 1JZDA 3D79A 3N54B 3WA3A 3OWYA 1A2PA 1BRGA 3LTBA 2KAAA 1Z1SA 4WWUC 1MWTA 3GRDA 3Q3FA 2W56A 3NQZA 2YFIB 3ER7A 4JRFA 1YHQ3 2FNQA 4L7KA 4L8PA 3GZRA 3KCHA 4K1UA 1AVKA 1OACA 1JZOA 1YNVX 1I3FA 2JQ5A 2IY2A 4AKZA 2MC8A 2KCDA 1FGMA 4EC6A 3AMOB 1WMNA 1GS3A 4N6NB 1JV2B 3LZAA 3UJMA 3I563 2IUKA 1UUWB 2R41A 1HKXA 1LNIA 1T5YA 2CX0A 5IG3A 1HZ1A 2QGUA 2HMNB 4R80A 1PY3A 2CFLA 1DVDA 4RZMA 1BNRA 1LRAA 1MWUA 2OCTA 1JB4A 4BIRA 1UCJA 2WOHA 5BVBA 3QRDA 4PEJA 3MG3A 4XBTA 1ISKA 1CH0A 3X3YA 1BRHA 1IT7A 3MKIA 2D1WA 1W2B2 1I2FA 1W6CA 3IMAB 1RGHA 1ULJB 3K5TA 2CFKA 1YJN3 1BRSA 1OHSA 3JVCA 3JUQA 2M7OA 3LT8A 2AADA 3LTAA 3LTDA 5EQLA 1BANA 3HOHA 1IYYA 3AGNA 4Q53A 2E2TA 4WFOA 2XF3A 3HIGA 1Q7Y4 1W6YA 5IENA 4X2HA 3NV0A 5I97A 3FLJA 1T3BA 3FG1A 1LNHA 4L8OA 2P38A 1LOVA 1I0VA 4JF8A 2XRXB 1DVCA 5AEUB 1RN1A 3FG4A 4WP5A 3WA2X 4BTXA 5BIRA 3EHCA 6STDA 1DYUA 4BL3A 1AVLA 5LC7A 2CWUA 4BU4A 3H51A 3BIRA 3EC9A 1BU4A 2QIYA 6GSPA 2JDIH 5BXQA 3OW22 1Q814 2CH9A 2OOVA 3KSED 1W02A 1US1A 3G713 3EB8A 3JUMA 3KE7A 1RGLA 3NM7A 5CK6A 1X1WA 1EEJA 3GZBA 3URPA 2RGQA 1JBTA 1LQGC 3JUNA 1OHOA 3T8UA 1YGWA 2CKFB 3I0YA 1Q42A 4KFFA 2IYJA 2W03A 4KVHA 4EV2A 4H3UA 3K9MC 2XFSA 3B7CA 1FGQA 5AI1A 3S29A 5EVHA 4EXRA 1MNLA 2UX0A 1I2GA 1FGRA 2H0IA 3GSPA 4CDLA 5IG0A 1BSCA 1MGWA 5A0OB 5AIHA 3G16A 1FZUA 4HZBB 1OGZA 1WNHA 2KRTA 2GBXB 2HMLB 4FMBA 5CF1A 3LOYA 3SEDA 4GSPA 2BMOB 2CWTA 2HMJB 1VQ73 3F8HA 2K3DA 1JN5B 1E3RA 1TIJA 1ZGXA 2Z7AA 1CYUA 1CYVA 5G2GA 2F5WA 4NREA 1TU5A 1BGSA 5IEOA 3RGRA 3RGAA 3BNEA 3CU3A 1BAOA 1JN5A 2KF3A 1Y4KA 3VF1A 1NB3I 1QALA 4HM3B 1RNBA 1CQSA 1OGXA 1RTUA 2K54A 3AHSA 5TGNA 1FYSA 2CW9A 1VQQA 4FCJA 1BSAA 5AYRB 1MOLA 2YFJB 1KC84 5DREA 1SIIA 3K7CA 4XB5A 3PXMA 1WQLB 1B20A 2CHCA 5KP3A 1SQWA 4N3VA 3D5GA 3WHOA 4J5GA 2P09A 1FUTA 4H61A 2MF7A 3S67A 1QMAA 1IK3A 1N8R4 2OTJ3 4HM8B 2HOHA 4RNZA 3DZLA 1L5GB 1NB5I 2XFTA 3RDEA 3OWSA 3KSPA 1ZS7A 3CC73 5M19A 1GD3A 1K734 1S5AA 2RSXA 1QVF2 1EKMA 2WGOA 2Y73A 1BSBA 2SBLA 4RBNA 3ZG5A 1GOUA 5G1KA 1TFOA 1W01A 4HAAA 1W5ZA 3F9SA 2B1XB 2J8XB 1B2MA 1G96A 4N6OB 1OPYA 1OUNA 1BOXA 3NX0A 4KFDA 4R1KA 3X42A 3NBJA 1VQK3 1FW7A 2GSPA 2XEPA 2BHMA 4HZ9B 1DMNA 3UB1A 1JKGB 3FF2A 4O3VA 4EV5A 3B4OA 3WDGB 5AYSC 1GD4A 1UCLA 2F86B 5AIGA 5DRVA 1I2EA 1BVIA 1NO3A 1PU4A 2IA7A 3VGNA 1STDA 2ML6A 3N8BA 3UNLA 3G0KA 5JPPA 4XDWA 1RGAA 2P0MA 1GY5A 2WO0A 3BB9A 3V92A 2W56B 5HGRA 1YIT3 1O7HB 4BTWA 3D3LA 4N6TA 8CHOA 1HU9A 1QJGA 3HI7A 2W6JH 1C54A 1FGTA 3D4AA 1ZO2A 2Q07A 3CCQ3 1BRIA 4NHFA 1UDII 1BNFA 2O3OA 3D5IA 4MMXB 4RNTA 2QEX3 1VQ43 1NNVA 2KF5A 2OOVC 4R9KA 3X3ZA 5STDA 3Q90A 4AKYA 3CCL3 9RNTA 1RHLA 1RNTA 1X1XA 2F4YA 3DMCA 1STFI 1I0XA 1UI7A 5GSPA 4FMCA 4EYCA 1D6YA 2RBIA 2F5MA 2I9WA 1DETA 2V1LA 2UUGC 1M1XB 1IVUA 2XH9A 1SJWA 2Z6BA 1JNQA 3MG1A 3MSOA 1NDOB 1BRNL 3MG2A 5RNTA 1RSNA 2BT3A 1B21A 3JUOA 1PFPA 1VQ63 1GMPA 1E3VA 3CD63 1O7NB 1JBSA 1B3SA 3LT9A 3HZPA 2IMJA 1EA2A 4LSOA 1UCKA 3UL6A 3CNMA 3U1WA 2OQEA 1K9M4 3CCE3 1MGRA 3NV0B 2GXFA 3DM8A 3VSYA 4DKIA 1E97A 1A2VA 3WOFB 2F98A 4X2OA 3STDA 2E2UA 3EBTA 1O7MB 2XR8B 2ZA4A 3CCM3 1JB5A 2YX9A 3FH1A 2XSHB 4LMIA 5M1AA 4R9LA 1BNIA 3KKGA 3JUPA 1BNJA 3BU4A 2XSOB 3F40A 1ZX2A 5HOHA 1KD14 1VZZA 5IF6A 1IV9A 1V74A 1RJOA 4HM6B 1I70A 1T2IA 3D9RA 3FG3A 1X1UA 4O02B 4XBXA 3FF0A 1A2KA 3K0ZA 2ZDJA 4TX4A 3CCV3 1YI23 1RCKA 1AV4A 2BO9B 1VQ83 3DGNA 3K63A 4QWTA 1GY7A 4XM4A 2SARA 3OWUA 2OQEC 2CG1A 3BNCA 1IQXA 3T8NA 3U97A 1DMMA 1VQL3 3EF8A 1BRKA 5IG4A 1UGIA 1IQ8A 1GOYA 1RN4A 1ROAA 2GBWB 3H3HA 4HM1B 3AGOA 2P0XA 1B2ZA 4OUQA 3S5CA 3V98A 4RNYA 2IUJA 3CXC2 4K1VA 1DMQA 3KIIA 1B2XA 2CWVA 3MPHA 3DGYA 1N5PA 3PYJA 2CFGA 4STDA 3S28A 4J5KA 1Q40A 1I3IA 1RCLA 2KXGA 3WODG 2F56A 2Y74A 1T2HA 2GEYA 4I4KA 1F8NA 2XGLA 1D6ZA 1OH0A 2ZL8A 4LYLB 2H0GA 1RRHA 1WMOA 2O9UX 1R4CA 2PNCA 3NHXA 1RDSA 1K41A 1U5OA 3CCS3 2RCDA 5KP1A 1FA3A 3DGOA 3GWRA 1BRJA 1D6UA 1W2ZA 2OWPA 3CCR3 3GZXB 4ILFA 3SXXA 1A90A 1TUHA 1QVG2 2BMRB 5AIFA 3QK9A 1IDPA 1S723 1TTOA 3SOYA 1N9JA 2XGNA 1M904 1ULIB 2QA43 3ALAA 1VQO3 3LMLA 2K0MA 1TFKA 3LH4A 1RGKA 1R4YA 3Q1CA 4ORLA 1NU3A 2GEXA 2C10A 2ML5A 4OK0A 1IU7A 3F7SA 1I8VA 4K61A 4GHOA 3O8YA 1OF5B 1TRPA 4HBRA 3NM2A 1YVBI 3NBRA 3EN1B 2INXA 1W00A 4FMAA 5D82A 5ELUA 3LXUX 1QAKA 1J2BA 4KT3B 3M8CA 2A15A 3DGMA 4N6LA 1LXEA 2FGTA 1YVSA 1KWIA 1Q9EA 4LGQA 1WMPA 3KN4A 1TJDA 3F8XA 4HYZA 4IPBA 4HJLB 2H0HA 1RMSA 2WOFA 5KP4A 1Q7HA 3PGBA 3SLUA 2PZVA 3OXAA 5CXOA 4KZ1A 5EEOA 1BNSA 2L4VA 4CCVA 1IVWA 1UI8A 2STDA 1V57A 2BU4A 2UGIA 1KSIA 1WTHA 2BMQB 1B27A 3MYTA 4FCZA 1BUJA 5LC6A 1O7PB 3AMOA 2CG0A 4HM0B 4LEHA 3BLZA 3KFQC 3X40A 5CF2A 3CCU3 1G0TA 2HMMB 3G6E3 1M1K4 2W9PA 5JPUA 2GU1A 1YJW3 3EE1A 1BSEA 2AAEA 3CNXA 1U8CB 4WHAA 3WOEB 1MWRA 1ASKA 1UCIA 4EBGA 2C11A 2LQVA 5FW5A 2CFDA 1IQYA 1CEWI 2ZHXB 1SIHA 3MWZA 2L1SA 2HMKB 1NWWA 3A5EA 4IT7A 4CJNA 1BUQA 4MJDA 1IV7A 1ROVA 2WGQA 3S27A 1Q824 2W2CA 1SPUA 5CLKA 2P05A 2R4IA 7STDA 3E99A 3CC23 1LOWA 1OF5A 3BNDA 1W7CA 3IPTA 1UUGB 4WYKA 3HIIA 2Z77A 3SX1A 1GYBA 1W4NA 3G4S3 4CPKA 1YGEA 3WR2A 1LVNA 2CC3A 1TP6A 4AEQA 5ELJA 1DE3A 3B8LA 1B2SA 4N6V0 1C7HA 4HVNA 4MMZB 4HOHA 3DGLA 1UGHI 3RNTA 5D83A 5G1LA 1Q864 1AR0A 2KF6A 2GU3A 2W9QA 4EW5A 3DH2A 4ZM8A 5IERA 2LYXA 4FR9A 3TDGA 3X41A 4K90B 3PZWA 2YFLB 7RNTA 1IVVA 2CFWA 4BL2A 1JJ22 3OV4A 1MWSA 4IIAA 3CME3 2HMOB 1LOYA 7GSPA 1EUIC 5FGOA 4HM4B 1GMRA 3I553 1JRQA 6RNTA 3HX8A 1Q40B 3EJVA 3N9HA 5M18A 4I5QA 3ZG0A 4XBYA 2RNTA 1V58A 3CPW2 3ECFA 2W04A 4HM7B 1G02A 3J7Yd 1RGGA 3F7XA 1VQP3 2FXTA 3DXOA 1LQMB 4HKVB 2KF4A 1VQM3 3CC43 1UW1A 3EN8A 4FMDA 2B24B 1RGFA 3Q2PA 1VQ53 2E2VA 1B2UA 3FZWA 4J9AA 3ZFZA 1FGOA 8RNTA 4NPBA 4GL6A 4MMYB 1VQN3 2F99A 1RN7A 2BNGA 2CX1A 4N6MA 5JBSA 1RKYA 3FCSB 2OTL3 4G1MB 3G8ZA 3NQYA 3PS8A 2Z76A 3X3XA 4U13A 3BNBA 4N6UA 3V99A 2BIRA 5D81A 3B4PA 3GAXA 1N8QA 2RFRA 1YIJ3 1AY7A 1JKGA 1K28A 3IJEB 3A76A 4FCMA 4J8TA 3SOAA 5IEPA 2W0QA 1NJI4 1VQ93 3FKAA 4MEIA 1A67A 3EX9A 3ROBA 1TRQA 4BTYA 1JBRA 3NBBA 1IT8A 3PCRA 1GMQA 1O7GB 2CIUA 3EBYA 3NUVA 3LYGA 2D42A 1JB2A 3FSDA 1OHPA 3EQQB 1LOXA 3MHEA 1HYFA 4O8SA 1BNGA 1PYLA 4HM2B 5AIIA 3T0UA 5AEWB 3CCJ3 4WYKB 1IVXA 3L0RA 4LZIA 4GB5A 1GSPA 5BU4A 1N5HA 1RLSA 1X1YA 3LTCA 1GOVA 1OCVA 5IW9A 1YJ93 1KQS2 2CK3H 3CMA3 4OVMA 2C4BA 3DY5A 3CPOA 1SARA 4KFEA 4HM5B 1RRLA 3FGYA 3UL5A 4R4KA 1QAFA 1RGCA 5IG5A 3HK4A 3SYUA 1AQZA 1FUSA 3PCSA 3SVAA
chains in the Genus database with same CATH topology
3GZYB 1EG9B 1O7WB 3DUKA 3KZTA 1EQKA 3OX9A 4XDVA 1M9GA 3WMDA 1UUVB 1W6GA 4O2HA 1K8A4 3F14A 3NXJA 1GY6A 1N9EA 1FUWA 3N54B 3WA3A 3OWYA 3LTBA 1Z1SA 4WWUC 3GRDA 2W56A 3NQZA 2YFIB 3ER7A 4JRFA 1YHQ3 2FNQA 4L7KA 4L8PA 3GZRA 4K1UA 1AVKA 1OACA 2JQ5A 4AKZA 2MC8A 2KCDA 1FGMA 4EC6A 3AMOB 1WMNA 1GS3A 4N6NB 1JV2B 3LZAA 3UJMA 3I563 2IUKA 1UUWB 1HKXA 1T5YA 5IG3A 2QGUA 2HMNB 4R80A 2CFLA 1DVDA 4RZMA 2OCTA 1JB4A 2WOHA 5BVBA 3QRDA 4PEJA 3MG3A 4XBTA 1ISKA 3X3YA 1IT7A 3MKIA 2D1WA 1W2B2 1W6CA 3IMAB 1ULJB 3K5TA 2CFKA 1YJN3 1OHSA 3JVCA 3JUQA 2M7OA 3LT8A 3LTAA 3LTDA 5EQLA 4Q53A 4WFOA 2E2TA 2XF3A 3HIGA 1Q7Y4 1W6YA 5IENA 4X2HA 3NV0A 5I97A 3FLJA 3FG1A 4L8OA 1LNHA 2P38A 4JF8A 2XRXB 1DVCA 5AEUB 3WA2X 3FG4A 4WP5A 4BTXA 6STDA 3EHCA 1DYUA 1AVLA 5LC7A 2CWUA 3H51A 3EC9A 2QIYA 2JDIH 5BXQA 3OW22 1Q814 2CH9A 2OOVA 3KSED 1W02A 1US1A 3G713 3EB8A 3JUMA 3KE7A 3NM7A 5CK6A 3GZBA 2RGQA 3JUNA 1OHOA 3T8UA 2CKFB 3I0YA 1Q42A 4KFFA 2W03A 4KVHA 4EV2A 4H3UA 3K9MC 2XFSA 3B7CA 1FGQA 5AI1A 3S29A 5EVHA 4EXRA 1MNLA 2UX0A 1FGRA 4CDLA 5IG0A 5A0OB 5AIHA 3G16A 4HZBB 1OGZA 1WNHA 2KRTA 2GBXB 2HMLB 4FMBA 5CF1A 3LOYA 3SEDA 2BMOB 2CWTA 2HMJB 1VQ73 3F8HA 1JN5B 1E3RA 1TIJA 1CYUA 2Z7AA 1CYVA 5G2GA 4NREA 1TU5A 3RGRA 5IEOA 3RGAA 3BNEA 3CU3A 1JN5A 1Y4KA 3VF1A 1NB3I 1QALA 4HM3B 1CQSA 1OGXA 2K54A 5TGNA 2CW9A 4FCJA 5AYRB 1MOLA 2YFJB 1KC84 5DREA 1SIIA 3K7CA 4XB5A 3PXMA 1WQLB 2CHCA 5KP3A 1SQWA 4N3VA 2P09A 4H61A 2MF7A 3S67A 1QMAA 1IK3A 1N8R4 2OTJ3 4HM8B 4RNZA 3DZLA 1L5GB 1NB5I 2XFTA 3RDEA 3OWSA 3KSPA 3CC73 1GD3A 1K734 1S5AA 2RSXA 1QVF2 1EKMA 2WGOA 2Y73A 2SBLA 4RBNA 1TFOA 1W01A 1W5ZA 3F9SA 2B1XB 1G96A 4N6OB 1OPYA 1OUNA 3NX0A 4KFDA 4R1KA 3X42A 3NBJA 1VQK3 4HZ9B 2XEPA 2BHMA 3UB1A 1DMNA 1JKGB 3FF2A 4O3VA 4EV5A 3B4OA 3WDGB 5AYSC 1GD4A 2F86B 5AIGA 5DRVA 1NO3A 1PU4A 2IA7A 3VGNA 1STDA 2ML6A 3N8BA 3UNLA 3G0KA 5JPPA 4XDWA 2P0MA 1GY5A 2WO0A 3BB9A 3V92A 2W56B 5HGRA 1YIT3 1O7HB 4BTWA 3D3LA 4N6TA 8CHOA 1HU9A 1QJGA 3HI7A 2W6JH 1FGTA 1ZO2A 2Q07A 3CCQ3 4NHFA 2O3OA 4MMXB 2QEX3 1VQ43 2OOVC 3X3ZA 4R9KA 5STDA 3Q90A 4AKYA 3CCL3 3DMCA 1STFI 1UI7A 4FMCA 4EYCA 1D6YA 2I9WA 2V1LA 2Z6BA 2XH9A 1M1XB 1IVUA 1SJWA 3MG1A 1JNQA 3MSOA 1NDOB 3MG2A 2BT3A 3JUOA 1PFPA 1VQ63 1E3VA 3CD63 1O7NB 3LT9A 3HZPA 2IMJA 1EA2A 4LSOA 3UL6A 3CNMA 3U1WA 1K9M4 3CCE3 3NV0B 2GXFA 3DM8A 3VSYA 1E97A 1A2VA 3WOFB 2F98A 4X2OA 3STDA 2E2UA 3EBTA 1O7MB 2XR8B 1YIJ3 3CCM3 1JB5A 2YX9A 3FH1A 2XSHB 4LMIA 4R9LA 3KKGA 3JUPA 2XSOB 3F40A 1ZX2A 1KD14 1VZZA 5IF6A 1IV9A 1V74A 1RJOA 4HM6B 3D9RA 3FG3A 4O02B 4XBXA 3FF0A 1A2KA 3K0ZA 2ZDJA 4TX4A 3CCV3 1YI23 1AV4A 2BO9B 1VQ83 3DGNA 3K63A 4QWTA 1GY7A 4XM4A 3OWUA 2OQEC 2CG1A 3BNCA 1IQXA 3T8NA 3U97A 1DMMA 1VQL3 3EF8A 5IG4A 2OQEA 1IQ8A 1ROAA 3H3HA 2GBWB 3S5CA 3V98A 4HM1B 3CXC2 2P0XA 4OUQA 4RNYA 2IUJA 4K1VA 1DMQA 3KIIA 3MPHA 2CWVA 1N5PA 3PYJA 2CFGA 4STDA 3S28A 1Q40A 2KXGA 3WODG 2Y74A 2GEYA 4I4KA 1F8NA 2XGLA 1D6ZA 1OH0A 2ZL8A 3NHXA 1RRHA 1WMOA 2O9UX 1R4CA 2PNCA 1K41A 1U5OA 3CCS3 2RCDA 5KP1A 1FA3A 3DGOA 3GWRA 2OWPA 1D6UA 1W2ZA 3CCR3 3GZXB 3SXXA 1A90A 1TUHA 1QVG2 2BMRB 5AIFA 3QK9A 1IDPA 1S723 3SOYA 1N9JA 2XGNA 1M904 1ULIB 2QA43 3ALAA 1VQO3 3LMLA 2K0MA 1TFKA 3LH4A 3Q1CA 4ORLA 1NU3A 2GEXA 2C10A 2ML5A 4OK0A 1IU7A 3F7SA 4K61A 3O8YA 1OF5B 4HBRA 3NM2A 1YVBI 3NBRA 3EN1B 2INXA 1W00A 4FMAA 5D82A 5ELUA 3LXUX 1QAKA 1J2BA 3M8CA 2A15A 3DGMA 4N6LA 1LXEA 2FGTA 1KWIA 4LGQA 1WMPA 3KN4A 3F8XA 4HYZA 4IPBA 4HJLB 2WOFA 5KP4A 3PGBA 3SLUA 2PZVA 3OXAA 5CXOA 4KZ1A 5EEOA 2L4VA 4CCVA 1IVWA 1UI8A 2STDA 3MYTA 4FCZA 3ROBA 1KSIA 1WTHA 2BMQB 2OTL3 5LC6A 1O7PB 3AMOA 2CG0A 4HM0B 4LEHA 3BLZA 3KFQC 3X40A 5CF2A 3CCU3 3G6E3 2HMMB 1M1K4 2W9PA 5JPUA 2GU1A 1YJW3 3EE1A 3CNXA 1U8CB 4WHAA 3WOEB 4EBGA 1ASKA 2C11A 2LQVA 5FW5A 2CFDA 1IQYA 1CEWI 1SIHA 3MWZA 2HMKB 1NWWA 4IT7A 1BUQA 4MJDA 1IV7A 1ROVA 2WGQA 3S27A 1Q824 2W2CA 1SPUA 5CLKA 2P05A 2R4IA 7STDA 3E99A 3CC23 1OF5A 3BNDA 3IPTA 1W7CA 4WYKA 3HIIA 2Z77A 3SX1A 1GYBA 1W4NA 3G4S3 1YGEA 1LVNA 2CC3A 1TP6A 4AEQA 5ELJA 3B8LA 4N6V0 1C7HA 4HVNA 4MMZB 3DGLA 5D83A 1Q864 1AR0A 2GU3A 2W9QA 4ZM8A 5IERA 2LYXA 4FR9A 3TDGA 3X41A 4K90B 3PZWA 2YFLB 1IVVA 2CFWA 1JJ22 3OV4A 4IIAA 3CME3 2HMOB 5FGOA 4HM4B 3I553 1JRQA 3HX8A 1Q40B 3EJVA 3N9HA 4XBYA 3CPW2 3ECFA 2W04A 4HM7B 3J7Yd 3F7XA 1VQP3 2FXTA 3DXOA 4HKVB 1VQM3 3CC43 1UW1A 3EN8A 4FMDA 2B24B 3Q2PA 1VQ53 2E2VA 3FZWA 4J9AA 1FGOA 4GL6A 4MMYB 1VQN3 2F99A 1RN7A 2BNGA 4N6MA 5JBSA 1RKYA 3FCSB 4G1MB 3G8ZA 3NQYA 3PS8A 2Z76A 3X3XA 4U13A 3BNBA 4N6UA 3V99A 5D81A 3B4PA 3GAXA 1N8QA 2RFRA 1JKGA 1K28A 3IJEB 3A76A 4FCMA 4J8TA 3SOAA 5IEPA 2W0QA 1NJI4 1VQ93 3FKAA 4MEIA 1A67A 3EX9A 4BTYA 3NBBA 1IT8A 3PCRA 1O7GB 2CIUA 3EBYA 3NUVA 3LYGA 2D42A 1JB2A 3FSDA 1OHPA 3EQQB 1LOXA 3MHEA 4O8SA 4HM2B 5AIIA 3T0UA 5AEWB 3CCJ3 4WYKB 1IVXA 3L0RA 4LZIA 4GB5A 1N5HA 3LTCA 1OCVA 5IW9A 1YJ93 1KQS2 3CMA3 2CK3H 4OVMA 3DY5A 3CPOA 4KFEA 4HM5B 1RRLA 3FGYA 3UL5A 4R4KA 1QAFA 5IG5A 3HK4A 3PCSA 3SVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8H A;  3GZY B;  1NWW A;  1JN5 B;  1E3R A;  1EG9 B;  1O7W B;  2Z7A A;  1O7M B;  2XR8 B;  3DUK A;  3EBT A;  1JB5 A;  3FH1 A;  3KZT A;  2XSH B;  3OX9 A;  4LMI A;  1UUV B;  4MJD A;  4R9L A;  4XDV A;  5IEO A;  3RGR A;  3RGA A;  3WMD A;  3KKG A;  3JUP A;  3CU3 A;  3F14 A;  2W2C A;  2XSO B;  1JN5 A;  1GY6 A;  1ZX2 A;  2R4I A;  3F40 A;  3NXJ A;  5CLK A;  1VZZ A;  3E99 A;  4HM3 B;  7STD A;  5IF6 A;  1CQS A;  1OF5 A;  1OGX A;  2K54 A;  3IPT A;  5TGN A;  4HM6 B;  3D9R A;  3OWY A;  2Z77 A;  4WYK A;  4XBX A;  1GYB A;  3FF0 A;  1A2K A;  3K0Z A;  4FCJ A;  1Z1S A;  2YFJ B;  4WWU C;  3GRD A;  5DRE A;  3K7C A;  4XB5 A;  1TP6 A;  1GY7 A;  1WQL B;  2YFI B;  3B8L A;  3ER7 A;  2CHC A;  4L7K A;  4L8P A;  3GZR A;  3OWU A;  4K1U A;  1C7H A;  4HVN A;  4N3V A;  2JQ5 A;  5KP3 A;  4CDL A;  3T8N A;  5D83 A;  1DMM A;  1QMA A;  1AR0 A;  3EF8 A;  1GS3 A;  4HM8 B;  4XM4 A;  5IG4 A;  3LZA A;  3H3H A;  2GBW B;  3S5C A;  3UJM A;  4HM1 B;  3DZL A;  1UUW B;  4OUQ A;  5IER A;  1HKX A;  4K1V A;  1DMQ A;  2YFL B;  5IG3 A;  2QGU A;  3OWS A;  3KSP A;  4STD A;  3OV4 A;  2HMN B;  1S5A A;  1Q40 A;  4IIA A;  4RZM A;  2HMO B;  4HM4 B;  1W01 A;  1JB4 A;  3F9S A;  2B1X B;  2GEY A;  3HX8 A;  4I4K A;  5BVB A;  1Q40 B;  1OH0 A;  3EJV A;  4PEJ A;  3NHX A;  1OPY A;  1OUN A;  4R1K A;  3MG3 A;  4XBT A;  1K41 A;  1U5O A;  4XBY A;  1ISK A;  2RCD A;  3ECF A;  4HZ9 B;  5KP1 A;  3GWR A;  1DMN A;  2OWP A;  1JKG B;  4HM7 B;  3FF2 A;  3MKI A;  3GZX B;  3F7X A;  1TUH A;  2BMR B;  3B4O A;  3DXO A;  1IDP A;  1ULJ B;  4HKV B;  5AIF A;  3SOY A;  2F86 B;  5AIG A;  5DRV A;  1OHS A;  3EN8 A;  3JUQ A;  1ULI B;  2B24 B;  3VGN A;  1STD A;  4X2O A;  3UNL A;  5JPP A;  3G0K A;  3FZW A;  4J9A A;  4Q53 A;  4XDW A;  1GY5 A;  1W6Y A;  2F99 A;  3BB9 A;  5HGR A;  3STD A;  2BNG A;  5IEN A;  1O7H B;  3NV0 A;  4X2H A;  3FLJ A;  4L8O A;  8CHO A;  4ORL A;  1NU3 A;  1QJG A;  2GEX A;  2XRX B;  3F7S A;  1ZO2 A;  5AEU B;  3G8Z A;  1OF5 B;  4WP5 A;  6STD A;  2Z76 A;  3EHC A;  3NM2 A;  4U13 A;  3T8U A;  3NBR A;  3EN1 B;  2INX A;  1W00 A;  5D81 A;  5D82 A;  3B4P A;  2RFR A;  3H51 A;  4R9K A;  3EC9 A;  1JKG A;  3Q90 A;  3M8C A;  2A15 A;  2QIY A;  3A76 A;  4FCM A;  4J8T A;  5STD A;  3SOA A;  5BXQ A;  5IEP A;  3FKA A;  1BUQ A;  3EX9 A;  1W02 A;  4LGQ A;  3DMC A;  3F8X A;  4HJL B;  3JUM A;  3KE7 A;  5CK6 A;  1O7G B;  3EBY A;  5KP4 A;  3GZB A;  3NUV A;  3LYG A;  2I9W A;  2PZV A;  1JB2 A;  2RGQ A;  3OXA A;  3FSD A;  3JUN A;  5CXO A;  1OHP A;  1OHO A;  3EQQ B;  1SJW A;  3MG1 A;  2CKF B;  3I0Y A;  1Q42 A;  1NDO B;  3MHE A;  3MG2 A;  3MSO A;  4KVH A;  2STD A;  3MYT A;  4H3U A;  3JUO A;  4HM2 B;  3ROB A;  2BMQ B;  5AII A;  3B7C A;  5AEW B;  5AI1 A;  4WYK B;  1E3V A;  5EVH A;  4GB5 A;  1O7N B;  2UX0 A;  1O7P B;  5G2G A;  1OCV A;  4HM0 B;  3BLZ A;  2IMJ A;  1EA2 A;  3HZP A;  4LEH A;  5IG0 A;  2HMM B;  3CNM A;  4OVM A;  5CF2 A;  5AIH A;  5JPU A;  3G16 A;  3CPO A;  1OGZ A;  3CNX A;  4HZB B;  3NV0 B;  2GBX B;  2GXF A;  2HML B;  3DM8 A;  4HM5 B;  1E97 A;  1ASK A;  3FGY A;  3VSY A;  5CF1 A;  5IG5 A;  5FW5 A;  3HK4 A;  3SED A;  2F98 A;  2BMO B;  2HMJ B;  2HMK B; 
#chains in the Genus database with same CATH topology
 3GZY B;  1BSD A;  1EG9 B;  1O7W B;  3DUK A;  3KZT A;  3AHW A;  1BIR A;  1EQK A;  3OX9 A;  4XDV A;  1M9G A;  3WMD A;  1UUV B;  1W6G A;  4O2H A;  1K8A 4;  3F14 A;  3NXJ A;  1GY6 A;  1N9E A;  1FUW A;  1RGE A;  1BNE A;  1JZD A;  3D79 A;  3N54 B;  3WA3 A;  3OWY A;  1A2P A;  1BRG A;  3LTB A;  2KAA A;  1Z1S A;  4WWU C;  1MWT A;  3GRD A;  3Q3F A;  2W56 A;  3NQZ A;  2YFI B;  3ER7 A;  4JRF A;  1YHQ 3;  2FNQ A;  4L7K A;  4L8P A;  3GZR A;  3KCH A;  4K1U A;  1AVK A;  1OAC A;  1JZO A;  1YNV X;  1I3F A;  2JQ5 A;  2IY2 A;  4AKZ A;  2MC8 A;  2KCD A;  1FGM A;  4EC6 A;  3AMO B;  1WMN A;  1GS3 A;  4N6N B;  1JV2 B;  3LZA A;  3UJM A;  3I56 3;  2IUK A;  1UUW B;  2R41 A;  1HKX A;  1LNI A;  1T5Y A;  2CX0 A;  5IG3 A;  1HZ1 A;  2QGU A;  2HMN B;  4R80 A;  1PY3 A;  2CFL A;  1DVD A;  4RZM A;  1BNR A;  1LRA A;  1MWU A;  2OCT A;  1JB4 A;  4BIR A;  1UCJ A;  2WOH A;  5BVB A;  3QRD A;  4PEJ A;  3MG3 A;  4XBT A;  1ISK A;  1CH0 A;  3X3Y A;  1BRH A;  1IT7 A;  3MKI A;  2D1W A;  1W2B 2;  1I2F A;  1W6C A;  3IMA B;  1RGH A;  1ULJ B;  3K5T A;  2CFK A;  1YJN 3;  1BRS A;  1OHS A;  3JVC A;  3JUQ A;  2M7O A;  3LT8 A;  2AAD A;  3LTA A;  3LTD A;  5EQL A;  1BAN A;  3HOH A;  1IYY A;  3AGN A;  4Q53 A;  2E2T A;  4WFO A;  2XF3 A;  3HIG A;  1Q7Y 4;  1W6Y A;  5IEN A;  4X2H A;  3NV0 A;  5I97 A;  3FLJ A;  1T3B A;  3FG1 A;  1LNH A;  4L8O A;  2P38 A;  1LOV A;  1I0V A;  4JF8 A;  2XRX B;  1DVC A;  5AEU B;  1RN1 A;  3FG4 A;  4WP5 A;  3WA2 X;  4BTX A;  5BIR A;  3EHC A;  6STD A;  1DYU A;  4BL3 A;  1AVL A;  5LC7 A;  2CWU A;  4BU4 A;  3H51 A;  3BIR A;  3EC9 A;  1BU4 A;  2QIY A;  6GSP A;  2JDI H;  5BXQ A;  3OW2 2;  1Q81 4;  2CH9 A;  2OOV A;  3KSE D;  1W02 A;  1US1 A;  3G71 3;  3EB8 A;  3JUM A;  3KE7 A;  1RGL A;  3NM7 A;  5CK6 A;  1X1W A;  1EEJ A;  3GZB A;  3URP A;  2RGQ A;  1JBT A;  1LQG C;  3JUN A;  1OHO A;  3T8U A;  1YGW A;  2CKF B;  3I0Y A;  1Q42 A;  4KFF A;  2IYJ A;  2W03 A;  4KVH A;  4EV2 A;  4H3U A;  3K9M C;  2XFS A;  3B7C A;  1FGQ A;  5AI1 A;  3S29 A;  5EVH A;  4EXR A;  1MNL A;  2UX0 A;  1I2G A;  1FGR A;  2H0I A;  3GSP A;  4CDL A;  5IG0 A;  1BSC A;  1MGW A;  5A0O B;  5AIH A;  3G16 A;  1FZU A;  4HZB B;  1OGZ A;  1WNH A;  2KRT A;  2GBX B;  2HML B;  4FMB A;  5CF1 A;  3LOY A;  3SED A;  4GSP A;  2BMO B;  2CWT A;  2HMJ B;  1VQ7 3;  3F8H A;  2K3D A;  1JN5 B;  1E3R A;  1TIJ A;  1ZGX A;  2Z7A A;  1CYU A;  1CYV A;  5G2G A;  2F5W A;  4NRE A;  1TU5 A;  1BGS A;  5IEO A;  3RGR A;  3RGA A;  3BNE A;  3CU3 A;  1BAO A;  1JN5 A;  2KF3 A;  1Y4K A;  3VF1 A;  1NB3 I;  1QAL A;  4HM3 B;  1RNB A;  1CQS A;  1OGX A;  1RTU A;  2K54 A;  3AHS A;  5TGN A;  1FYS A;  2CW9 A;  1VQQ A;  4FCJ A;  1BSA A;  5AYR B;  1MOL A;  2YFJ B;  1KC8 4;  5DRE A;  1SII A;  3K7C A;  4XB5 A;  3PXM A;  1WQL B;  1B20 A;  2CHC A;  5KP3 A;  1SQW A;  4N3V A;  3D5G A;  3WHO A;  4J5G A;  2P09 A;  1FUT A;  4H61 A;  2MF7 A;  3S67 A;  1QMA A;  1IK3 A;  1N8R 4;  2OTJ 3;  4HM8 B;  2HOH A;  4RNZ A;  3DZL A;  1L5G B;  1NB5 I;  2XFT A;  3RDE A;  3OWS A;  3KSP A;  1ZS7 A;  3CC7 3;  5M19 A;  1GD3 A;  1K73 4;  1S5A A;  2RSX A;  1QVF 2;  1EKM A;  2WGO A;  2Y73 A;  1BSB A;  2SBL A;  4RBN A;  3ZG5 A;  1GOU A;  5G1K A;  1TFO A;  1W01 A;  4HAA A;  1W5Z A;  3F9S A;  2B1X B;  2J8X B;  1B2M A;  1G96 A;  4N6O B;  1OPY A;  1OUN A;  1BOX A;  3NX0 A;  4KFD A;  4R1K A;  3X42 A;  3NBJ A;  1VQK 3;  1FW7 A;  2GSP A;  2XEP A;  2BHM A;  4HZ9 B;  1DMN A;  3UB1 A;  1JKG B;  3FF2 A;  4O3V A;  4EV5 A;  3B4O A;  3WDG B;  5AYS C;  1GD4 A;  1UCL A;  2F86 B;  5AIG A;  5DRV A;  1I2E A;  1BVI A;  1NO3 A;  1PU4 A;  2IA7 A;  3VGN A;  1STD A;  2ML6 A;  3N8B A;  3UNL A;  3G0K A;  5JPP A;  4XDW A;  1RGA A;  2P0M A;  1GY5 A;  2WO0 A;  3BB9 A;  3V92 A;  2W56 B;  5HGR A;  1YIT 3;  1O7H B;  4BTW A;  3D3L A;  4N6T A;  8CHO A;  1HU9 A;  1QJG A;  3HI7 A;  2W6J H;  1C54 A;  1FGT A;  3D4A A;  1ZO2 A;  2Q07 A;  3CCQ 3;  1BRI A;  4NHF A;  1UDI I;  1BNF A;  2O3O A;  3D5I A;  4MMX B;  4RNT A;  2QEX 3;  1VQ4 3;  1NNV A;  2KF5 A;  2OOV C;  4R9K A;  3X3Z A;  5STD A;  3Q90 A;  4AKY A;  3CCL 3;  9RNT A;  1RHL A;  1RNT A;  1X1X A;  2F4Y A;  3DMC A;  1STF I;  1I0X A;  1UI7 A;  5GSP A;  4FMC A;  4EYC A;  1D6Y A;  2RBI A;  2F5M A;  2I9W A;  1DET A;  2V1L A;  2UUG C;  1M1X B;  1IVU A;  2XH9 A;  1SJW A;  2Z6B A;  1JNQ A;  3MG1 A;  3MSO A;  1NDO B;  1BRN L;  3MG2 A;  5RNT A;  1RSN A;  2BT3 A;  1B21 A;  3JUO A;  1PFP A;  1VQ6 3;  1GMP A;  1E3V A;  3CD6 3;  1O7N B;  1JBS A;  1B3S A;  3LT9 A;  3HZP A;  2IMJ A;  1EA2 A;  4LSO A;  1UCK A;  3UL6 A;  3CNM A;  3U1W A;  2OQE A;  1K9M 4;  3CCE 3;  1MGR A;  3NV0 B;  2GXF A;  3DM8 A;  3VSY A;  4DKI A;  1E97 A;  1A2V A;  3WOF B;  2F98 A;  4X2O A;  3STD A;  2E2U A;  3EBT A;  1O7M B;  2XR8 B;  2ZA4 A;  3CCM 3;  1JB5 A;  2YX9 A;  3FH1 A;  2XSH B;  4LMI A;  5M1A A;  4R9L A;  1BNI A;  3KKG A;  3JUP A;  1BNJ A;  3BU4 A;  2XSO B;  3F40 A;  1ZX2 A;  5HOH A;  1KD1 4;  1VZZ A;  5IF6 A;  1IV9 A;  1V74 A;  1RJO A;  4HM6 B;  1I70 A;  1T2I A;  3D9R A;  3FG3 A;  1X1U A;  4O02 B;  4XBX A;  3FF0 A;  1A2K A;  3K0Z A;  2ZDJ A;  4TX4 A;  3CCV 3;  1YI2 3;  1RCK A;  1AV4 A;  2BO9 B;  1VQ8 3;  3DGN A;  3K63 A;  4QWT A;  1GY7 A;  4XM4 A;  2SAR A;  3OWU A;  2OQE C;  2CG1 A;  3BNC A;  1IQX A;  3T8N A;  3U97 A;  1DMM A;  1VQL 3;  3EF8 A;  1BRK A;  5IG4 A;  1UGI A;  1IQ8 A;  1GOY A;  1RN4 A;  1ROA A;  2GBW B;  3H3H A;  4HM1 B;  3AGO A;  2P0X A;  1B2Z A;  4OUQ A;  3S5C A;  3V98 A;  4RNY A;  2IUJ A;  3CXC 2;  4K1V A;  1DMQ A;  3KII A;  1B2X A;  2CWV A;  3MPH A;  3DGY A;  1N5P A;  3PYJ A;  2CFG A;  4STD A;  3S28 A;  4J5K A;  1Q40 A;  1I3I A;  1RCL A;  2KXG A;  3WOD G;  2F56 A;  2Y74 A;  1T2H A;  2GEY A;  4I4K A;  1F8N A;  2XGL A;  1D6Z A;  1OH0 A;  2ZL8 A;  4LYL B;  2H0G A;  1RRH A;  1WMO A;  2O9U X;  1R4C A;  2PNC A;  3NHX A;  1RDS A;  1K41 A;  1U5O A;  3CCS 3;  2RCD A;  5KP1 A;  1FA3 A;  3DGO A;  3GWR A;  1BRJ A;  1D6U A;  1W2Z A;  2OWP A;  3CCR 3;  3GZX B;  4ILF A;  3SXX A;  1A90 A;  1TUH A;  1QVG 2;  2BMR B;  5AIF A;  3QK9 A;  1IDP A;  1S72 3;  1TTO A;  3SOY A;  1N9J A;  2XGN A;  1M90 4;  1ULI B;  2QA4 3;  3ALA A;  1VQO 3;  3LML A;  2K0M A;  1TFK A;  3LH4 A;  1RGK A;  1R4Y A;  3Q1C A;  4ORL A;  1NU3 A;  2GEX A;  2C10 A;  2ML5 A;  4OK0 A;  1IU7 A;  3F7S A;  1I8V A;  4K61 A;  4GHO A;  3O8Y A;  1OF5 B;  1TRP A;  4HBR A;  3NM2 A;  1YVB I;  3NBR A;  3EN1 B;  2INX A;  1W00 A;  4FMA A;  5D82 A;  5ELU A;  3LXU X;  1QAK A;  1J2B A;  4KT3 B;  3M8C A;  2A15 A;  3DGM A;  4N6L A;  1LXE A;  2FGT A;  1YVS A;  1KWI A;  1Q9E A;  4LGQ A;  1WMP A;  3KN4 A;  1TJD A;  3F8X A;  4HYZ A;  4IPB A;  4HJL B;  2H0H A;  1RMS A;  2WOF A;  5KP4 A;  1Q7H A;  3PGB A;  3SLU A;  2PZV A;  3OXA A;  5CXO A;  4KZ1 A;  5EEO A;  1BNS A;  2L4V A;  4CCV A;  1IVW A;  1UI8 A;  2STD A;  1V57 A;  2BU4 A;  2UGI A;  1KSI A;  1WTH A;  2BMQ B;  1B27 A;  3MYT A;  4FCZ A;  1BUJ A;  5LC6 A;  1O7P B;  3AMO A;  2CG0 A;  4HM0 B;  4LEH A;  3BLZ A;  3KFQ C;  3X40 A;  5CF2 A;  3CCU 3;  1G0T A;  2HMM B;  3G6E 3;  1M1K 4;  2W9P A;  5JPU A;  2GU1 A;  1YJW 3;  3EE1 A;  1BSE A;  2AAE A;  3CNX A;  1U8C B;  4WHA A;  3WOE B;  1MWR A;  1ASK A;  1UCI A;  4EBG A;  2C11 A;  2LQV A;  5FW5 A;  2CFD A;  1IQY A;  1CEW I;  2ZHX B;  1SIH A;  3MWZ A;  2L1S A;  2HMK B;  1NWW A;  3A5E A;  4IT7 A;  4CJN A;  1BUQ A;  4MJD A;  1IV7 A;  1ROV A;  2WGQ A;  3S27 A;  1Q82 4;  2W2C A;  1SPU A;  5CLK A;  2P05 A;  2R4I A;  7STD A;  3E99 A;  3CC2 3;  1LOW A;  1OF5 A;  3BND A;  1W7C A;  3IPT A;  1UUG B;  4WYK A;  3HII A;  2Z77 A;  3SX1 A;  1GYB A;  1W4N A;  3G4S 3;  4CPK A;  1YGE A;  3WR2 A;  1LVN A;  2CC3 A;  1TP6 A;  4AEQ A;  5ELJ A;  1DE3 A;  3B8L A;  1B2S A;  4N6V 0;  1C7H A;  4HVN A;  4MMZ B;  4HOH A;  3DGL A;  1UGH I;  3RNT A;  5D83 A;  5G1L A;  1Q86 4;  1AR0 A;  2KF6 A;  2GU3 A;  2W9Q A;  4EW5 A;  3DH2 A;  4ZM8 A;  5IER A;  2LYX A;  4FR9 A;  3TDG A;  3X41 A;  4K90 B;  3PZW A;  2YFL B;  7RNT A;  1IVV A;  2CFW A;  4BL2 A;  1JJ2 2;  3OV4 A;  1MWS A;  4IIA A;  3CME 3;  2HMO B;  1LOY A;  7GSP A;  1EUI C;  5FGO A;  4HM4 B;  1GMR A;  3I55 3;  1JRQ A;  6RNT A;  3HX8 A;  1Q40 B;  3EJV A;  3N9H A;  5M18 A;  4I5Q A;  3ZG0 A;  4XBY A;  2RNT A;  1V58 A;  3CPW 2;  3ECF A;  2W04 A;  4HM7 B;  1G02 A;  3J7Y d;  1RGG A;  3F7X A;  1VQP 3;  2FXT A;  3DXO A;  1LQM B;  4HKV B;  2KF4 A;  1VQM 3;  3CC4 3;  1UW1 A;  3EN8 A;  4FMD A;  2B24 B;  1RGF A;  3Q2P A;  1VQ5 3;  2E2V A;  1B2U A;  3FZW A;  4J9A A;  3ZFZ A;  1FGO A;  8RNT A;  4NPB A;  4GL6 A;  4MMY B;  1VQN 3;  2F99 A;  1RN7 A;  2BNG A;  2CX1 A;  4N6M A;  5JBS A;  1RKY A;  3FCS B;  2OTL 3;  4G1M B;  3G8Z A;  3NQY A;  3PS8 A;  2Z76 A;  3X3X A;  4U13 A;  3BNB A;  4N6U A;  3V99 A;  2BIR A;  5D81 A;  3B4P A;  3GAX A;  1N8Q A;  2RFR A;  1YIJ 3;  1AY7 A;  1JKG A;  1K28 A;  3IJE B;  3A76 A;  4FCM A;  4J8T A;  3SOA A;  5IEP A;  2W0Q A;  1NJI 4;  1VQ9 3;  3FKA A;  4MEI A;  1A67 A;  3EX9 A;  3ROB A;  1TRQ A;  4BTY A;  1JBR A;  3NBB A;  1IT8 A;  3PCR A;  1GMQ A;  1O7G B;  2CIU A;  3EBY A;  3NUV A;  3LYG A;  2D42 A;  1JB2 A;  3FSD A;  1OHP A;  3EQQ B;  1LOX A;  3MHE A;  1HYF A;  4O8S A;  1BNG A;  1PYL A;  4HM2 B;  5AII A;  3T0U A;  5AEW B;  3CCJ 3;  4WYK B;  1IVX A;  3L0R A;  4LZI A;  4GB5 A;  1GSP A;  5BU4 A;  1N5H A;  1RLS A;  1X1Y A;  3LTC A;  1GOV A;  1OCV A;  5IW9 A;  1YJ9 3;  1KQS 2;  2CK3 H;  3CMA 3;  4OVM A;  2C4B A;  3DY5 A;  3CPO A;  1SAR A;  4KFE A;  4HM5 B;  1RRL A;  3FGY A;  3UL5 A;  4R4K A;  1QAF A;  1RGC A;  5IG5 A;  3HK4 A;  3SYU A;  1AQZ A;  1FUS A;  3PCS A;  3SVA A; 
#chains in the Genus database with same CATH homology
 3GZY B;  1EG9 B;  1O7W B;  3DUK A;  3KZT A;  1EQK A;  3OX9 A;  4XDV A;  1M9G A;  3WMD A;  1UUV B;  1W6G A;  4O2H A;  1K8A 4;  3F14 A;  3NXJ A;  1GY6 A;  1N9E A;  1FUW A;  3N54 B;  3WA3 A;  3OWY A;  3LTB A;  1Z1S A;  4WWU C;  3GRD A;  2W56 A;  3NQZ A;  2YFI B;  3ER7 A;  4JRF A;  1YHQ 3;  2FNQ A;  4L7K A;  4L8P A;  3GZR A;  4K1U A;  1AVK A;  1OAC A;  2JQ5 A;  4AKZ A;  2MC8 A;  2KCD A;  1FGM A;  4EC6 A;  3AMO B;  1WMN A;  1GS3 A;  4N6N B;  1JV2 B;  3LZA A;  3UJM A;  3I56 3;  2IUK A;  1UUW B;  1HKX A;  1T5Y A;  5IG3 A;  2QGU A;  2HMN B;  4R80 A;  2CFL A;  1DVD A;  4RZM A;  2OCT A;  1JB4 A;  2WOH A;  5BVB A;  3QRD A;  4PEJ A;  3MG3 A;  4XBT A;  1ISK A;  3X3Y A;  1IT7 A;  3MKI A;  2D1W A;  1W2B 2;  1W6C A;  3IMA B;  1ULJ B;  3K5T A;  2CFK A;  1YJN 3;  1OHS A;  3JVC A;  3JUQ A;  2M7O A;  3LT8 A;  3LTA A;  3LTD A;  5EQL A;  4Q53 A;  4WFO A;  2E2T A;  2XF3 A;  3HIG A;  1Q7Y 4;  1W6Y A;  5IEN A;  4X2H A;  3NV0 A;  5I97 A;  3FLJ A;  3FG1 A;  4L8O A;  1LNH A;  2P38 A;  4JF8 A;  2XRX B;  1DVC A;  5AEU B;  3WA2 X;  3FG4 A;  4WP5 A;  4BTX A;  6STD A;  3EHC A;  1DYU A;  1AVL A;  5LC7 A;  2CWU A;  3H51 A;  3EC9 A;  2QIY A;  2JDI H;  5BXQ A;  3OW2 2;  1Q81 4;  2CH9 A;  2OOV A;  3KSE D;  1W02 A;  1US1 A;  3G71 3;  3EB8 A;  3JUM A;  3KE7 A;  3NM7 A;  5CK6 A;  3GZB A;  2RGQ A;  3JUN A;  1OHO A;  3T8U A;  2CKF B;  3I0Y A;  1Q42 A;  4KFF A;  2W03 A;  4KVH A;  4EV2 A;  4H3U A;  3K9M C;  2XFS A;  3B7C A;  1FGQ A;  5AI1 A;  3S29 A;  5EVH A;  4EXR A;  1MNL A;  2UX0 A;  1FGR A;  4CDL A;  5IG0 A;  5A0O B;  5AIH A;  3G16 A;  4HZB B;  1OGZ A;  1WNH A;  2KRT A;  2GBX B;  2HML B;  4FMB A;  5CF1 A;  3LOY A;  3SED A;  2BMO B;  2CWT A;  2HMJ B;  1VQ7 3;  3F8H A;  1JN5 B;  1E3R A;  1TIJ A;  1CYU A;  2Z7A A;  1CYV A;  5G2G A;  4NRE A;  1TU5 A;  3RGR A;  5IEO A;  3RGA A;  3BNE A;  3CU3 A;  1JN5 A;  1Y4K A;  3VF1 A;  1NB3 I;  1QAL A;  4HM3 B;  1CQS A;  1OGX A;  2K54 A;  5TGN A;  2CW9 A;  4FCJ A;  5AYR B;  1MOL A;  2YFJ B;  1KC8 4;  5DRE A;  1SII A;  3K7C A;  4XB5 A;  3PXM A;  1WQL B;  2CHC A;  5KP3 A;  1SQW A;  4N3V A;  2P09 A;  4H61 A;  2MF7 A;  3S67 A;  1QMA A;  1IK3 A;  1N8R 4;  2OTJ 3;  4HM8 B;  4RNZ A;  3DZL A;  1L5G B;  1NB5 I;  2XFT A;  3RDE A;  3OWS A;  3KSP A;  3CC7 3;  1GD3 A;  1K73 4;  1S5A A;  2RSX A;  1QVF 2;  1EKM A;  2WGO A;  2Y73 A;  2SBL A;  4RBN A;  1TFO A;  1W01 A;  1W5Z A;  3F9S A;  2B1X B;  1G96 A;  4N6O B;  1OPY A;  1OUN A;  3NX0 A;  4KFD A;  4R1K A;  3X42 A;  3NBJ A;  1VQK 3;  4HZ9 B;  2XEP A;  2BHM A;  3UB1 A;  1DMN A;  1JKG B;  3FF2 A;  4O3V A;  4EV5 A;  3B4O A;  3WDG B;  5AYS C;  1GD4 A;  2F86 B;  5AIG A;  5DRV A;  1NO3 A;  1PU4 A;  2IA7 A;  3VGN A;  1STD A;  2ML6 A;  3N8B A;  3UNL A;  3G0K A;  5JPP A;  4XDW A;  2P0M A;  1GY5 A;  2WO0 A;  3BB9 A;  3V92 A;  2W56 B;  5HGR A;  1YIT 3;  1O7H B;  4BTW A;  3D3L A;  4N6T A;  8CHO A;  1HU9 A;  1QJG A;  3HI7 A;  2W6J H;  1FGT A;  1ZO2 A;  2Q07 A;  3CCQ 3;  4NHF A;  2O3O A;  4MMX B;  2QEX 3;  1VQ4 3;  2OOV C;  3X3Z A;  4R9K A;  5STD A;  3Q90 A;  4AKY A;  3CCL 3;  3DMC A;  1STF I;  1UI7 A;  4FMC A;  4EYC A;  1D6Y A;  2I9W A;  2V1L A;  2Z6B A;  2XH9 A;  1M1X B;  1IVU A;  1SJW A;  3MG1 A;  1JNQ A;  3MSO A;  1NDO B;  3MG2 A;  2BT3 A;  3JUO A;  1PFP A;  1VQ6 3;  1E3V A;  3CD6 3;  1O7N B;  3LT9 A;  3HZP A;  2IMJ A;  1EA2 A;  4LSO A;  3UL6 A;  3CNM A;  3U1W A;  1K9M 4;  3CCE 3;  3NV0 B;  2GXF A;  3DM8 A;  3VSY A;  1E97 A;  1A2V A;  3WOF B;  2F98 A;  4X2O A;  3STD A;  2E2U A;  3EBT A;  1O7M B;  2XR8 B;  1YIJ 3;  3CCM 3;  1JB5 A;  2YX9 A;  3FH1 A;  2XSH B;  4LMI A;  4R9L A;  3KKG A;  3JUP A;  2XSO B;  3F40 A;  1ZX2 A;  1KD1 4;  1VZZ A;  5IF6 A;  1IV9 A;  1V74 A;  1RJO A;  4HM6 B;  3D9R A;  3FG3 A;  4O02 B;  4XBX A;  3FF0 A;  1A2K A;  3K0Z A;  2ZDJ A;  4TX4 A;  3CCV 3;  1YI2 3;  1AV4 A;  2BO9 B;  1VQ8 3;  3DGN A;  3K63 A;  4QWT A;  1GY7 A;  4XM4 A;  3OWU A;  2OQE C;  2CG1 A;  3BNC A;  1IQX A;  3T8N A;  3U97 A;  1DMM A;  1VQL 3;  3EF8 A;  5IG4 A;  2OQE A;  1IQ8 A;  1ROA A;  3H3H A;  2GBW B;  3S5C A;  3V98 A;  4HM1 B;  3CXC 2;  2P0X A;  4OUQ A;  4RNY A;  2IUJ A;  4K1V A;  1DMQ A;  3KII A;  3MPH A;  2CWV A;  1N5P A;  3PYJ A;  2CFG A;  4STD A;  3S28 A;  1Q40 A;  2KXG A;  3WOD G;  2Y74 A;  2GEY A;  4I4K A;  1F8N A;  2XGL A;  1D6Z A;  1OH0 A;  2ZL8 A;  3NHX A;  1RRH A;  1WMO A;  2O9U X;  1R4C A;  2PNC A;  1K41 A;  1U5O A;  3CCS 3;  2RCD A;  5KP1 A;  1FA3 A;  3DGO A;  3GWR A;  2OWP A;  1D6U A;  1W2Z A;  3CCR 3;  3GZX B;  3SXX A;  1A90 A;  1TUH A;  1QVG 2;  2BMR B;  5AIF A;  3QK9 A;  1IDP A;  1S72 3;  3SOY A;  1N9J A;  2XGN A;  1M90 4;  1ULI B;  2QA4 3;  3ALA A;  1VQO 3;  3LML A;  2K0M A;  1TFK A;  3LH4 A;  3Q1C A;  4ORL A;  1NU3 A;  2GEX A;  2C10 A;  2ML5 A;  4OK0 A;  1IU7 A;  3F7S A;  4K61 A;  3O8Y A;  1OF5 B;  4HBR A;  3NM2 A;  1YVB I;  3NBR A;  3EN1 B;  2INX A;  1W00 A;  4FMA A;  5D82 A;  5ELU A;  3LXU X;  1QAK A;  1J2B A;  3M8C A;  2A15 A;  3DGM A;  4N6L A;  1LXE A;  2FGT A;  1KWI A;  4LGQ A;  1WMP A;  3KN4 A;  3F8X A;  4HYZ A;  4IPB A;  4HJL B;  2WOF A;  5KP4 A;  3PGB A;  3SLU A;  2PZV A;  3OXA A;  5CXO A;  4KZ1 A;  5EEO A;  2L4V A;  4CCV A;  1IVW A;  1UI8 A;  2STD A;  3MYT A;  4FCZ A;  3ROB A;  1KSI A;  1WTH A;  2BMQ B;  2OTL 3;  5LC6 A;  1O7P B;  3AMO A;  2CG0 A;  4HM0 B;  4LEH A;  3BLZ A;  3KFQ C;  3X40 A;  5CF2 A;  3CCU 3;  3G6E 3;  2HMM B;  1M1K 4;  2W9P A;  5JPU A;  2GU1 A;  1YJW 3;  3EE1 A;  3CNX A;  1U8C B;  4WHA A;  3WOE B;  4EBG A;  1ASK A;  2C11 A;  2LQV A;  5FW5 A;  2CFD A;  1IQY A;  1CEW I;  1SIH A;  3MWZ A;  2HMK B;  1NWW A;  4IT7 A;  1BUQ A;  4MJD A;  1IV7 A;  1ROV A;  2WGQ A;  3S27 A;  1Q82 4;  2W2C A;  1SPU A;  5CLK A;  2P05 A;  2R4I A;  7STD A;  3E99 A;  3CC2 3;  1OF5 A;  3BND A;  3IPT A;  1W7C A;  4WYK A;  3HII A;  2Z77 A;  3SX1 A;  1GYB A;  1W4N A;  3G4S 3;  1YGE A;  1LVN A;  2CC3 A;  1TP6 A;  4AEQ A;  5ELJ A;  3B8L A;  4N6V 0;  1C7H A;  4HVN A;  4MMZ B;  3DGL A;  5D83 A;  1Q86 4;  1AR0 A;  2GU3 A;  2W9Q A;  4ZM8 A;  5IER A;  2LYX A;  4FR9 A;  3TDG A;  3X41 A;  4K90 B;  3PZW A;  2YFL B;  1IVV A;  2CFW A;  1JJ2 2;  3OV4 A;  4IIA A;  3CME 3;  2HMO B;  5FGO A;  4HM4 B;  3I55 3;  1JRQ A;  3HX8 A;  1Q40 B;  3EJV A;  3N9H A;  4XBY A;  3CPW 2;  3ECF A;  2W04 A;  4HM7 B;  3J7Y d;  3F7X A;  1VQP 3;  2FXT A;  3DXO A;  4HKV B;  1VQM 3;  3CC4 3;  1UW1 A;  3EN8 A;  4FMD A;  2B24 B;  3Q2P A;  1VQ5 3;  2E2V A;  3FZW A;  4J9A A;  1FGO A;  4GL6 A;  4MMY B;  1VQN 3;  2F99 A;  1RN7 A;  2BNG A;  4N6M A;  5JBS A;  1RKY A;  3FCS B;  4G1M B;  3G8Z A;  3NQY A;  3PS8 A;  2Z76 A;  3X3X A;  4U13 A;  3BNB A;  4N6U A;  3V99 A;  5D81 A;  3B4P A;  3GAX A;  1N8Q A;  2RFR A;  1JKG A;  1K28 A;  3IJE B;  3A76 A;  4FCM A;  4J8T A;  3SOA A;  5IEP A;  2W0Q A;  1NJI 4;  1VQ9 3;  3FKA A;  4MEI A;  1A67 A;  3EX9 A;  4BTY A;  3NBB A;  1IT8 A;  3PCR A;  1O7G B;  2CIU A;  3EBY A;  3NUV A;  3LYG A;  2D42 A;  1JB2 A;  3FSD A;  1OHP A;  3EQQ B;  1LOX A;  3MHE A;  4O8S A;  4HM2 B;  5AII A;  3T0U A;  5AEW B;  3CCJ 3;  4WYK B;  1IVX A;  3L0R A;  4LZI A;  4GB5 A;  1N5H A;  3LTC A;  1OCV A;  5IW9 A;  1YJ9 3;  1KQS 2;  3CMA 3;  2CK3 H;  4OVM A;  3DY5 A;  3CPO A;  4KFE A;  4HM5 B;  1RRL A;  3FGY A;  3UL5 A;  4R4K A;  1QAF A;  5IG5 A;  3HK4 A;  3PCS A;  3SVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...