4GB5A

Crystal structure of kfla4162 protein from kribbella flavida
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
DAETDRAEIIELFGRYADIADLKEFTDLPRRVHTDPLTIDFESVTGMPPMTVPLSDYGAALRASFGAFSATHHAITGHVVTIDSDRATIHAHVRAEHWLPAEVAGDGPDRWLVVGFYDNEAVRTADGWRLSSVKLTASYQENAHLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of Kfla4162 protein from Kribbella flavida (CASP Target)
rcsb
source organism Kribbella flavida
molecule tags Structural genomics, unknown function
total genus 43
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gb5A00
3HK4A 2HMLB 3B4PA 3DUKA 1OF5A 3RGAA 1OGZA 4LEHA 1E3RA 4OVMA 5DREA 3RGRA 2CHCA 3EX9A 3F8HA 3MYTA 1JKGB 1JB2A 1O7PB 3BLZA 3MG1A 2GEYA 2RGQA 1ASKA 3GWRA 3NM2A 4XM4A 3VGNA 2Z77A 2QIYA 3BB9A 3H3HA 3STDA 1W00A 1ULJB 1OUNA 1TP6A 1A2KA 3CPOA 2HMMB 5IF6A 3GZXB 1OHOA 7STDA 3UNLA 2HMOB 4OUQA 1NWWA 4HM3B 4K1VA 4XBXA 1DMNA 5AIIA 3T8NA 5CK6A 3JUOA 4PEJA 4J9AA 2BMOB 4L8OA 1GY6A 1C7HA 2Z7AA 4WYKA 3EJVA 6STDA 3CNXA 1GS3A 4L7KA 4FCJA 3OX9A 3EN1B 3FGYA 5FW5A 3G8ZA 1Q40A 1OH0A 2K54A 3K7CA 5KP4A 3MHEA 3F8XA 5DRVA 1Z1SA 4FCMA 1O7HB 3FH1A 3FKAA 3EC9A 4HJLB 5IERA 3FZWA 3B7CA 2YFLB 8CHOA 2QGUA 1OHSA 1JKGA 5AIFA 4GB5A 5EVHA 4HZ9B 3OWUA 1DMMA 5CF2A 3CU3A 2CKFB 4R1KA 3EF8A 5JPUA 3EHCA 4N3VA 3HZPA 2F99A 1W02A 5IG5A 4L8PA 1QMAA 2BMQB 1CQSA 2Z76A 4X2OA 1TUHA 3S5CA 4STDA 3GZYB 5KP3A 3F9SA 3GZBA 5JPPA 4HM7B 4WP5A 3SEDA 1OHPA 3I0YA 2I9WA 5AEWB 3GRDA 1ZO2A 1U5OA 1ULIB 3DMCA 4I4KA 2GEXA 1GYBA 4HM5B 1EA2A 2IMJA 5STDA 3OWYA 5IG4A 3A76A 5IG3A 5G2GA 2GBXB 3F7XA 3FF0A 3G16A 3JUPA 3JUNA 5IENA 2XSHB 3HX8A 2R4IA 3NBRA 4IIAA 3SOYA 5CXOA 1ZX2A 2B1XB 2YFJB 5BXQA 1JB4A 4KVHA 1NDOB 4R9KA 2STDA 1OF5B 2BMRB 3B8LA 3EBTA 2JQ5A 3EN8A 5CF1A 3DZLA 4XBYA 2F98A 3JUQA 4Q53A 3DXOA 3M8CA 4MJDA 1O7GB 5AIHA 1WQLB 3H51A 3GZRA 5IEPA 3D9RA 2W2CA 3IPTA 1SJWA 2PZVA 2YFIB 4J8TA 4XDWA 1S5AA 4R9LA 2GBWB 3CNMA 2INXA 5D81A 1OCVA 3MG3A 3MG2A 5AI1A 3UJMA 1JN5B 3F14A 3DM8A 2HMKB 1Q42A 4LMIA 4HM1B 1GY7A 2F86B 4WYKB 5D82A 5D83A 2HMJB 1OPYA 3LZAA 1BUQA 1O7MB 1E3VA 2B24B 4HM0B 4LGQA 1Q40B 4HM6B 5IEOA 1JB5A 4HVNA 1QJGA 3EQQB 4HZBB 3E99A 5IG0A 5AIGA 5HGRA 3KKGA 4XB5A 3NV0B 4H3UA 2GXFA 1IDPA 3OXAA 3T8UA 4XDVA 4U13A 3FLJA 3KZTA 4X2HA 1O7WB 1HKXA 2HMNB 4HM4B 3EBYA 3NUVA 1W01A 2RCDA 3ECFA 4WWUC 3ROBA 2RFRA 3KE7A 3WMDA 1JN5A 5BVBA 1UUVB 3MKIA 3FSDA 1K41A 1O7NB 4RZMA 1EG9B 3B4OA 3ER7A 3Q90A 5TGNA 3KSPA 3G0KA 1AR0A 3F40A 2XRXB 4HKVB 3K0ZA 3OWSA 2A15A 3LYGA 3OV4A 1STDA 5KP1A 3F7SA 3NHXA 1DMQA 3SOAA 3VSYA 1W6YA 1VZZA 5AEUB 2XSOB 4CDLA 2XR8B 1OGXA 2OWPA 1NU3A 3NV0A 1GY5A 5CLKA 4ORLA 1ISKA 4XBTA 2UX0A 1UUWB 4K1UA 1E97A 2BNGA 3JUMA 3NXJA 3MSOA 3FF2A 4HM8B 4HM2B
chains in the Genus database with same CATH superfamily
3HK4A 3N54B 1MWSA 1UCKA 2FXTA 1UUGB 1OF5A 2HMLB 1OGZA 2XH9A 3B4PA 1LVNA 1BSEA 4LEHA 5M1AA 1K28A 2F5WA 1A90A 4WHAA 1DETA 1E3RA 4O3VA 3DGYA 1X1XA 4LZIA 2GU1A 4OVMA 1QVF2 4MMZB 1W6GA 2E2VA 2ML6A 4BU4A 3T0UA 1MOLA 5DREA 3RGRA 4GHOA 3NX0A 1FUTA 1PYLA 1X1UA 2BHMA 2CHCA 3U1WA 1RTUA 3EX9A 3F8HA 3LMLA 3MYTA 2F56A 1JKGB 1VQL3 1EEJA 1RGCA 4GSPA 1JB2A 3D3LA 1KD14 1O7PB 3BLZA 3MG1A 2OQEA 2GEYA 5GSPA 2IY2A 4BIRA 4QWTA 2RGQA 2IUJA 2HOHA 1ASKA 3GWRA 2WGOA 4N6UA 1RLSA 2M7OA 3AMOA 3PYJA 4IPBA 3CCV3 3CCR3 1BNEA 3URPA 3NM2A 3DY5A 4XM4A 3VF1A 4O2HA 3G4S3 1YHQ3 2K3DA 3VGNA 1PY3A 1Q824 1TIJA 2Z77A 1C54A 1LQMB 1AVLA 2CG0A 3DGOA 2QIYA 3BB9A 3H3HA 3STDA 3LTDA 4EC6A 3GAXA 1W00A 1R4CA 2RSXA 1I0VA 1ULJB 1OUNA 3DGLA 1TP6A 1A2KA 3CPOA 2HMMB 2ML5A 2WOFA 3GZXB 1OHOA 1N5PA 5IF6A 3GSPA 7STDA 3UNLA 4K90B 1T5YA 4MEIA 1ROAA 1BNFA 2HMOB 4OUQA 2XFSA 4WFOA 1I3IA 1NWWA 1ZS7A 2ZA4A 4HM3B 4K1VA 4XBXA 1DMNA 3ZFZA 2P0MA 5AIIA 2CWUA 1IQYA 1FZUA 3T8NA 5CK6A 1EUIC 3JUOA 1JRQA 2XEPA 3DGNA 4HM8B 4J9AA 4PEJA 2BMOB 4L8OA 1GY6A 4FMAA 3S29A 3AHSA 2W0QA 2Y73A 1C7HA 1VQM3 2Z7AA 2OOVA 1YJN3 1F8NA 1A2PA 1HYFA 3LTAA 4WYKA 3SYUA 3EJVA 6GSPA 4HYZA 3WR2A 6STDA 3CNXA 3CCE3 1GS3A 1RHLA 2LQVA 2C10A 4I5QA 1Y4KA 2KAAA 1LRAA 1MWUA 3CC23 1RGAA 4ZM8A 4L7KA 1BRJA 2R41A 4FCJA 3OX9A 4FR9A 3EN1B 1RKYA 5ELJA 1YIT3 3FGYA 4OK0A 5FW5A 1JV2B 1GOVA 3G8ZA 1Q40A 1OH0A 1WMPA 2P05A 5LC6A 2E2UA 3FG4A 5FGOA 2WOHA 4BL3A 1LOWA 1QVG2 2K54A 2BU4A 3CCQ3 4NPBA 3K7CA 1IV9A 3K63A 1TTOA 1QAFA 3PXMA 3MHEA 5KP4A 3F8XA 5DRVA 3TDGA 1DVDA 3RDEA 1JNQA 1RGLA 1Z1SA 2PNCA 4FCMA 4AKZA 1O7HB 4GL6A 3FH1A 2F5MA 3FKAA 1I3FA 1QAKA 1IVUA 3EC9A 4HJLB 5IERA 2P38A 1VQ73 3FZWA 3B7CA 1B21A 2KF5A 3NM7A 4JRFA 2YFLB 1CYVA 3EB8A 3LTCA 8CHOA 1Q7Y4 1SQWA 1MNLA 1RGEA 1UGIA 3FCSB 3SXXA 1R4YA 2CX1A 1OHSA 1RSNA 2QGUA 1JKGA 5AIFA 1PFPA 4GB5A 5EVHA 1BRGA 4HZ9B 4EXRA 3OWUA 1GMQA 1LOVA 1DMMA 3BNEA 4N6MA 1FW7A 2W9PA 5CF2A 3CU3A 5LC7A 1YVSA 2CKFB 4R1KA 1M1K4 3EF8A 1UW1A 1BU4A 3N8BA 3I553 1A67A 5JPUA 3HOHA 1YI23 3DH2A 3EHCA 4N3VA 4AKYA 4ILFA 3X40A 1Q864 1K8A4 3FG3A 1TJDA 3HZPA 3WHOA 2F99A 1W02A 1NNVA 5IG5A 4J5GA 1RN1A 2SARA 4L8PA 1ROVA 1L5GB 2GU3A 1VQO3 1QMAA 2BMQB 3KSED 2XGNA 1CQSA 3D5GA 1N9JA 2Z76A 3LOYA 1B2MA 1GOYA 4LYLB 3QK9A 1V74A 2J8XB 1NO3A 4X2OA 1T3BA 1TUHA 2Q07A 1I8VA 4STDA 2H0IA 2D42A 3AHWA 3F9SA 3GZYB 5KP3A 4EBGA 1YVBI 3GZBA 1BAOA 1U8CB 3LT9A 5G1KA 5JPPA 4HM7B 1SIHA 3SVAA 3KFQC 4WP5A 3SEDA 1MWRA 3LT8A 1YGWA 4HOHA 1OHPA 1N9EA 2KXGA 1UI8A 3I0YA 4MMYB 2I9WA 3NQZA 5AEWB 1NB5I 3WODG 1WNHA 1BRSA 3GRDA 3WA2X 3NBJA 4NREA 1TRQA 1ZO2A 1U5OA 3X42A 1ULIB 3DMCA 4I4KA 1JBSA 2GEXA 1GYBA 4HM5B 1BNJA 2KF6A 1EA2A 2IMJA 5STDA 3OWYA 5IG4A 2C11A 1W7CA 4R80A 5ELUA 4N6NB 1BANA 3A76A 5G2GA 2GBXB 3F7XA 3FF0A 5IG3A 3OW22 3G16A 1JBRA 4LSOA 1S723 3BIRA 3JUPA 4HAAA 2YX9A 3JUNA 3QRDA 1BRHA 5IENA 3PCRA 2XSHB 4FMDA 3HX8A 4KZ1A 1RJOA 2R4IA 2KRTA 1AV4A 3NBRA 3Q1CA 4IIAA 1HU9A 1AQZA 1JZDA 3FG1A 5CXOA 1G02A 3SOYA 2BO9B 4EV5A 3NQYA 1ZX2A 4CCVA 2B1XB 1JBTA 1D6YA 2YFJB 3V92A 5BXQA 5M19A 1A2VA 1RRLA 1GD4A 2UGIA 2BIRA 1BIRA 2Z6BA 1W5ZA 1RMSA 1D6UA 2CH9A 1IK3A 1CEWI 1JB4A 4CPKA 4KVHA 4AEQA 3PCSA 1NDOB 1VQK3 4R9KA 5I97A 2STDA 1OF5B 2BMRB 1STFI 4FMBA 1BNRA 3PS8A 3B8LA 3EBTA 2FNQA 2JQ5A 3EN8A 1LOXA 5CF1A 4KFEA 1FGMA 3DZLA 1IVWA 1VQQA 2F98A 4XBYA 3HIIA 3CCS3 5JBSA 1LNHA 3JUQA 3M8CA 3DXOA 4Q53A 1KC84 3IMAB 1O7GB 1WMOA 4MJDA 2IYJA 1K734 2CFKA 2FGTA 1TFKA 5AIHA 3SLUA 3WOFB 1KWIA 1VQ53 4BL2A 3CCU3 3CME3 2OTJ3 2W04A 4O02B 1WQLB 2P09A 4BTWA 5EEOA 3HIGA 3H51A 2F4YA 3Q2PA 5BIRA 4CJNA 3CMA3 3GZRA 1UCJA 1UGHI 2K0MA 4N6V0 5IEPA 3D9RA 1T2IA 2Y74A 2W2CA 3AMOB 4RBNA 1GOUA 1AY7A 1W2B2 3IPTA 1IYYA 1SJWA 1SARA 1X1WA 2CFLA 2PZVA 3BNDA 1VQP3 1B27A 2YFIB 4J8TA 1LQGC 3LH4A 4HBRA 4NHFA 3A5EA 4XDWA 3V99A 1S5AA 4R9LA 2GBWB 1I2GA 1I70A 3D79A 3KCHA 3CNMA 3X3XA 3LTBA 3N9HA 5A0OB 7RNTA 2INXA 5D81A 1CYUA 1OCVA 4RNZA 1BOXA 4TX4A 2W56B 3MG3A 2W6JH 1G96A 1W6CA 4JF8A 3MG2A 5AI1A 3UJMA 1JN5B 5M18A 1NJI4 5AYSC 4N6OB 3F14A 3DGMA 3DM8A 2H0GA 1DYUA 2ZHXB 2HMKB 1Q42A 4O8SA 1BRKA 4LMIA 3S27A 2XF3A 5EQLA 2L1SA 3BNBA 1OACA 3U97A 6RNTA 4HM1B 1VQ43 3NBBA 1JZOA 3D4AA 1GY7A 2F86B 4WYKB 1I0XA 5D82A 3RNTA 5D83A 2HMJB 1I2FA 3G6E3 1OPYA 3CC43 4FMCA 3LZAA 1BUQA 4J5KA 2AAEA 2CC3A 1WMNA 2CW9A 3ZG5A 1TFOA 1O7MB 1E3VA 3KN4A 2B24B 4HM0B 1W4NA 7GSPA 4LGQA 1Q40B 4HM6B 2AADA 1IQ8A 2E2TA 3X41A 1D6ZA 1NB3I 2CIUA 2GSPA 5IEOA 3CD63 1LNIA 1QALA 1JB5A 1TRPA 1US1A 3LXUX 4HVNA 1QJGA 3EQQB 2V1LA 3AGNA 1X1YA 3J7Yd 1V58A 4HZBB 2CWTA 2D1WA 3E99A 1JJ22 5IG0A 5AIGA 2CG1A 3S5CA 3PGBA 5HGRA 1B2XA 1RDSA 1FYSA 2OOVC 4BTYA 3KKGA 1RN4A 2H0HA 4XB5A 1BSDA 1B3SA 2WGQA 1GSPA 3NV0B 4H3UA 3ZG0A 2GXFA 1FA3A 3BNCA 3X3ZA 2RNTA 1IDPA 3OXAA 3T8UA 3CCM3 1RN7A 1BSCA 4XDVA 2MC8A 1FGOA 4U13A 3FLJA 3BU4A 1BRIA 3KZTA 4X2HA 1UCIA 5AYRB 1UI7A 1BNSA 1O7WB 1BGSA 3MPHA 4R4KA 2CWVA 3S28A 1PU4A 1HKXA 3G713 1UCLA 2HMNB 3CXC2 4HM4B 1RNBA 4N6TA 2CFDA 3WA3A 3JVCA 2QEX3 3EBYA 2CFWA 1WTHA 3NUVA 3WDGB 1FGTA 1B2UA 3S67A 1BSBA 1W01A 5G1LA 2RCDA 1RGKA 2O9UX 1G0TA 1N5HA 3ECFA 1VQN3 1B2SA 4WWUC 4KFFA 3CPW2 3ROBA 1Q7HA 2RBIA 2W56A 3AGOA 3DUKA 2RFRA 3KE7A 5BU4A 3WMDA 1RGGA 1JN5A 2BT3A 5BVBA 1UUVB 3MKIA 3K5TA 1SIIA 1YJ93 1Q814 3IJEB 3CCJ3 2XGLA 3FSDA 3K9MC 1K41A 1O7NB 1YNVX 3PZWA 4RZMA 1EG9B 1SPUA 3HI7A 3L0RA 1YGEA 4K61A 1EKMA 1RNTA 3UB1A 1BSAA 1RCLA 1YIJ3 1RGHA 1V57A 3B4OA 2IA7A 1YJW3 1IT8A 1KSIA 3ER7A 3FF2A 1J2BA 1FGQA 1CH0A 2KF3A 3Q90A 5TGNA 3CC73 2WO0A 5IW9A 3KSPA 3G0KA 2P0XA 3ALAA 2L4VA 4KFDA 1LXEA 2ZL8A 4EYCA 2CK3H 1M1XB 1AR0A 2KF4A 1B20A 3F40A 1HZ1A 1Q9EA 2XRXB 3O8YA 3UL6A 2QA43 1VQ63 1M904 1BNGA 1IV7A 3EE1A 4H61A 1GMRA 2ZDJA 1RCKA 1ZGXA 4HKVB 1VQ83 3K0ZA 1M9GA 2O3OA 1IU7A 3OWSA 2A15A 1AVKA 3LYGA 3OV4A 5RNTA 3KIIA 3RGAA 1STDA 5KP1A 3F7SA 1IVVA 2IUKA 1I2EA 1DMQA 3NHXA 3SOAA 1RGFA 1MGRA 3VSYA 4DKIA 4RNYA 1W6YA 1T2HA 2OQEC 1RRHA 1VZZA 3MWZA 2KCDA 8RNTA 4MMXB 1K9M4 1MWTA 1DE3A 2XFTA 1GMPA 4IT7A 3D5IA 5AEUB 1FUWA 2XSOB 4CDLA 2XR8B 2SBLA 1FGRA 1IQXA 1OGXA 4FCZA 4BTXA 1BNIA 2OWPA 4N6LA 1NU3A 9RNTA 1GD3A 3NV0A 1GY5A 1VQ93 3WOEB 4G1MB 5CLKA 1EQKA 4ORLA 1BVIA 3X3YA 2C4BA 2CFGA 2CX0A 1TU5A 1UDII 2W03A 4KT3B 3SX1A 3UL5A 1ISKA 1N8R4 1B2ZA 5HOHA 4XBTA 1KQS2 2OCTA 4EV2A 2UX0A 1IVXA 1UUWB 2JDIH 1N8QA 2OTL3 1MGWA 4K1UA 1E97A 2BNGA 1DVCA 3Q3FA 3CCL3 1W2ZA 3JUMA 3NXJA 1BRNL 3I563 3V98A 2UUGC 3MSOA 4RNTA 4EW5A 2MF7A 2W9QA 1BUJA 1IT7A 2LYXA 1LOYA 4HM2B 1FUSA
chains in the Genus database with same CATH topology
3HK4A 3N54B 2HMLB 2FXTA 3B4PA 1OF5A 2XH9A 1OGZA 3DUKA 3RGAA 1LVNA 4LEHA 1A90A 1K28A 4WHAA 1E3RA 4O3VA 4LZIA 2GU1A 4OVMA 1QVF2 4MMZB 1W6GA 2E2VA 2ML6A 3T0UA 1MOLA 5DREA 3RGRA 3NX0A 2BHMA 2CHCA 3U1WA 3EX9A 3F8HA 3LMLA 3MYTA 1JKGB 1VQL3 1JB2A 3D3LA 1KD14 1O7PB 3BLZA 3MG1A 2OQEA 2GEYA 4QWTA 2RGQA 2IUJA 1ASKA 3GWRA 2WGOA 4N6UA 2M7OA 3AMOA 3PYJA 3CCV3 4IPBA 3CCR3 3NM2A 3DY5A 4XM4A 3VF1A 4O2HA 3G4S3 1YHQ3 3VGNA 1Q824 1TIJA 2Z77A 1AVLA 2CG0A 3DGOA 2QIYA 3BB9A 3H3HA 3STDA 3LTDA 4EC6A 3GAXA 1W00A 1R4CA 2RSXA 1ULJB 1OUNA 3DGLA 1TP6A 1A2KA 3CPOA 2HMMB 2ML5A 2WOFA 3GZXB 1OHOA 1N5PA 5IF6A 7STDA 3UNLA 4K90B 1T5YA 4MEIA 1ROAA 2HMOB 4OUQA 2XFSA 4WFOA 1NWWA 4HM3B 4K1VA 4XBXA 1DMNA 2P0MA 5AIIA 2CWUA 1IQYA 3T8NA 5CK6A 3JUOA 1JRQA 2XEPA 3DGNA 4HM8B 4J9AA 4PEJA 2BMOB 4L8OA 1GY6A 4FMAA 3S29A 2W0QA 2Y73A 1C7HA 1VQM3 2Z7AA 2OOVA 1YJN3 1F8NA 4WYKA 3LTAA 3EJVA 4HYZA 6STDA 3CNXA 3CCE3 1GS3A 2LQVA 2C10A 1Y4KA 3CC23 4ZM8A 4L7KA 4FCJA 3OX9A 4FR9A 3EN1B 1RKYA 5ELJA 1YIT3 3FGYA 4OK0A 5FW5A 1JV2B 3G8ZA 1Q40A 1OH0A 1WMPA 2P05A 5LC6A 2E2UA 3FG4A 5FGOA 2WOHA 1QVG2 2K54A 3CCQ3 3K7CA 1IV9A 3K63A 1QAFA 3PXMA 3MHEA 5KP4A 3F8XA 5DRVA 3TDGA 1DVDA 3RDEA 1JNQA 1Z1SA 2PNCA 4FCMA 4AKZA 1O7HB 4GL6A 3FH1A 3FKAA 1QAKA 1IVUA 3EC9A 4HJLB 5IERA 2P38A 1VQ73 3FZWA 3B7CA 3NM7A 4JRFA 2YFLB 1CYVA 3EB8A 3LTCA 8CHOA 1Q7Y4 1SQWA 1MNLA 3SXXA 3FCSB 2QGUA 1OHSA 1JKGA 5AIFA 1PFPA 4GB5A 5EVHA 4HZ9B 4EXRA 3OWUA 4N6MA 1DMMA 3BNEA 2W9PA 5CF2A 3CU3A 5LC7A 2CKFB 4R1KA 1M1K4 3EF8A 1UW1A 3N8BA 3I553 1A67A 5JPUA 1YI23 3EHCA 4N3VA 4AKYA 1Q864 3X40A 1K8A4 3FG3A 3HZPA 2F99A 1W02A 5IG5A 4L8PA 1ROVA 1L5GB 2GU3A 1VQO3 1QMAA 2BMQB 3KSED 2XGNA 1CQSA 1N9JA 2Z76A 3LOYA 3QK9A 1V74A 1NO3A 4X2OA 1TUHA 2Q07A 3S5CA 4STDA 3GZYB 2D42A 3F9SA 5KP3A 4EBGA 1YVBI 3GZBA 1U8CB 3LT9A 5JPPA 4HM7B 1SIHA 3SVAA 3KFQC 4WP5A 3SEDA 3LT8A 1OHPA 1N9EA 2KXGA 1UI8A 3I0YA 4MMYB 2I9WA 3NQZA 5AEWB 1NB5I 3WODG 1WNHA 3GRDA 3WA2X 3NBJA 4NREA 1ZO2A 1U5OA 3X42A 1ULIB 3DMCA 4I4KA 2GEXA 1GYBA 4HM5B 1EA2A 2IMJA 5STDA 3OWYA 5IG4A 2C11A 1W7CA 4R80A 5ELUA 4N6NB 3A76A 5IG3A 5G2GA 2GBXB 3F7XA 3FF0A 3OW22 3G16A 4LSOA 1S723 3JUPA 2YX9A 3JUNA 3QRDA 5IENA 3PCRA 2XSHB 4FMDA 3HX8A 4KZ1A 2R4IA 1RJOA 2KRTA 1AV4A 3NBRA 3Q1CA 4IIAA 1HU9A 5CXOA 3FG1A 3SOYA 4EV5A 2BO9B 3NQYA 1ZX2A 4CCVA 2B1XB 1D6YA 2YFJB 3V92A 5BXQA 1A2VA 1RRLA 1GD4A 2Z6BA 1W5ZA 1D6UA 2CH9A 1IK3A 1CEWI 1JB4A 4KVHA 4AEQA 3PCSA 1NDOB 1VQK3 4R9KA 5I97A 2STDA 1OF5B 2BMRB 1STFI 4FMBA 3PS8A 3B8LA 3EBTA 2FNQA 2JQ5A 3EN8A 1LOXA 5CF1A 4KFEA 1FGMA 3DZLA 1IVWA 4XBYA 2F98A 3HIIA 3CCS3 5JBSA 1LNHA 3JUQA 3M8CA 3DXOA 4Q53A 1KC84 3IMAB 1O7GB 1WMOA 4MJDA 1K734 2CFKA 2FGTA 1TFKA 5AIHA 3SLUA 3WOFB 1KWIA 1VQ53 3CCU3 3CME3 2OTJ3 2W04A 4O02B 1WQLB 2P09A 4BTWA 5EEOA 3HIGA 3H51A 3Q2PA 3CMA3 3GZRA 2K0MA 4N6V0 5IEPA 3D9RA 2Y74A 2W2CA 3AMOB 4RBNA 1W2B2 3IPTA 1SJWA 3BNDA 2CFLA 2PZVA 1VQP3 2YFIB 4J8TA 3LH4A 4HBRA 4NHFA 4XDWA 3V99A 1S5AA 4R9LA 2GBWB 3CNMA 3X3XA 3LTBA 3N9HA 5A0OB 2INXA 5D81A 1CYUA 1OCVA 4RNZA 4TX4A 2W56B 3MG3A 2W6JH 1G96A 1W6CA 4JF8A 3MG2A 5AI1A 3UJMA 1JN5B 1NJI4 5AYSC 4N6OB 3F14A 3DGMA 3DM8A 1DYUA 2HMKB 1Q42A 4O8SA 4LMIA 3S27A 2XF3A 5EQLA 3BNBA 1OACA 3U97A 4HM1B 1VQ43 3NBBA 1GY7A 2F86B 4WYKB 5D82A 5D83A 2HMJB 3G6E3 1OPYA 3CC43 4FMCA 3LZAA 1BUQA 2CC3A 1WMNA 2CW9A 1TFOA 1O7MB 1E3VA 3KN4A 2B24B 4HM0B 1W4NA 4LGQA 1Q40B 4HM6B 1IQ8A 2E2TA 3X41A 1D6ZA 1NB3I 2CIUA 5IEOA 3CD63 1QALA 1JB5A 1US1A 3LXUX 4HVNA 1QJGA 3EQQB 2V1LA 3J7Yd 4HZBB 2CWTA 2D1WA 3E99A 1JJ22 5IG0A 5AIGA 2CG1A 3PGBA 5HGRA 2OOVC 4BTYA 3KKGA 4XB5A 2WGQA 3NV0B 4H3UA 2GXFA 1FA3A 3BNCA 3X3ZA 1IDPA 3OXAA 3T8UA 3CCM3 1RN7A 4XDVA 2MC8A 1FGOA 4U13A 3FLJA 3KZTA 4X2HA 5AYRB 1UI7A 1O7WB 3MPHA 4R4KA 1PU4A 2CWVA 3S28A 3G713 1HKXA 3CXC2 2HMNB 4HM4B 4N6TA 2CFDA 3WA3A 3JVCA 2QEX3 3EBYA 2CFWA 1WTHA 3NUVA 3WDGB 1FGTA 3S67A 1W01A 2RCDA 2O9UX 3ECFA 1N5HA 1VQN3 4WWUC 4KFFA 3CPW2 3ROBA 2W56A 2RFRA 3KE7A 3WMDA 1JN5A 2BT3A 5BVBA 1UUVB 3MKIA 3K5TA 1SIIA 1YJ93 1Q814 3IJEB 3CCJ3 2XGLA 3FSDA 3K9MC 1K41A 1O7NB 3PZWA 4RZMA 1EG9B 1SPUA 3HI7A 3L0RA 1YGEA 4K61A 1EKMA 3UB1A 1YIJ3 1YJW3 3B4OA 2IA7A 1IT8A 1KSIA 3ER7A 3FF2A 1J2BA 1FGQA 3Q90A 3CC73 5TGNA 2WO0A 5IW9A 3KSPA 3G0KA 2P0XA 3ALAA 2L4VA 4KFDA 1LXEA 2ZL8A 4EYCA 2CK3H 1M1XB 1AR0A 1VQ63 3F40A 3UL6A 2XRXB 3O8YA 2QA43 1M904 1IV7A 3EE1A 4H61A 2ZDJA 4HKVB 1VQ83 3K0ZA 1M9GA 2O3OA 1IU7A 3OWSA 2A15A 1AVKA 3LYGA 3OV4A 3KIIA 1STDA 5KP1A 3F7SA 1IVVA 2IUKA 3NHXA 1DMQA 3SOAA 3VSYA 4RNYA 1W6YA 2OQEC 1RRHA 1VZZA 3MWZA 2KCDA 4MMXB 1K9M4 2XFTA 4IT7A 5AEUB 1FUWA 2XSOB 4CDLA 2XR8B 2SBLA 1FGRA 1IQXA 1OGXA 4FCZA 4BTXA 2OWPA 4N6LA 1NU3A 1GD3A 3NV0A 1GY5A 1VQ93 3WOEB 4G1MB 5CLKA 1EQKA 4ORLA 3X3YA 2CFGA 1TU5A 3UL5A 2W03A 3SX1A 1ISKA 1N8R4 4XBTA 1KQS2 2OCTA 4EV2A 2UX0A 1IVXA 1UUWB 2JDIH 1N8QA 2OTL3 4K1UA 1E97A 2BNGA 1DVCA 3CCL3 1W2ZA 3JUMA 3NXJA 3I563 3V98A 3MSOA 2MF7A 2W9QA 1IT7A 2LYXA 4HM2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK4 A;  2HML B;  3B4P A;  3DUK A;  1OF5 A;  3RGA A;  1OGZ A;  4LEH A;  1E3R A;  4OVM A;  5DRE A;  3RGR A;  2CHC A;  3EX9 A;  3F8H A;  3MYT A;  1JKG B;  1JB2 A;  1O7P B;  3BLZ A;  3MG1 A;  2GEY A;  2RGQ A;  1ASK A;  3GWR A;  3NM2 A;  4XM4 A;  3VGN A;  2Z77 A;  2QIY A;  3BB9 A;  3H3H A;  3STD A;  1W00 A;  1ULJ B;  1OUN A;  1TP6 A;  1A2K A;  3CPO A;  2HMM B;  5IF6 A;  3GZX B;  1OHO A;  7STD A;  3UNL A;  2HMO B;  4OUQ A;  1NWW A;  4HM3 B;  4K1V A;  4XBX A;  1DMN A;  5AII A;  3T8N A;  5CK6 A;  3JUO A;  4PEJ A;  4J9A A;  2BMO B;  4L8O A;  1GY6 A;  1C7H A;  2Z7A A;  4WYK A;  3EJV A;  6STD A;  3CNX A;  1GS3 A;  4L7K A;  4FCJ A;  3OX9 A;  3EN1 B;  3FGY A;  5FW5 A;  3G8Z A;  1Q40 A;  1OH0 A;  2K54 A;  3K7C A;  5KP4 A;  3MHE A;  3F8X A;  5DRV A;  1Z1S A;  4FCM A;  1O7H B;  3FH1 A;  3FKA A;  3EC9 A;  4HJL B;  5IER A;  3FZW A;  3B7C A;  2YFL B;  8CHO A;  2QGU A;  1OHS A;  1JKG A;  5AIF A;  4GB5 A;  5EVH A;  4HZ9 B;  3OWU A;  1DMM A;  5CF2 A;  3CU3 A;  2CKF B;  4R1K A;  3EF8 A;  5JPU A;  3EHC A;  4N3V A;  3HZP A;  2F99 A;  1W02 A;  5IG5 A;  4L8P A;  1QMA A;  2BMQ B;  1CQS A;  2Z76 A;  4X2O A;  1TUH A;  3S5C A;  4STD A;  3GZY B;  5KP3 A;  3F9S A;  3GZB A;  5JPP A;  4HM7 B;  4WP5 A;  3SED A;  1OHP A;  3I0Y A;  2I9W A;  5AEW B;  3GRD A;  1ZO2 A;  1U5O A;  1ULI B;  3DMC A;  4I4K A;  2GEX A;  1GYB A;  4HM5 B;  1EA2 A;  2IMJ A;  5STD A;  3OWY A;  5IG4 A;  3A76 A;  5IG3 A;  5G2G A;  2GBX B;  3F7X A;  3FF0 A;  3G16 A;  3JUP A;  3JUN A;  5IEN A;  2XSH B;  3HX8 A;  2R4I A;  3NBR A;  4IIA A;  3SOY A;  5CXO A;  1ZX2 A;  2B1X B;  2YFJ B;  5BXQ A;  1JB4 A;  4KVH A;  1NDO B;  4R9K A;  2STD A;  1OF5 B;  2BMR B;  3B8L A;  3EBT A;  2JQ5 A;  3EN8 A;  5CF1 A;  3DZL A;  4XBY A;  2F98 A;  3JUQ A;  4Q53 A;  3DXO A;  3M8C A;  4MJD A;  1O7G B;  5AIH A;  1WQL B;  3H51 A;  3GZR A;  5IEP A;  3D9R A;  2W2C A;  3IPT A;  1SJW A;  2PZV A;  2YFI B;  4J8T A;  4XDW A;  1S5A A;  4R9L A;  2GBW B;  3CNM A;  2INX A;  5D81 A;  1OCV A;  3MG3 A;  3MG2 A;  5AI1 A;  3UJM A;  1JN5 B;  3F14 A;  3DM8 A;  2HMK B;  1Q42 A;  4LMI A;  4HM1 B;  1GY7 A;  2F86 B;  4WYK B;  5D82 A;  5D83 A;  2HMJ B;  1OPY A;  3LZA A;  1BUQ A;  1O7M B;  1E3V A;  2B24 B;  4HM0 B;  4LGQ A;  1Q40 B;  4HM6 B;  5IEO A;  1JB5 A;  4HVN A;  1QJG A;  3EQQ B;  4HZB B;  3E99 A;  5IG0 A;  5AIG A;  5HGR A;  3KKG A;  4XB5 A;  3NV0 B;  4H3U A;  2GXF A;  1IDP A;  3OXA A;  3T8U A;  4XDV A;  4U13 A;  3FLJ A;  3KZT A;  4X2H A;  1O7W B;  1HKX A;  2HMN B;  4HM4 B;  3EBY A;  3NUV A;  1W01 A;  2RCD A;  3ECF A;  4WWU C;  3ROB A;  2RFR A;  3KE7 A;  3WMD A;  1JN5 A;  5BVB A;  1UUV B;  3MKI A;  3FSD A;  1K41 A;  1O7N B;  4RZM A;  1EG9 B;  3B4O A;  3ER7 A;  3Q90 A;  5TGN A;  3KSP A;  3G0K A;  1AR0 A;  3F40 A;  2XRX B;  4HKV B;  3K0Z A;  3OWS A;  2A15 A;  3LYG A;  3OV4 A;  1STD A;  5KP1 A;  3F7S A;  3NHX A;  1DMQ A;  3SOA A;  3VSY A;  1W6Y A;  1VZZ A;  5AEU B;  2XSO B;  4CDL A;  2XR8 B;  1OGX A;  2OWP A;  1NU3 A;  3NV0 A;  1GY5 A;  5CLK A;  4ORL A;  1ISK A;  4XBT A;  2UX0 A;  1UUW B;  4K1U A;  1E97 A;  2BNG A;  3JUM A;  3NXJ A;  3MSO A;  3FF2 A;  4HM8 B;  4HM2 B; 
#chains in the Genus database with same CATH topology
 3HK4 A;  3N54 B;  1MWS A;  1UCK A;  2FXT A;  1UUG B;  1OF5 A;  2HML B;  1OGZ A;  2XH9 A;  3B4P A;  1LVN A;  1BSE A;  4LEH A;  5M1A A;  1K28 A;  2F5W A;  1A90 A;  4WHA A;  1DET A;  1E3R A;  4O3V A;  3DGY A;  1X1X A;  4LZI A;  2GU1 A;  4OVM A;  1QVF 2;  4MMZ B;  1W6G A;  2E2V A;  2ML6 A;  4BU4 A;  3T0U A;  1MOL A;  5DRE A;  3RGR A;  4GHO A;  3NX0 A;  1FUT A;  1PYL A;  1X1U A;  2BHM A;  2CHC A;  3U1W A;  1RTU A;  3EX9 A;  3F8H A;  3LML A;  3MYT A;  2F56 A;  1JKG B;  1VQL 3;  1EEJ A;  1RGC A;  4GSP A;  1JB2 A;  3D3L A;  1KD1 4;  1O7P B;  3BLZ A;  3MG1 A;  2OQE A;  2GEY A;  5GSP A;  2IY2 A;  4BIR A;  4QWT A;  2RGQ A;  2IUJ A;  2HOH A;  1ASK A;  3GWR A;  2WGO A;  4N6U A;  1RLS A;  2M7O A;  3AMO A;  3PYJ A;  4IPB A;  3CCV 3;  3CCR 3;  1BNE A;  3URP A;  3NM2 A;  3DY5 A;  4XM4 A;  3VF1 A;  4O2H A;  3G4S 3;  1YHQ 3;  2K3D A;  3VGN A;  1PY3 A;  1Q82 4;  1TIJ A;  2Z77 A;  1C54 A;  1LQM B;  1AVL A;  2CG0 A;  3DGO A;  2QIY A;  3BB9 A;  3H3H A;  3STD A;  3LTD A;  4EC6 A;  3GAX A;  1W00 A;  1R4C A;  2RSX A;  1I0V A;  1ULJ B;  1OUN A;  3DGL A;  1TP6 A;  1A2K A;  3CPO A;  2HMM B;  2ML5 A;  2WOF A;  3GZX B;  1OHO A;  1N5P A;  5IF6 A;  3GSP A;  7STD A;  3UNL A;  4K90 B;  1T5Y A;  4MEI A;  1ROA A;  1BNF A;  2HMO B;  4OUQ A;  2XFS A;  4WFO A;  1I3I A;  1NWW A;  1ZS7 A;  2ZA4 A;  4HM3 B;  4K1V A;  4XBX A;  1DMN A;  3ZFZ A;  2P0M A;  5AII A;  2CWU A;  1IQY A;  1FZU A;  3T8N A;  5CK6 A;  1EUI C;  3JUO A;  1JRQ A;  2XEP A;  3DGN A;  4HM8 B;  4J9A A;  4PEJ A;  2BMO B;  4L8O A;  1GY6 A;  4FMA A;  3S29 A;  3AHS A;  2W0Q A;  2Y73 A;  1C7H A;  1VQM 3;  2Z7A A;  2OOV A;  1YJN 3;  1F8N A;  1A2P A;  1HYF A;  3LTA A;  4WYK A;  3SYU A;  3EJV A;  6GSP A;  4HYZ A;  3WR2 A;  6STD A;  3CNX A;  3CCE 3;  1GS3 A;  1RHL A;  2LQV A;  2C10 A;  4I5Q A;  1Y4K A;  2KAA A;  1LRA A;  1MWU A;  3CC2 3;  1RGA A;  4ZM8 A;  4L7K A;  1BRJ A;  2R41 A;  4FCJ A;  3OX9 A;  4FR9 A;  3EN1 B;  1RKY A;  5ELJ A;  1YIT 3;  3FGY A;  4OK0 A;  5FW5 A;  1JV2 B;  1GOV A;  3G8Z A;  1Q40 A;  1OH0 A;  1WMP A;  2P05 A;  5LC6 A;  2E2U A;  3FG4 A;  5FGO A;  2WOH A;  4BL3 A;  1LOW A;  1QVG 2;  2K54 A;  2BU4 A;  3CCQ 3;  4NPB A;  3K7C A;  1IV9 A;  3K63 A;  1TTO A;  1QAF A;  3PXM A;  3MHE A;  5KP4 A;  3F8X A;  5DRV A;  3TDG A;  1DVD A;  3RDE A;  1JNQ A;  1RGL A;  1Z1S A;  2PNC A;  4FCM A;  4AKZ A;  1O7H B;  4GL6 A;  3FH1 A;  2F5M A;  3FKA A;  1I3F A;  1QAK A;  1IVU A;  3EC9 A;  4HJL B;  5IER A;  2P38 A;  1VQ7 3;  3FZW A;  3B7C A;  1B21 A;  2KF5 A;  3NM7 A;  4JRF A;  2YFL B;  1CYV A;  3EB8 A;  3LTC A;  8CHO A;  1Q7Y 4;  1SQW A;  1MNL A;  1RGE A;  1UGI A;  3FCS B;  3SXX A;  1R4Y A;  2CX1 A;  1OHS A;  1RSN A;  2QGU A;  1JKG A;  5AIF A;  1PFP A;  4GB5 A;  5EVH A;  1BRG A;  4HZ9 B;  4EXR A;  3OWU A;  1GMQ A;  1LOV A;  1DMM A;  3BNE A;  4N6M A;  1FW7 A;  2W9P A;  5CF2 A;  3CU3 A;  5LC7 A;  1YVS A;  2CKF B;  4R1K A;  1M1K 4;  3EF8 A;  1UW1 A;  1BU4 A;  3N8B A;  3I55 3;  1A67 A;  5JPU A;  3HOH A;  1YI2 3;  3DH2 A;  3EHC A;  4N3V A;  4AKY A;  4ILF A;  3X40 A;  1Q86 4;  1K8A 4;  3FG3 A;  1TJD A;  3HZP A;  3WHO A;  2F99 A;  1W02 A;  1NNV A;  5IG5 A;  4J5G A;  1RN1 A;  2SAR A;  4L8P A;  1ROV A;  1L5G B;  2GU3 A;  1VQO 3;  1QMA A;  2BMQ B;  3KSE D;  2XGN A;  1CQS A;  3D5G A;  1N9J A;  2Z76 A;  3LOY A;  1B2M A;  1GOY A;  4LYL B;  3QK9 A;  1V74 A;  2J8X B;  1NO3 A;  4X2O A;  1T3B A;  1TUH A;  2Q07 A;  1I8V A;  4STD A;  2H0I A;  2D42 A;  3AHW A;  3F9S A;  3GZY B;  5KP3 A;  4EBG A;  1YVB I;  3GZB A;  1BAO A;  1U8C B;  3LT9 A;  5G1K A;  5JPP A;  4HM7 B;  1SIH A;  3SVA A;  3KFQ C;  4WP5 A;  3SED A;  1MWR A;  3LT8 A;  1YGW A;  4HOH A;  1OHP A;  1N9E A;  2KXG A;  1UI8 A;  3I0Y A;  4MMY B;  2I9W A;  3NQZ A;  5AEW B;  1NB5 I;  3WOD G;  1WNH A;  1BRS A;  3GRD A;  3WA2 X;  3NBJ A;  4NRE A;  1TRQ A;  1ZO2 A;  1U5O A;  3X42 A;  1ULI B;  3DMC A;  4I4K A;  1JBS A;  2GEX A;  1GYB A;  4HM5 B;  1BNJ A;  2KF6 A;  1EA2 A;  2IMJ A;  5STD A;  3OWY A;  5IG4 A;  2C11 A;  1W7C A;  4R80 A;  5ELU A;  4N6N B;  1BAN A;  3A76 A;  5G2G A;  2GBX B;  3F7X A;  3FF0 A;  5IG3 A;  3OW2 2;  3G16 A;  1JBR A;  4LSO A;  1S72 3;  3BIR A;  3JUP A;  4HAA A;  2YX9 A;  3JUN A;  3QRD A;  1BRH A;  5IEN A;  3PCR A;  2XSH B;  4FMD A;  3HX8 A;  4KZ1 A;  1RJO A;  2R4I A;  2KRT A;  1AV4 A;  3NBR A;  3Q1C A;  4IIA A;  1HU9 A;  1AQZ A;  1JZD A;  3FG1 A;  5CXO A;  1G02 A;  3SOY A;  2BO9 B;  4EV5 A;  3NQY A;  1ZX2 A;  4CCV A;  2B1X B;  1JBT A;  1D6Y A;  2YFJ B;  3V92 A;  5BXQ A;  5M19 A;  1A2V A;  1RRL A;  1GD4 A;  2UGI A;  2BIR A;  1BIR A;  2Z6B A;  1W5Z A;  1RMS A;  1D6U A;  2CH9 A;  1IK3 A;  1CEW I;  1JB4 A;  4CPK A;  4KVH A;  4AEQ A;  3PCS A;  1NDO B;  1VQK 3;  4R9K A;  5I97 A;  2STD A;  1OF5 B;  2BMR B;  1STF I;  4FMB A;  1BNR A;  3PS8 A;  3B8L A;  3EBT A;  2FNQ A;  2JQ5 A;  3EN8 A;  1LOX A;  5CF1 A;  4KFE A;  1FGM A;  3DZL A;  1IVW A;  1VQQ A;  2F98 A;  4XBY A;  3HII A;  3CCS 3;  5JBS A;  1LNH A;  3JUQ A;  3M8C A;  3DXO A;  4Q53 A;  1KC8 4;  3IMA B;  1O7G B;  1WMO A;  4MJD A;  2IYJ A;  1K73 4;  2CFK A;  2FGT A;  1TFK A;  5AIH A;  3SLU A;  3WOF B;  1KWI A;  1VQ5 3;  4BL2 A;  3CCU 3;  3CME 3;  2OTJ 3;  2W04 A;  4O02 B;  1WQL B;  2P09 A;  4BTW A;  5EEO A;  3HIG A;  3H51 A;  2F4Y A;  3Q2P A;  5BIR A;  4CJN A;  3CMA 3;  3GZR A;  1UCJ A;  1UGH I;  2K0M A;  4N6V 0;  5IEP A;  3D9R A;  1T2I A;  2Y74 A;  2W2C A;  3AMO B;  4RBN A;  1GOU A;  1AY7 A;  1W2B 2;  3IPT A;  1IYY A;  1SJW A;  1SAR A;  1X1W A;  2CFL A;  2PZV A;  3BND A;  1VQP 3;  1B27 A;  2YFI B;  4J8T A;  1LQG C;  3LH4 A;  4HBR A;  4NHF A;  3A5E A;  4XDW A;  3V99 A;  1S5A A;  4R9L A;  2GBW B;  1I2G A;  1I70 A;  3D79 A;  3KCH A;  3CNM A;  3X3X A;  3LTB A;  3N9H A;  5A0O B;  7RNT A;  2INX A;  5D81 A;  1CYU A;  1OCV A;  4RNZ A;  1BOX A;  4TX4 A;  2W56 B;  3MG3 A;  2W6J H;  1G96 A;  1W6C A;  4JF8 A;  3MG2 A;  5AI1 A;  3UJM A;  1JN5 B;  5M18 A;  1NJI 4;  5AYS C;  4N6O B;  3F14 A;  3DGM A;  3DM8 A;  2H0G A;  1DYU A;  2ZHX B;  2HMK B;  1Q42 A;  4O8S A;  1BRK A;  4LMI A;  3S27 A;  2XF3 A;  5EQL A;  2L1S A;  3BNB A;  1OAC A;  3U97 A;  6RNT A;  4HM1 B;  1VQ4 3;  3NBB A;  1JZO A;  3D4A A;  1GY7 A;  2F86 B;  4WYK B;  1I0X A;  5D82 A;  3RNT A;  5D83 A;  2HMJ B;  1I2F A;  3G6E 3;  1OPY A;  3CC4 3;  4FMC A;  3LZA A;  1BUQ A;  4J5K A;  2AAE A;  2CC3 A;  1WMN A;  2CW9 A;  3ZG5 A;  1TFO A;  1O7M B;  1E3V A;  3KN4 A;  2B24 B;  4HM0 B;  1W4N A;  7GSP A;  4LGQ A;  1Q40 B;  4HM6 B;  2AAD A;  1IQ8 A;  2E2T A;  3X41 A;  1D6Z A;  1NB3 I;  2CIU A;  2GSP A;  5IEO A;  3CD6 3;  1LNI A;  1QAL A;  1JB5 A;  1TRP A;  1US1 A;  3LXU X;  4HVN A;  1QJG A;  3EQQ B;  2V1L A;  3AGN A;  1X1Y A;  3J7Y d;  1V58 A;  4HZB B;  2CWT A;  2D1W A;  3E99 A;  1JJ2 2;  5IG0 A;  5AIG A;  2CG1 A;  3S5C A;  3PGB A;  5HGR A;  1B2X A;  1RDS A;  1FYS A;  2OOV C;  4BTY A;  3KKG A;  1RN4 A;  2H0H A;  4XB5 A;  1BSD A;  1B3S A;  2WGQ A;  1GSP A;  3NV0 B;  4H3U A;  3ZG0 A;  2GXF A;  1FA3 A;  3BNC A;  3X3Z A;  2RNT A;  1IDP A;  3OXA A;  3T8U A;  3CCM 3;  1RN7 A;  1BSC A;  4XDV A;  2MC8 A;  1FGO A;  4U13 A;  3FLJ A;  3BU4 A;  1BRI A;  3KZT A;  4X2H A;  1UCI A;  5AYR B;  1UI7 A;  1BNS A;  1O7W B;  1BGS A;  3MPH A;  4R4K A;  2CWV A;  3S28 A;  1PU4 A;  1HKX A;  3G71 3;  1UCL A;  2HMN B;  3CXC 2;  4HM4 B;  1RNB A;  4N6T A;  2CFD A;  3WA3 A;  3JVC A;  2QEX 3;  3EBY A;  2CFW A;  1WTH A;  3NUV A;  3WDG B;  1FGT A;  1B2U A;  3S67 A;  1BSB A;  1W01 A;  5G1L A;  2RCD A;  1RGK A;  2O9U X;  1G0T A;  1N5H A;  3ECF A;  1VQN 3;  1B2S A;  4WWU C;  4KFF A;  3CPW 2;  3ROB A;  1Q7H A;  2RBI A;  2W56 A;  3AGO A;  3DUK A;  2RFR A;  3KE7 A;  5BU4 A;  3WMD A;  1RGG A;  1JN5 A;  2BT3 A;  5BVB A;  1UUV B;  3MKI A;  3K5T A;  1SII A;  1YJ9 3;  1Q81 4;  3IJE B;  3CCJ 3;  2XGL A;  3FSD A;  3K9M C;  1K41 A;  1O7N B;  1YNV X;  3PZW A;  4RZM A;  1EG9 B;  1SPU A;  3HI7 A;  3L0R A;  1YGE A;  4K61 A;  1EKM A;  1RNT A;  3UB1 A;  1BSA A;  1RCL A;  1YIJ 3;  1RGH A;  1V57 A;  3B4O A;  2IA7 A;  1YJW 3;  1IT8 A;  1KSI A;  3ER7 A;  3FF2 A;  1J2B A;  1FGQ A;  1CH0 A;  2KF3 A;  3Q90 A;  5TGN A;  3CC7 3;  2WO0 A;  5IW9 A;  3KSP A;  3G0K A;  2P0X A;  3ALA A;  2L4V A;  4KFD A;  1LXE A;  2ZL8 A;  4EYC A;  2CK3 H;  1M1X B;  1AR0 A;  2KF4 A;  1B20 A;  3F40 A;  1HZ1 A;  1Q9E A;  2XRX B;  3O8Y A;  3UL6 A;  2QA4 3;  1VQ6 3;  1M90 4;  1BNG A;  1IV7 A;  3EE1 A;  4H61 A;  1GMR A;  2ZDJ A;  1RCK A;  1ZGX A;  4HKV B;  1VQ8 3;  3K0Z A;  1M9G A;  2O3O A;  1IU7 A;  3OWS A;  2A15 A;  1AVK A;  3LYG A;  3OV4 A;  5RNT A;  3KII A;  3RGA A;  1STD A;  5KP1 A;  3F7S A;  1IVV A;  2IUK A;  1I2E A;  1DMQ A;  3NHX A;  3SOA A;  1RGF A;  1MGR A;  3VSY A;  4DKI A;  4RNY A;  1W6Y A;  1T2H A;  2OQE C;  1RRH A;  1VZZ A;  3MWZ A;  2KCD A;  8RNT A;  4MMX B;  1K9M 4;  1MWT A;  1DE3 A;  2XFT A;  1GMP A;  4IT7 A;  3D5I A;  5AEU B;  1FUW A;  2XSO B;  4CDL A;  2XR8 B;  2SBL A;  1FGR A;  1IQX A;  1OGX A;  4FCZ A;  4BTX A;  1BNI A;  2OWP A;  4N6L A;  1NU3 A;  9RNT A;  1GD3 A;  3NV0 A;  1GY5 A;  1VQ9 3;  3WOE B;  4G1M B;  5CLK A;  1EQK A;  4ORL A;  1BVI A;  3X3Y A;  2C4B A;  2CFG A;  2CX0 A;  1TU5 A;  1UDI I;  2W03 A;  4KT3 B;  3SX1 A;  3UL5 A;  1ISK A;  1N8R 4;  1B2Z A;  5HOH A;  4XBT A;  1KQS 2;  2OCT A;  4EV2 A;  2UX0 A;  1IVX A;  1UUW B;  2JDI H;  1N8Q A;  2OTL 3;  1MGW A;  4K1U A;  1E97 A;  2BNG A;  1DVC A;  3Q3F A;  3CCL 3;  1W2Z A;  3JUM A;  3NXJ A;  1BRN L;  3I56 3;  3V98 A;  2UUG C;  3MSO A;  4RNT A;  4EW5 A;  2MF7 A;  2W9Q A;  1BUJ A;  1IT7 A;  2LYX A;  1LOY A;  4HM2 B;  1FUS A; 
#chains in the Genus database with same CATH homology
 3HK4 A;  3N54 B;  2HML B;  2FXT A;  3B4P A;  1OF5 A;  2XH9 A;  1OGZ A;  3DUK A;  3RGA A;  1LVN A;  4LEH A;  1A90 A;  1K28 A;  4WHA A;  1E3R A;  4O3V A;  4LZI A;  2GU1 A;  4OVM A;  1QVF 2;  4MMZ B;  1W6G A;  2E2V A;  2ML6 A;  3T0U A;  1MOL A;  5DRE A;  3RGR A;  3NX0 A;  2BHM A;  2CHC A;  3U1W A;  3EX9 A;  3F8H A;  3LML A;  3MYT A;  1JKG B;  1VQL 3;  1JB2 A;  3D3L A;  1KD1 4;  1O7P B;  3BLZ A;  3MG1 A;  2OQE A;  2GEY A;  4QWT A;  2RGQ A;  2IUJ A;  1ASK A;  3GWR A;  2WGO A;  4N6U A;  2M7O A;  3AMO A;  3PYJ A;  3CCV 3;  4IPB A;  3CCR 3;  3NM2 A;  3DY5 A;  4XM4 A;  3VF1 A;  4O2H A;  3G4S 3;  1YHQ 3;  3VGN A;  1Q82 4;  1TIJ A;  2Z77 A;  1AVL A;  2CG0 A;  3DGO A;  2QIY A;  3BB9 A;  3H3H A;  3STD A;  3LTD A;  4EC6 A;  3GAX A;  1W00 A;  1R4C A;  2RSX A;  1ULJ B;  1OUN A;  3DGL A;  1TP6 A;  1A2K A;  3CPO A;  2HMM B;  2ML5 A;  2WOF A;  3GZX B;  1OHO A;  1N5P A;  5IF6 A;  7STD A;  3UNL A;  4K90 B;  1T5Y A;  4MEI A;  1ROA A;  2HMO B;  4OUQ A;  2XFS A;  4WFO A;  1NWW A;  4HM3 B;  4K1V A;  4XBX A;  1DMN A;  2P0M A;  5AII A;  2CWU A;  1IQY A;  3T8N A;  5CK6 A;  3JUO A;  1JRQ A;  2XEP A;  3DGN A;  4HM8 B;  4J9A A;  4PEJ A;  2BMO B;  4L8O A;  1GY6 A;  4FMA A;  3S29 A;  2W0Q A;  2Y73 A;  1C7H A;  1VQM 3;  2Z7A A;  2OOV A;  1YJN 3;  1F8N A;  4WYK A;  3LTA A;  3EJV A;  4HYZ A;  6STD A;  3CNX A;  3CCE 3;  1GS3 A;  2LQV A;  2C10 A;  1Y4K A;  3CC2 3;  4ZM8 A;  4L7K A;  4FCJ A;  3OX9 A;  4FR9 A;  3EN1 B;  1RKY A;  5ELJ A;  1YIT 3;  3FGY A;  4OK0 A;  5FW5 A;  1JV2 B;  3G8Z A;  1Q40 A;  1OH0 A;  1WMP A;  2P05 A;  5LC6 A;  2E2U A;  3FG4 A;  5FGO A;  2WOH A;  1QVG 2;  2K54 A;  3CCQ 3;  3K7C A;  1IV9 A;  3K63 A;  1QAF A;  3PXM A;  3MHE A;  5KP4 A;  3F8X A;  5DRV A;  3TDG A;  1DVD A;  3RDE A;  1JNQ A;  1Z1S A;  2PNC A;  4FCM A;  4AKZ A;  1O7H B;  4GL6 A;  3FH1 A;  3FKA A;  1QAK A;  1IVU A;  3EC9 A;  4HJL B;  5IER A;  2P38 A;  1VQ7 3;  3FZW A;  3B7C A;  3NM7 A;  4JRF A;  2YFL B;  1CYV A;  3EB8 A;  3LTC A;  8CHO A;  1Q7Y 4;  1SQW A;  1MNL A;  3SXX A;  3FCS B;  2QGU A;  1OHS A;  1JKG A;  5AIF A;  1PFP A;  4GB5 A;  5EVH A;  4HZ9 B;  4EXR A;  3OWU A;  4N6M A;  1DMM A;  3BNE A;  2W9P A;  5CF2 A;  3CU3 A;  5LC7 A;  2CKF B;  4R1K A;  1M1K 4;  3EF8 A;  1UW1 A;  3N8B A;  3I55 3;  1A67 A;  5JPU A;  1YI2 3;  3EHC A;  4N3V A;  4AKY A;  1Q86 4;  3X40 A;  1K8A 4;  3FG3 A;  3HZP A;  2F99 A;  1W02 A;  5IG5 A;  4L8P A;  1ROV A;  1L5G B;  2GU3 A;  1VQO 3;  1QMA A;  2BMQ B;  3KSE D;  2XGN A;  1CQS A;  1N9J A;  2Z76 A;  3LOY A;  3QK9 A;  1V74 A;  1NO3 A;  4X2O A;  1TUH A;  2Q07 A;  3S5C A;  4STD A;  3GZY B;  2D42 A;  3F9S A;  5KP3 A;  4EBG A;  1YVB I;  3GZB A;  1U8C B;  3LT9 A;  5JPP A;  4HM7 B;  1SIH A;  3SVA A;  3KFQ C;  4WP5 A;  3SED A;  3LT8 A;  1OHP A;  1N9E A;  2KXG A;  1UI8 A;  3I0Y A;  4MMY B;  2I9W A;  3NQZ A;  5AEW B;  1NB5 I;  3WOD G;  1WNH A;  3GRD A;  3WA2 X;  3NBJ A;  4NRE A;  1ZO2 A;  1U5O A;  3X42 A;  1ULI B;  3DMC A;  4I4K A;  2GEX A;  1GYB A;  4HM5 B;  1EA2 A;  2IMJ A;  5STD A;  3OWY A;  5IG4 A;  2C11 A;  1W7C A;  4R80 A;  5ELU A;  4N6N B;  3A76 A;  5IG3 A;  5G2G A;  2GBX B;  3F7X A;  3FF0 A;  3OW2 2;  3G16 A;  4LSO A;  1S72 3;  3JUP A;  2YX9 A;  3JUN A;  3QRD A;  5IEN A;  3PCR A;  2XSH B;  4FMD A;  3HX8 A;  4KZ1 A;  2R4I A;  1RJO A;  2KRT A;  1AV4 A;  3NBR A;  3Q1C A;  4IIA A;  1HU9 A;  5CXO A;  3FG1 A;  3SOY A;  4EV5 A;  2BO9 B;  3NQY A;  1ZX2 A;  4CCV A;  2B1X B;  1D6Y A;  2YFJ B;  3V92 A;  5BXQ A;  1A2V A;  1RRL A;  1GD4 A;  2Z6B A;  1W5Z A;  1D6U A;  2CH9 A;  1IK3 A;  1CEW I;  1JB4 A;  4KVH A;  4AEQ A;  3PCS A;  1NDO B;  1VQK 3;  4R9K A;  5I97 A;  2STD A;  1OF5 B;  2BMR B;  1STF I;  4FMB A;  3PS8 A;  3B8L A;  3EBT A;  2FNQ A;  2JQ5 A;  3EN8 A;  1LOX A;  5CF1 A;  4KFE A;  1FGM A;  3DZL A;  1IVW A;  4XBY A;  2F98 A;  3HII A;  3CCS 3;  5JBS A;  1LNH A;  3JUQ A;  3M8C A;  3DXO A;  4Q53 A;  1KC8 4;  3IMA B;  1O7G B;  1WMO A;  4MJD A;  1K73 4;  2CFK A;  2FGT A;  1TFK A;  5AIH A;  3SLU A;  3WOF B;  1KWI A;  1VQ5 3;  3CCU 3;  3CME 3;  2OTJ 3;  2W04 A;  4O02 B;  1WQL B;  2P09 A;  4BTW A;  5EEO A;  3HIG A;  3H51 A;  3Q2P A;  3CMA 3;  3GZR A;  2K0M A;  4N6V 0;  5IEP A;  3D9R A;  2Y74 A;  2W2C A;  3AMO B;  4RBN A;  1W2B 2;  3IPT A;  1SJW A;  3BND A;  2CFL A;  2PZV A;  1VQP 3;  2YFI B;  4J8T A;  3LH4 A;  4HBR A;  4NHF A;  4XDW A;  3V99 A;  1S5A A;  4R9L A;  2GBW B;  3CNM A;  3X3X A;  3LTB A;  3N9H A;  5A0O B;  2INX A;  5D81 A;  1CYU A;  1OCV A;  4RNZ A;  4TX4 A;  2W56 B;  3MG3 A;  2W6J H;  1G96 A;  1W6C A;  4JF8 A;  3MG2 A;  5AI1 A;  3UJM A;  1JN5 B;  1NJI 4;  5AYS C;  4N6O B;  3F14 A;  3DGM A;  3DM8 A;  1DYU A;  2HMK B;  1Q42 A;  4O8S A;  4LMI A;  3S27 A;  2XF3 A;  5EQL A;  3BNB A;  1OAC A;  3U97 A;  4HM1 B;  1VQ4 3;  3NBB A;  1GY7 A;  2F86 B;  4WYK B;  5D82 A;  5D83 A;  2HMJ B;  3G6E 3;  1OPY A;  3CC4 3;  4FMC A;  3LZA A;  1BUQ A;  2CC3 A;  1WMN A;  2CW9 A;  1TFO A;  1O7M B;  1E3V A;  3KN4 A;  2B24 B;  4HM0 B;  1W4N A;  4LGQ A;  1Q40 B;  4HM6 B;  1IQ8 A;  2E2T A;  3X41 A;  1D6Z A;  1NB3 I;  2CIU A;  5IEO A;  3CD6 3;  1QAL A;  1JB5 A;  1US1 A;  3LXU X;  4HVN A;  1QJG A;  3EQQ B;  2V1L A;  3J7Y d;  4HZB B;  2CWT A;  2D1W A;  3E99 A;  1JJ2 2;  5IG0 A;  5AIG A;  2CG1 A;  3PGB A;  5HGR A;  2OOV C;  4BTY A;  3KKG A;  4XB5 A;  2WGQ A;  3NV0 B;  4H3U A;  2GXF A;  1FA3 A;  3BNC A;  3X3Z A;  1IDP A;  3OXA A;  3T8U A;  3CCM 3;  1RN7 A;  4XDV A;  2MC8 A;  1FGO A;  4U13 A;  3FLJ A;  3KZT A;  4X2H A;  5AYR B;  1UI7 A;  1O7W B;  3MPH A;  4R4K A;  1PU4 A;  2CWV A;  3S28 A;  3G71 3;  1HKX A;  3CXC 2;  2HMN B;  4HM4 B;  4N6T A;  2CFD A;  3WA3 A;  3JVC A;  2QEX 3;  3EBY A;  2CFW A;  1WTH A;  3NUV A;  3WDG B;  1FGT A;  3S67 A;  1W01 A;  2RCD A;  2O9U X;  3ECF A;  1N5H A;  1VQN 3;  4WWU C;  4KFF A;  3CPW 2;  3ROB A;  2W56 A;  2RFR A;  3KE7 A;  3WMD A;  1JN5 A;  2BT3 A;  5BVB A;  1UUV B;  3MKI A;  3K5T A;  1SII A;  1YJ9 3;  1Q81 4;  3IJE B;  3CCJ 3;  2XGL A;  3FSD A;  3K9M C;  1K41 A;  1O7N B;  3PZW A;  4RZM A;  1EG9 B;  1SPU A;  3HI7 A;  3L0R A;  1YGE A;  4K61 A;  1EKM A;  3UB1 A;  1YIJ 3;  1YJW 3;  3B4O A;  2IA7 A;  1IT8 A;  1KSI A;  3ER7 A;  3FF2 A;  1J2B A;  1FGQ A;  3Q90 A;  3CC7 3;  5TGN A;  2WO0 A;  5IW9 A;  3KSP A;  3G0K A;  2P0X A;  3ALA A;  2L4V A;  4KFD A;  1LXE A;  2ZL8 A;  4EYC A;  2CK3 H;  1M1X B;  1AR0 A;  1VQ6 3;  3F40 A;  3UL6 A;  2XRX B;  3O8Y A;  2QA4 3;  1M90 4;  1IV7 A;  3EE1 A;  4H61 A;  2ZDJ A;  4HKV B;  1VQ8 3;  3K0Z A;  1M9G A;  2O3O A;  1IU7 A;  3OWS A;  2A15 A;  1AVK A;  3LYG A;  3OV4 A;  3KII A;  1STD A;  5KP1 A;  3F7S A;  1IVV A;  2IUK A;  3NHX A;  1DMQ A;  3SOA A;  3VSY A;  4RNY A;  1W6Y A;  2OQE C;  1RRH A;  1VZZ A;  3MWZ A;  2KCD A;  4MMX B;  1K9M 4;  2XFT A;  4IT7 A;  5AEU B;  1FUW A;  2XSO B;  4CDL A;  2XR8 B;  2SBL A;  1FGR A;  1IQX A;  1OGX A;  4FCZ A;  4BTX A;  2OWP A;  4N6L A;  1NU3 A;  1GD3 A;  3NV0 A;  1GY5 A;  1VQ9 3;  3WOE B;  4G1M B;  5CLK A;  1EQK A;  4ORL A;  3X3Y A;  2CFG A;  1TU5 A;  3UL5 A;  2W03 A;  3SX1 A;  1ISK A;  1N8R 4;  4XBT A;  1KQS 2;  2OCT A;  4EV2 A;  2UX0 A;  1IVX A;  1UUW B;  2JDI H;  1N8Q A;  2OTL 3;  4K1U A;  1E97 A;  2BNG A;  1DVC A;  3CCL 3;  1W2Z A;  3JUM A;  3NXJ A;  3I56 3;  3V98 A;  3MSO A;  2MF7 A;  2W9Q A;  1IT7 A;  2LYX A;  4HM2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...