4GBJA

Crystal structure of nad-binding 6-phosphogluconate dehydrogenase from dyadobacter fermentans
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
286
Chain Sequence
MSEKIAFLGLGNLGTPIAEILLEAGYELVVWEPLTKLGATVVENAIDAITPGGIVFSVLADDAAVEELFSMELVEKLGKDGVHVSMSTISPETSRQLAQVHEWYGAHYVGAPIFARPEAVRAKVGNICLSGNAGAKERIKPIVENFVKGVFDFGDDPGAANVIKLAGNFMIACSLEMMGEAFTMAEKNGISRQSIYEMLTSTLFAAPIFQNYGKLVASNTYEPVAFRFPLGLKDINLTLQTASDVNAPMPFADIIRNRFISGLAKGRENLDWGALALGASDDAGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NAD-binding 6-phosphogluconate dehydrogenase from Dyadobacter fermentans
rcsb
source organism Dyadobacter fermentans
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase NAD-binding
total genus 97
structure length 286
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gbjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gbjA01
1N1EA 4RO0A 1QLHA 3NDRA 4YJGB 4DLAA 3KETA 3PRJA 4WCFC 3KZVA 1DJNA 3I52A 7MDHA 1IOLA 3NT2A 1B2LA 4NBUA 3ITDA 4D42A 2NU7A 4LISA 4FCCA 4BMSA 1E7YA 3DZBA 4K6CA 1VJ1A 4PLGA 3KXDA 2HSDA 4PG8A 3DTYA 3BYZA 1LSJA 3AUUA 4UUPA 2WTBA 4HNHA 1ULSA 2GPTA 4XWYA 5A06A 1UDAA 1E7WA 1YKFA 1EE9A 1KC3A 1XCBA 3BMQB 4HX5A 3DZIA 3ETDA 1QLJA 1U4SA 1PS9A 4RVDA 3WSWA 2C29D 4TSKA 1ML3A 5HS4A 4BIIA 3KOUA 5L7YA 2X6TA 4PG5A 4BNWA 4TRRA 2J3HA 3B1FA 3JTMA 4DRYA 4M1QA 3ZWAA 3E9MA 3SJUA 4CR7A 4R41A 4R1NA 4XYEA 1XELA 3JQFA 3JQAA 4UEJA 3IKVA 4RVSA 3W4IA 3K92A 1JU9A 2Q2QA 1DOHA 3NDIA 4W9NA 3U4DA 3VH1A 1NXQA 4WASA 4YT2A 3Q2IA 3WIEA 2EJVA 1MA0A 3EMKA 3WMWA 2D5AA 4NFHA 2Q49A 1P9LA 1E92A 2VNSA 4XR9A 1M2WA 2X0IA 5K9ZA 5CEFA 1MFZA 1FXSA 4WLUA 1WZIA 3JQBC 1VRWA 4DWVA 4ALKA 3A06A 4LMRA 2AE1A 4PVCA 3OEYA 4KMSA 4NFSA 4L73A 4EJ0A 3ZHBA 3PLNA 5KVCA 2A9FA 1LDMA 1QYWA 2BELA 3KO8A 1C0PA 3OH8A 3PJEA 4CMIB 3DOJA 1B8UA 5H83A 1NQ5A 4GKVA 5L4SA 1SNYA 3EYWA 3VDQA 3OMLA 3INRA 2LDBA 3SXPA 2ZB4A 5GY7A 5LDGA 1X0XA 1IZ0A 5KJEA 2QHXA 3VH2A 3JQ6A 2DAPA 3V1UA 1NVGA 3ZV6A 3PZRA 4WKGA 3P19A 3GK3A 5JW6A 3S1LA 4MVJE 4E2YA 1V8BA 2GASA 4M89A 1YL6A 5AVOA 3F1KA 2DUWA 4AG3A 3RAJA 1E1NA 1X7DA 2FOIA 3ONFA 1W4ZA 2P4HX 4Z0HO 4PZEA 1GDHA 4J4BA 3U3XA 3H9EO 2DTEA 3EVTA 1KEWA 2GYYA 1Q0QA 2LDXA 4YRAA 2A94A 5FYDA 2G76A 1R0KA 1V6AA 5IZCC 3E48A 5BNTA 1TB4A 3OSUA 2VRBA 4IDBA 3WTCA 4RVFA 5L3ZA 3UCFA 2D59A 2Q3EA 2PZKA 5DNAA 1HYHA 3PLRA 2BFAA 2EV9A 1YWGO 2VUTA 8ADHA 1A71A 1DC5A 1R4MA 2E37A 3DHEA 1ZK1A 4PLFA 1U7HA 2AEMA 5F1PA 4XRGA 3ADPA 2UDPA 1GADO 1C14A 3PDUA 6LDHA 4BO2A 1DHRA 3L6EA 3TOZA 1L7EA 3ZU3A 1AHIA 4PLYA 3TNLA 1UP7A 4D7AA 3GOHA 3E9QA 3LZ6A 3PHHA 3WYCA 2EGGA 4EITA 3I9LA 4CLHA 3UVEA 3RWBA 3Q0EA 3BMNB 2C2YA 1PJCA 1PZGA 4HUJA 3WGQA 4P4NA 1PGPA 5G4KB 1D3AA 2JD0A 3I3OA 2AG5A 2NU9A 3NX4A 3ZWNA 5IDYA 3FI9A 3MJVA 1RM3A 3UOGA 2PLAA 1PJSA 4II3A 1KY4A 5EN4A 2NU6A 2W2LD 4R51A 2Q50A 1OI7A 3VZQA 3CZMA 4RF2A 5A9SB 5IN4A 1XU9A 3RFXA 1I3KA 1T1SA 3ICCA 4LW8A 1YB1A 3DQPA 3DWFA 3LK7A 1PGNA 4GX0A 2DBVO 1HE4A 3M1AA 4KWHA 4P38A 4NQZA 3AM5A 2J5QA 2NADA 2NU8A 4OAQA 4B7UA 4KP7A 3KB6A 3HWRA 2C0CA 1CERA 3E8XA 3ABIA 1E1KA 1GUFA 3WQRA 3U5TA 4ALMA 2CVOA 2Q1SA 3JQEA 1T24A 2WE8A 3M2PA 1YXMA 1HWYA 3ZV3A 4F6CA 4YCAA 3VPFA 1YL7A 4YA6A 3UGKA 3GVHA 3BMNA 1PS0A 1TA4A 3AU8A 4B4OA 5BSFA 4IINA 3UHAA 4BO9A 3GGPA 3OF2A 5HA5A 3DAFA 1LTHR 3GFBA 4Y6RA 2DKNA 1GTMA 5TQVA 1Q7BA 3BHIA 4FDAA 2Q99A 3JQGA 4BQPA 1K6XA 1DIAA 4IGFA 4BHTA 4BNFA 1TLTA 2HUNA 3E9NA 4JBHA 4XCVA 5C3MA 3MCVA 5KKAA 2UUOA 2PZJA 1ENOA 4EUHA 3WMXA 5THKA 4DIBA 3WQSB 1NWCA 4TZTA 3HADA 3ANNA 5COBA 1AUPA 3O4RA 1HETA 2IXBA 1CJCA 1ID1A 3PK0A 4GVLA 3WR5A 4N5NA 5ICMA 2GERA 3C85A 3EY4A 1PL6A 4AJNA 4BKPA 2BKAA 4KTTE 4Y67A 5DF1A 1IHXA 3NAQA 3DBRA 2EIHA 3MWDB 2IYPA 5AXDA 1ENYA 4KTVE 3UUWA 3QV1A 3VKVA 4CV2A 3EDMA 4YYZA 1DFIA 4CM9D 3JQCA 4XGKA 4WEOA 3JD3A 5JS6A 4URFA 1PGJA 1P45A 1VKNA 2E82A 3B6ZA 4M87A 4CODB 2JJYA 5F5LA 2EXXA 2ZKLA 3FNGA 3P5SA 1H6BA 4YWJA 3EZYA 4E33A 4HADA 3W4JA 2P5UA 1LEHA 3GDGA 4BKUA 1DIRA 3HB5X 1E5QA 2ZTMA 3TN7A 2OOSA 4WE3A 4FFMA 3QJ5A 1JAYA 2CDBA 3LLSA 2WYVA 3WFIA 5HWSA 3MZ0A 4YJHB 1WMAA 4DQXA 1B16A 3BMCA 2HMWA 4R69A 3WS7A 2V6GA 1E6WA 1U3VA 1AN9A 1FF9A 1YB5A 3GG2A 1HDRA 1P74A 1MXHA 2B36A 5LC1A 3VTFA 1H94A 3G1UA 3X2FA 1FDVA 3ZNOA 4R9RA 1E7QA 3LT2A 4KQWA 1E3SA 3OQ1A 1JQBA 2IEBA 1PGOA 1FMCA 1S7CA 4GLOA 4PG7A 5BR7A 5EQFA 1QYDA 4DC1A 4KUGA 4GH5A 4INAA 2AQIA 2O3RA 2HMVA 4AJKA 5I9LA 1U3UA 2BI7A 3D3EA 3W6ZA 2O3JA 4FS3A 4NBTA 5HS6A 3TL3A 3OJEA 3IP1A 3ROPA 3RUDA 3OQ6A 1DIGA 4PLCA 3VAZA 1UXKA 5JAQA 3ADOA 5DOZA 1QG6A 2NTJA 1NNUA 5MGBA 4MVJD 3HN7A 3PVZA 3FR8A 3A28A 1IPEA 3KRTA 4U0JA 3ASVA 1B3RA 1JVBA 3AJRA 2JCYA 4KUHA 2NV6A 4Z3DA 3PI7A 5TJHA 3GNTA 1YGYA 1PJQA 4YJHA 1MFPA 2TMGA 4Q3CA 2YHIA 2HCTA 3DB2A 3HDQA 1BW9A 5JC1A 3ZWOA 1H9BA 2G17A 1T2EA 1ORRA 2A4KA 3C3XA 2DPGA 3GFGA 2X1HA 1HSZA 1BGVA 1HYGA 2VQ3A 3AM3A 1Y9EA 4DMLA 3GY0A 1LSSA 3K6JA 2EERA 3JQBA 4L4SA 3ROMA 1WDKA 1UJMA 2RAFA 4I5GA 4UEOA 2CDAA 3IOYA 1WDMA 1Y5MA 3H9UA 4I08A 2UUPA 4QSMA 2NNLD 3CKYA 3ANLA 1M76A 3ON5A 4IIVA 4ND4A 4B4WA 5KWEA 3G79A 3OJLA 4L74A 3WLEA 3LDHA 4RVHA 4CMIA 2BGLA 3WGGA 4BNIA 2NVUB 3VVCA 5I7FA 1FDTA 3K31A 4FOOA 4U6SA 4O1MA 3GN2A 4L4RA 5EERA 2P5YA 4IY1A 4PLTA 3LC7O 4FOSA 4DVJA 1O5IA 1E3JA 4JJGA 2IZ1A 3CH6A 1NR7A 1GCUA 1ADBA 2B37A 3JQDA 3QP9A 1LJ8A 1P1IA 4NHEA 5DP2A 2FR0A 3OBBA 1D4FA 1GPJA 5A05A 4RJTA 5A1TA 1V0JA 2GZ3A 4BO8A 1KYQA 1ZIDA 1OC4A 3JQ8B 1PSDA 4MP8A 2AG8A 1OC2A 4XB1A 3RUEA 4XA8A 2VZ9A 2YHUA 4JP2A 4CL8A 1ZSNA 4CMJA 1X7HA 1JWAB 1PR3A 3ZU4A 1LC0A 1JN0A 1RKXA 3WQQA 1WNTA 4WLVA 1IL0A 3JQFC 3M6IA 1K6JA 1XSEA 1KOLA 3UAGA 4CQMA 2GR9A 4XB2A 4FB5A 2Q1UA 4E13A 4BO4A 5ITWA 3HZZA 4IXTA 3Q3CA 1SOVA 4RGBA 1ZW1A 1EVIA 3BTSA 1GEEA 4UVHA 3OJFA 1C0LA 3JQ9C 4CLRB 4WJZA 2AQHA 4YJGA 3IIEA 4MKZA 3ZWMA 4BGVA 1I2ZA 1YDWA 3JYNA 3UN1A 4YBZA 3GUCA 5FEUA 1HF3A 2HLPA 1GV0A 2J3KA 1YB4A 2RH4A 1WDLA 4XQGA 3V8BA 5KNLA 2B4QA 1XIVA 2WSBA 4CLEA 1DFHA 3L0DA 4R5MA 2CFCA 1P1FA 5EINA 1VJTA 4FFOA 3IUPA 1UP6A 3NJ8A 1DRWA 3W8DA 3ORFA 2FPGA 1O6ZA 1PQPA 4PCVA 4EGFA 1ZNQO 2X0NA 3AY6A 3WJAA 2ZK7A 4IMRA 5TJ9A 1NQAO 3GDOA 3R3JA 1IE3A 5A02A 1E7MA 3JYLA 4I5FA 1R37A 4RPHA 4J1NA 2EWMA 2QIOA 5ENDA 2C20A 4HWKA 3T4EA 2H63A 4DQVA 3BA1A 1UR5A 1Z45A 2YQ5A 3F46A 2JCVA 1DFGA 1QV7A 3KUXA 4N54A 1ZXLA 3WTBA 2DTDA 4HP8A 4YRDA 3WDSA 1P33A 3EK2A 5TT0A 4CUJA 5B4UA 5L45A 2EJWA 5HRUA 5MDHA 1R6DA 4BV8A 3F4BA 3N58A 4ZA2A 3KSZO 3QWBA 1NTOA 4E2ZA 1ZH8A 3ENNA 2C5EA 4N18A 1Z7BA 2JL1A 1DLJA 1RM5A 4OH1A 1LDYA 2ZJ0A 3H9QA 1RYEA 1P1HA 5EMHA 2I3GA 4D0SA 3KBOA 1OMOA 4LSWA 1E1LA 1DJQA 3ICPA 2NQ8A 1NHWA 3JQ7B 3JYQA 1H6AA 3NT4A 1DEHA 2DBZA 2JFFA 2VYND 4KQXA 1WPQA 4L76A 4DPMA 5JYEA 1P1RA 1JWBB 2CSUA 2R6JA 3I9KA 1GQQA 1HDYA 3D4NA 4UEKA 1PGQA 4I8XA 5BSEA 1QSGA 2C54A 3JQGB 2PZMA 3TZ6A 2OL4A 1JA9A 5IN5A 1W6UA 4H15A 3WOHA 4CV3A 3JCZA 5JBIA 1UZLA 4DYVA 4FQ8A 3B20A 3MJCA 4IXWA 2VZ0A 4N7RA 3WBBA 5CFZA 3U9LA 4CR8A 4CM9A 2VUSA 1N92A 4Y9DA 3RQSA 3L9XA 3EZLA 3VOSA 3JD0A 3RI3A 5H81A 1W73A 1YQGA 3AK4A 3BTUA 5KJ6A 1P31A 4PIVA 4OSPA 4GBJA 4GVXA 4W6ZA 1A27A 2D4AA 4CPDA 4FD3A 2QRJA 4Q3BA 1IUKA 4PRLA 2WJPA 3PPIA 4B8ZA 4WNIA 4FFLA 1MG0A 2OGUA 3JD4A 2J5KA 1BRMA 2ZIZA 4YACA 3RJ9A 3HSKA 1YL5A 4IZHA 3F1LA 1B7GO 3MOGA 4GX2A 1VJ0A 1B3BA 1R4MB 2VHXA 3DMYA 4FR5A 4EUFA 3HFGA 1I10A 2PD6A 1C0IA 2HRBA 1WMBA 1XU7A 4TRNA 3TRIA 4ZHSA 1KBZA 1T26A 1MC4A 1CWUA 4MKRA 2QZZA 4BNUA 4EBFA 2HJSA 1QYXA 5C37A 3GHYA 3BTOA 4BUCA 3QSGA 2B69A 2JFHA 4XEHA 3JQAD 3W8EA 5JY1A 4FC6A 3TZHA 3CXRA 3RFVA 3WBFA 3BMQA 1BHSA 2ZYAA 2WD7B 2VYVD 4YQZA 1CF2O 4BNYA 1GZ4A 4XRRA 1KS9A 4LCJA 1Z73A 5JDIA 3CE6A 4BNVA 1F12A 2ZJ1A 3U4CA 4XZ3A 3ZW9A 4DLLA 1L1FA 3AW9A 3OECA 4L75A 5I7EA 3W8FA 5JY6A 3EAGA 1NPDA 5DBIA 2W8ZA 1KVQA 3I6IA 9LDBA 5JDIC 4YXFA 2OHXA 4TRJA 1EFLA 3AY7A 5C5IA 3DEYX 1AGNA 2Y0CA 3GA0A 4WEQA 2JAHA 4WCFB 2I76A 4IJWA 3RUCA 4EI2A 5JNLA 4ZU3A 2TMDA 4WLOA 5HTOA 1NPTO 3ZHYA 1HRDA 3GZNA 5CPFA 4TZKA 4ZQHA 1KVSA 2BI8A 4ZQFA 3PHGA 4XKJA 5EIOA 5L40A 4BO1A 4R1TA 1GUZA 5AYVA 1NBOA 2FP4A 4A2CA 5CG1A 3L77A 1Y6JA 3GH3A 1Y7TA 3S8MA 4GWGA 2C7GA 2E4AA 2CDCA 4J7UA 3PYXA 4OMUA 2ZCUA 3HUDA 2J8ZA 4YT5A 2BMAA 4GX1A 3H7AA 3JD2A 1TEHA 3I5MA 5T67A 4BNKA 5L95A 3RUHA 3VDRA 4A10A 2I67A 4GSLA 3NTRA 1E3EA 5IDQA 1XQ6A 3QWFA 4YQYA 2WYUA 2XOXA 5BSGA 3A1NA 2FHSA 3D4PA 3QW2A 3RKRA 4OXYA 3PQEA 1M66A 5IDXA 3NDJA 4X54A 5GZ3A 4J7CA 1XHLA 1NFFA 2O4UX 4IDAA 4Q3NA 2NM0A 5A9TA 1Y8RB 1GZ6A 4JBIA 1P3DA 3BTVA 3QLJA 1A72A 2IZ0A 4GSKA 3NEPX 5EESA 3A4VA 5JO9A 4R4JA 4YR9A 3RC1A 3SX2A 3PWSA 2WMDA 2Z1NA 1DSSG 1LC3A 1WVGA 3CIFA 4E2XA 1H0KA 2X8LA 4E5MA 3DBRB 1XG5A 1BXGB 2ZTVA 1QORA 2ZB3A 3HQ4O 2X0RA 1IHYA 3HJAA 3O9ZA 3L4BC 3C7CB 5L4NA 2VRCD 4LGVA 5T8KA 3QVSA 5G2OA 1KIFA 5CPBA 1N9GB 3FCOA 2R2GA 3BIOA 3GMSA 1F8FA 2VCYA 4AJHA 4OQYA 5CEJA 3FR7A 1HYEA 4ZICA 2G5CA 3RC9A 5G0UA 3LC2O 3HDYA 4QO8A 1PJLA 3KSUA 3TDKA 5C7IO 1J4AA 3DONA 4P8RA 4XQ9A 3RU9A 3WX0A 1SCUA 4II2A 4BS9A 1ONPA 4O5OA 3ONEA 2YZ7A 4RDHA 5A4DA 3OA0A 4MINA 5TSDA 4H16A 1LLQA 2YV3A 2V6FA 3LVFO 4DQUA 4U8GA 3VPXA 5GZ1A 4QQRA 3WFJA 1IPFA 1Q0LA 2QRKA 2IRWA 1LSOA 2VHVA 3D64A 1GAEO 3GZ4A 3I1JA 1F06A 3CTVA 1H5QA 4JLWA 4NU6A 4E2WA 1P1JA 2X5OA 4WPGA 1RJWA 4IM7A 2HMSA 2I9PA 1JW9B 5B1YA 3C1OA 1MXFA 2J3JA 3MTJA 4DREA 3E18A 4DUPA 3OQBA 3Q6IA 5EL0A 3R6DA 2AEJA 4NH4A 5JDCC 5U9CA 1Y81A 3DZHA 1DIBA 4NJMA 3Q9UA 1YQXA 4MVJM 4E5YA 1VE9A 2DBRA 5JCJA 5JPIA 3FF4A 1ADFA 2V65A 2F1KA 4WOKA 1R4NB 2XPCA 4CMEA 1E3WB 4IPTA 4XYLA 2C5AA 4TKLA 4R16A 2FMUA 4JROA 1UXIA 1HTBA 1U3TA 2VYNA 2E6UX 4B3IA 1YOVA 1X7GA 1QV6A 4PLHA 3FWZA 2BGKA 3DAPA 1LQTA 4UULA 2PKQO 1KERA 2YHIB 3QVWA 1VPDA 4BB5A 4XDYA 1WXDA 3H4VA 2BH9A 4XDZA 3PWKA 1JDJA 2YY7A 3R0IA 1PL8A 3TSCA 5B4TA 1R66A 4D3DA 2VWGA 2OO5A 1GQYA 2GO1A 5DBGA 2BHLA 4M86A 1MC5A 2AEFA 3K96A 5KJ1A 1H2BA 3ROQA 5TLSA 4EZBA 1B8PA 1VSUA 4GX5A 2VTEA 1ULUA 1JVSA 3ZV5A 4XQCA 2NTVA 3QIVA 3LQFA 3HN2A 3QQPA 1EDZA 4D43A 2Y93A 1J49A 2Q4BA 3N7UA 4FIZA 4FFPA 2GUGA 3KYDB 1IULA 5KCZA 1PQWA 3DDNA 3L4BA 1DC6A 1ISFA 5AQ1A 3K2BA 4P4GA 1A7AA 1ZJYA 4RDIA 1ZBQA 1T1RA 1LX6A 1I2CA 2V7PA 4QFCA 2FRDA 2HU2A 3CPSA 2XAAA 5ADHA 3O26A 3WB9A 4Z0PA 1PL7A 2J6IA 3UH1A 2W2KA 5AXCA 2HKIA 3VHRA 2D1YA 3PTZA 2FZEA 5F5NA 1KETA 4WOJA 5CEEA 1T4DA 3ZHZA 1H6DA 4L9RA 4ZVVA 3GG9A 2CZCA 1N7HA 2VNAA 3D1LA 3WIDA 4C4OA 2IXAA 3FTNA 4YT4A 5CG2A 1U7TA 1YQDA 3GN1A 4QXMA 4R1UA 4ZD6A 1OZAA 2CMDA 2O50A 2UVDA 1OOEA 3GAZA 4QO7A 4BOYA 2E48A 2I3AA 3UCXA 4CMKA 1BXKA 5CDUA 4B7CA 5A3JA 5FFFA 1AE1A 4CMGA 1VLLA 3RASA 4QT0A 5BNFA 4K1LA 1HL3A 3D0OA 4ZRMA 1ADGA 4UUMA 1N1GA 4ZJUA 1T2AA 3ZH2A 3WGHA 2GN4A 1LBEA 4LSMA 3ZV4A 4EJMA 1GY8A 1KEPA 1TVEA 4CM4B 1WZEA 2W98A 3QWAA 4GMGA 4ROSA 2PZLA 3WSVA 3KYCB 1TT5B 4HXYA 4ITUA 2P68A 3ZWCA 4AJLA 1ZEJA 2P9EA 4YTEA 1SZJG 1B0AA 1PJ3A 4NMHA 3GVIA 5AXAA 4MDHA 2X4GA 3AOGA 2O7QA 3OFSA 4PLZA 1W8DA 4XD2A 4EUEA 3QE3A 2HK7A 4NFYA 2CY0A 2EP7A 4BO6A 3INGA 3GEDA 2O2SA 2RH8A 1DDOA 4ONEA 5FI5A 2OZPA 1B14A 3F47A 2R00C 3ZDFA 3PQDA 1LU9A 4R54A 1I8TA 5U1PA 2FPPA 3PIDA 2NQTA 3VVBA 5DDIP 3LT4A 3NTQA 1HZJA 4ZRNA 1G0OA 3U62A 4IQ8A 4YT8A 5I7SA 4W82A 1KY5A 2Q46A 5AOVA 5ER6A 4E32A 4OXNA 1LRLA 3D3WA 5FWNA 2PTGA 4TKMA 3VPSA 1BDMA 1Q1NA 4NNJA 3NV9A 1I5RA 2UAGA 3PFWO 3T4XA 3OA2A 3BHMA 2OBNA 1EBFA 3UW3A 4CMHA 4EYEA 1O95A 4LN1A 4JX8A 3JQ7A 1R12A 4B7XA 5LDHA 1SMKA 3LC1O 4IJVA 3FRJA 4GGOA 2W4QA 1E1MA 3AUAA 2D3TA 4NR0A 4UAGA 4ZQBA 4HV4A 3QWHA 3NRCA 3RJ5A 2UV8A 1LDNA 1EMDA 1ZMTA 1U8XX 2D0IA 4OXKA 5DCYA 3RROA 1HE2A 2GN8A 4U5QA 4JBGA 4RQUA 4U6QA 1S6YA 3U49A 2FZWA 5JYDA 1VSVA 4BO0A 3QRWA 3E03A 1YE3A 3H2ZA 2Y1CA 4L4XA 4IIUA 4IQGA 5TRTA 2DTXA 4CQMD 1CYDA 1PZEA 1NVMB 1PWZA 5L51A 1FDUA 4YAGA 2VOEA 1A9ZA 1R0SA 2DC1A 4I9NA 3ZNPA 3GQVA 4IDEA 3NTOA 2ZYDA 3FBTA 3I9OA 3DBHA 2Q2WA 2JHGA 1QRRA 2ZB8A 4IMPA 4ALNA 2OUIA 3GNSA 2WE7A 3ULKA 1NAIA 3E5MA 3EC7A 1IY8A 2JD2A 3PYLA 2I99A 4JQCA 3LLVA 4EEZA 2RCYA 3IJPA 3A14A 2CF5A 3GGGA 2PKRA 3D3WB 1RYDA 3FSRA 3N74A 3PIIA 2FPIA 3GR6A 4D3SA 4J16A 4WK6A 1Z74A 4BMVA 1BWSA 1QYVA 3COSA 4ND2A 4QTZA 4D0RA 1U2DA 5H82A 3DZJA 5G0WA 4OJNA 1NP3A 5JMPA 2BFMA 5T64A 4BKQA 1M6HA 3DFZA 5DULA 1DIHA 1F8GA 4UUOA 8LDHA 1MG5A 1TT7A 2GSDA 2EKPA 1O8CA 2B5WA 1QKIA 2YQ4A 1DC4A 4D3FA 4TVBA 1RPNA 4Z9YA 2GD1O 4G2NA 2BLLA 4A03A 4D46A 5BQFA 4NJMB 3WNVA 3GDFA 2G82A 3DMTA 4G65A 3VPHA 4PN3A 4RVGA 3GC6A 1LLDA 3K9QO 5A5EA 1DBVO 3OIDA 3GLQA 3V2GA 4WNCA 1X15A 1B8VA 4PFJA 4ESOA 1DC3A 4FJ0A 2GGSA 3QVXA 3KEOA 1NHGA 1ZCJA 3H2SA 1KVUA 3JQAB 2CNBA 1HLPA 2HMTA 5ES3A 4BNXA 3HFSA 2I6TA 5B4VA 1G6KA 4EDFA 1Q0HA 2OMEA 4CR6A 5G0SA 4O59O 3E1KA 1JTVA 3EVNA 3KVOA 1X14A 1H6CA 3S2GA 2WD8A 2O7SA 4HY3A 2O3UA 3TQHA 4J9VA 5KTKA 2PFGA 4CMAA 5G0TA 1I24A 3GGOA 1V35A 4I9HA 5FF9A 5FI3A 1MX3A 1EK5A 1FJHA 3A9WA 4MIEA 2AE2A 2HRZA 4OHUA 3GEMA 2I65A 1ZUD1 2ZYGA 4AJEA 3ENKA 4EW6A 3VC7A 1HDXA 1CQJA 3ZWBA 2B4RO 2HK8A 4YVFA 4J90A 5JCXA 4ND3A 5GZ6A 3S2EA 3DZGA 4NI5A 2NLOA 2C59A 3MWEB 1DAPA 1GYPA 1MP0A 3GT0A 1WWKA 2ZB7A 3NKLA 4KWIA 5L7TA 2VT3A 4Q39A 4J1QA 4KOAA 4NBVA 1JAXA 4DMMA 1G1AA 1P1KA 4XGIA 1BTOA 2GZ2A 1X0VA 4RPGA 4BO5A 4DBZA 1U3WA 4JNKA 2YUTA 3BXXA 2J3IA 3C1TA 2X9VA 4R68A 1HSOA 4PRKA 4OYRA 4CM8A 3X2EA 1SPXA 4DIOA 3SLKA 3VZRA 3FNFA 3SEFA 3RKUA 3EGOA 4E31A 3AI3A 3VZSA 3C8MA 3CSDA 4QUKA 2IDZA 1SAYA 3RBXA 3FNHA 4NBWA 4W4TA 2Y1DA 3QVOA 3WWZA 1SB8A 5C7LO 3F4LA 3I6QA 4E21A 3GVXA 5F1KA 4BGIA 3ZGYA 4E5NA 2B4TO 4IS3A 4K28A 3ZU5A 4AJIA 4IDCA 2HDHA 1HDGO 3RCBA 3OJ0A 1PZFA 1E0DA 4L0QA 1MUUA 1K89A 5A3VA 3ZN2A 1PJTA 1UXHA 4HNGA 3STHA 4ZGWA 4CQLB 2OORA 3S2IA 3WNQA 3OIFA 1UZNA 1QYCA 3ZHXA 2NSDA 2WEKA 4MOWA 5B12A 2HJRA 2X7HA 2YFHA 2ZCVA 1BXZA 3G17A 2PGLA 4ZQEA 2EF1A 2X23A 4IZIA 4FGSA 4RPLA 3DZFA 4J9UE 1PS8A 3H3FA 1GCOA 3VPGA 3MJEA 4ND5A 3DXFA 1O0SA 1HDZA 4RPKA 5IXYA 3V1TC 4F3YA 3RU7A 4GWKA 4UVIA 4NU5A 3AWDA 5CHEA 3OICA 5KVQA 1YO6A 3PJDA 1HE5A 4JN6B 5KVVA 4HFMA 4CUKA 3QWIA 4FFRA 4WLFA 5TGDA 1HXHA 1D8AA 1XGKA 3G49A 4BNJA 3JSAA 5AXBA 4CLXA 4U0KA 4OO3A 1GUYA 1TXGA 2V6MA 4WCDA 4PVDA 4FN4A 1O89A 3TFOA 4R3WA 3O8QA 4AJJA 3ZW8A 4M55A 4NPCA 2B35A 4B4UA 2X9NA 4BNHA 1EK6A 2DFVA 5JDCA 4MKXA 1QR6A 2FSVA 4IUYA 1BG6A 1GZ3A 5IJZA 3ZNNA 1NASA 3M1LA 2ET6A 4CUZA 4Z9XA 1EBUA 4KZPA 4XJSA 1EQ2A 1X1TA 4QFDA 3NGLA 4BNLA 1MLDA 1I3LA 1NQOA 2RHRA 4XGNA 4CM6A 4E3ZA 3H5RA 2VYVA 4PG4A 1T2DA 3GNQA 3ROKA 4CM5A 4I1IA 4E4YA 4BNMA 5ILGA 4GL4A 1LQUA 2FY8A 2X58A 3CZRA 5CDSA 1R4NA 5K0ZA 4I5EA 4LRSB 2Y1EA 3DOOA 1O9BA 1R15A 1EE2A 4AJOA 1PX0A 3FN4A 4D45A 3GRKA 1Y8QB 4GKBA 4PGFA 4D41A 5JMWA 3U0BA 2BRUA 2YDYA 3LU1A 2PH5A 3MJSA 4D44A 5COQA 4BQRA 1FDWA 4E30A 1U1IA 4J4HA 4MIOA 4DBVO 4D79A 4IGEA 2Y0DA 4KDEA 3FNEA 1WLYA 2Q2VA 1YJ8A 4DTIA 5IG2A 1UH5A 4MVJI 4PLPA 4FBGA 1YDEA 5ENVA 1EZ4A 3PHJA 5JAMA 5EQDA 4B79A 4J1TA 4JIGA 4O0LA 2VWQA 2BGMA 2IE0A 2O3QA 1C1DB 3IDSA 1QXSA 2JCXA 5T57A 3I4FA 4RPJA 2PR2A 1K2WA 2CUKA 2A92A 1I36A 2EG9A 3HE3A 3P2OA 1E3LA 1G0NA 4RLHA 1LRKA 4YB8A 2V6BA 4OOEA 4WLNA 3KSDO 4Y8VA 5IZCA 3BMOB 3HG7A 4AICA 3C1AA 2Y67A 2AXQA 3INTA 3H6KA 2YFQA 4DLBA 5K6AA 4FC7A 1Y8QA 1KEVA 2PNFA 3PXXA 3UXYA 4OGWA 1NVTA 3I4CA 1Z82A 3D5TA 3PFFA 1KVTA 3ASUA 4MPDA 1Y5RA 3AU9A 4HBGA 1CEQA 2DQ4A 1IB6A 5COAA 1HZZA 1ISGA 4E5KA 1ISMA 3LF2A 1DO8A 1GL3A 3BZUA 4A7PA 4BNTA 1SEPA 1YBVA 1K5HA 4J1SA 2Z95A 4MVJG 5B37A 5EPOA 4CV1A 2O2YA 4RVUA 1ZSVA 3AY3A 3O38A 2NVBA 1P0FA 1YRLA 4LVUA 3AUTA 4UUNA 3ZWWA 3ANMA 4NZ9A 4J6FA 3C7DB 1V3TA 4S3MA 3GUYA 5TX7A 1GEGA 2JFGA 1A9YA 1JLLA 1VC2A 5JAIA 3IKTA 4U7WA 4J3FA 3JQ9A 1U4OA 2PKQP 1M67A 2ZATA 3UICA 3WJ7A 2UYYA 5JC8A 3OJOA 4XYGA 2HQ1A 4Q3AA 1PR9A 4ALLA 1GYQA 2NACA 1F17A 4LRTB 3RUAA 4ZN6A 2Y1FA 1HE3A 4IS2A 1H2HA 3DFUA 1U9JA 3G1TA 2QRLA 4W7HA 3U4IA 4H3VA 4IDGA 4GMFA 1PJ2A 1VL0A 4AVYA 2VWHA 3TJRA 1L7DA 3JQ8A 1N7GA 4QEDA 4W9NC 4BNNA 3Q11A 1DXYA 1B15A 3LF1A 3K8ZA 4I9UA 5U4QA 4XQEA 4MVJH 1UXGA 3TZQA 4B4VA 1LXCA 1F14A 4YDRA 4CV0A 4BKOA 2YV1A 9LDTA 4Q9NA 1OBFO 4IDDA 3ZWVA 3F6YA 2AQ8A 3DO5A 1GFSA 2Q45A 4DL9A 2JAPA 5ICSA 4Y98A 3B70A 3IL2A 5TF4A 2D8AA 2JD1A 3KV3O 2WYWA 1PQUA 2GLXA 4CM8B 2VWPA 4YJFB 3VH3A 4A26A 4UVEA 2QYSA 4ZQGA 4LK3A 4W7IA 2ZTUA 2G0TA 2DBQA 4DIFA 1XDWA 1SBYA 3JV7A 3QVTA 4ID9A 4NK5A 1CETA 4NJOA 5G0VA 3OIGA 3ONDA 1MGOA 4RF3A 1ZKMA 3PDJA 1ENZA 5L9AA 3HDJA 1QP8A 4O63O 1Z75A 4IDFA 4BL5A 4HKTA 4GI2A 4EJ6A 4JK3A 3EUWA 1JKFA 2OP0A 5DZSA 1HEUA 1LDEA 3B1KA 3C7AA 5CAEA 2YDXA 4RCVA 5THQA 4WLEA 3RIHA 3DHYA 5I7VA 1NWHA 1XR3A 2C07A 2OFPA 3BAZA 4GGPA 4Z3KA 4P22A 3QY9A 3F5QA 4LVCA 4XYMA 1A4UA 2AQKA 2VOJA 4M8SA 2J5RA 3S55A 1I3NA 3RD5A 1MB4A 3FWNA 4O6VA 2Y0EA 2A35A 2X5KO 3L4SO 4C7KA 3P2YA 1T2FA 2R00A 4NK4A 3I9MA 3BMCB 3DAGA 4PLVA 4WECA 1YVEI 3KM0A 5KKCA 2GCGA 3OP4A 1VKOA 5T5QA 4YAEA 3DBHB 3ST7A 5TT1A 3SLGA 2WDZA 2GZ1A 5DP1A 3KEQA 4CQMB 1E6UA 4AJ2A 3CUKA 3UCEA 2JKVA 1XEAA 4WUVA 2QX7A 4XR4A 1M75A 1V3VA 5JE8A 1NQTA 1ZEMA 4K26A 2Z1MA 1ZO8A 1FK8A 3OEWA 2ZQZA 2GF2A 1IYZA 3W4KA 3AFMA 3PGXA 4J4TA 5A03A 3AOEC 4DYDA 1O94A 4A27A 3FBGA 2PGJA 4RV9A 3MEQA 3DR3A 2EW2A 3NT5A 2CD9A 3L9WA 1P77A 3I9NA 3ETGA 1E77A 1A4IA 4IBOA 3MJTA 5HBRA 5K6AC 2CVZA 1ZK3A 2VT2A 3DOCA 1KC1A 3F9IA 3UKOA 1YJQA 3I23A 1QMGA 3WLFA 1DHTA 4W99A 4RLSA 2EGHA 3SC4A 4CM1A 4HFNA 1XA0A 2Q1TA 1WW8A 2VUUA 1NPYA 5JCJD 5A9SA 2IYOA 1XYGA 4H7PA 1JKIA 3GRPA 1B26A 1HDOA 1UXJA 3UFXA 4Y6PA 1HKUA 1P0CA 4Y6SA 5TC4A 1AHHA 1X1EA 5DT9A 4YPOA 2GDZA 5TS3A 5DN9A 4AJPA 4J0EA 1NR1A 2GNAA 4CM7A 1LUAA 4DA9A 1W0CA 2DVMA 3AI2A 4AJ4A 3KHUA 3ZZNA 2O3SA 3MJ4A 4UVGA 3D5QA 5T8KC 4E5PA 3QHAA 1XLTA 1N9GA 1DRVA 4F6LA 3L6OO 2DU8A 1TT5A 2AMFA 2FWMX 1YBMA 2CVQA 4ILKA 4DC0A 1SC6A 1YS4A 1HT0A 1T25A 2QZ9A 4N5MA 4TQGA 4JCOA 3EHEA 1AXGA 4K6FA 4Q3DA 1NX6A 1A7KA 1PEDA 3GVCA 1N5DA 2GN6A 3H5NA 2PY6A 5T6BA 5BSHA 3I83A 4YRBA 2FR1A 2PA3A 3DBVO 1UAYA 3GPDG 3JYOA 2Y1GA 4CMEC 3E6AA 3VTZA 3BMOA 3ZCXA 2WWRA 4Z6KA 1C0KA 1EVZA 2OBYA 3LSYA 3PHLA 4LMPA 1NM5A 1PJBA 5L53A 5DBFA 1UUFA 3F3SA 3PJFA 1GD1O 4NBRA 4TVOA 4BGUA 4MP6A 1U5AA 1ZSYA 3E5RA 5IAAA 2EP5A 3UF0A 4HFRA 4S1VA 4BO3A 3OETA 3WGTA 2Y68A 4XIJA 3RVDA 3DTTA 3ZWXA 5LCXA 2VZ8A 3KLPX 3WYBA 1TI7A 3TWOA 2F00A 5F1OA 1PTJA 4TRMA 1CDOA 2H6EA 2VTDA 1U28A 3RC7A 4FJ1A 4MVJP 2Y66A 4R9SA 4G81A 2AW5A 4AL4A 3WGIA 3I9JA 5JFOA 3O03A 4EEXA 5J23A 2RBEA 2H1SA 5IDWA 1EUZA 1I33A 4B3JA 3LT1A 1Q7GA 3OM9A 4KDFA 2DPHA 3RBZA 3ZU2A 1YOVB 2H9IA 4FSHA 1C3VA 1ZVMA 2WD7A 4BB6A 1KEUA 4K9DA 1BMDA 1UZMA 5KJFA 2X9GA 4CMCA 3DBLA 1LLUA 4IJKA 2P91A 3GHHA 1C1XB 5DCWA 1E7RA 1BVRA 3V2HA 3RFTA 2ILTA 3WWYA 2C2XA 4UREA 3R1IA 1GPDG 1N8KA 4RL6A 3HNPA 4OOFA 4BKRA 2EEZA 3L07A 6ADHA 5A9RA 1LLCA 1J6UA 3AM4A 3OHSX 5GMOA 4FGWA 4BGEA 5JXWA 3IS3A 1UP4A 3K73O 3GZNB 3PJGA 1WP4A 1E3IA 1VM6A 4DPKA 1FDSA 5CDTA 1EFKA 4FJ2A 5BT9A 4BVAA 1ZMOA 4A5OA 2XF8A 4JGBA 2QG4A 5IFLA 2P4QA 3NGXA 4OIMA 3EW7A 2CF6A 3AOEA 3CMCO 2YW9A 3DHNA 3LT0A 1Y1PA 3IJRA 5A04A 5L4LA 3O8QB 2QYTA 4OKIA 3ZWYA 2O3TA 1Z7EA 3WG9A 3T7EA 1ARZA 2ZTLA 3L6DA 1XQ1A 1JKJA 3NJ4A 4IJUA 4J91A 4YAIA 2YJZA 4NG5A 4IQ0A 4GQAA 3H9GA 3DZKA 4JXKA 2IEDA 3ZNQA 4OM8A 4CLOA 1LRJA 5I9NA 3G0OA 5ER9A 2BD0A 3B1JA 3FHLA 3GMDA 3KLMX 4QX6A 3PYMA 4Z9FA 3NYWA 3W1VA 2Y1OA 2Y05A 2E49A 4Z0TA 3ETEA 1DAOA 1P44A 4J49A 4ND1A 3SBOA 1YONA 2PD4A 2NWQA 2HK9A 5IXSA 1I0ZA 3K2EA 2P9CA 3Q2KA 5DOVA 2YYYA 4JP3A 1Y8RA 3MTGA 4CM3A 3IC5A 4ALIA 4MIYA 2RIRA 4YJFA 4MVJF 4MO2A 3RSHA 3GAFA 2C7VA 3SJ7A 1PWXA 3IMFA 1V9LA 1EQUA 1U2GA 4F45A 2WM3A 3VH4A 3PHIA 3TPCA 3V2UA 1Q7CA 3H9JA 1K6IA 3KYBA 3PQFA 4I5DA 3W6UA 1LSUA 4OSOA 3TOXA 1BXGA 3F5SA 3DC2A 4BO7A 5ILOA 5ITVA 1LI4A 1GV1A 4J0FA 5F21A 1DB3A 2O23A 2XXJA 1UAGA 4CM4A 4UVDA 2H5LA 2QW8A 4GAEA 1U5CA 3WGOA 4A73A 3GPIA 5KVSA 4R01A 1X13A 4J7XA 2IODA 3PP8A 2O48X 1DRUA 4GLLA 4MP3A 2FSSA 3M2TA 2D5CA 2BFPA 1E3WA 3E82A 3V5NA 2HMUA 2EHDA 3AI1A 3NUGA 1EDOA 2IZZA 4DPLA 4CQLA 5KJCA 2VN8A 3AUSA 4AFNA 4MJLA 1LA2A 2W2LA 3K30A 4CMBA 2DUUA 4DGSA 5G4LA 1LNQA 2O4CA 2X5JO 4OKNA 2FN7A 2NUAA 4WGGA 1BDBA 1UDCA 2VHYA 3RC2A 2SCUA 1K0UA 2I5PO 1M6WA 4E6PA 4C7JA 4BNGA 1SO8A 2QQ5A 4PLWA 1H93A 5TNXA 1VI2A 1ISIA 1LDGA 3KTDA 3SC6A 5KIAA 2EW8A 3BHJA 4F46A 3IP3A 1RM0A 3H65A 1T4BA 4E0BA 1EVYA 1CIVA 2NVUA 3FTPA 3ITKA 4GPD1 4JJFA 4NIMA 5IF3A 4CL3A 3D7LA 3WYEA 5A5FA 2D2IA 4FW8A 3CEAA 3WGZA 3KYDA 4E12A 1V3UA 2DT5A 4B3HA 4TROA 4RZHA 1EVJA 2DFDA 4R5HA 2DM6A 2C82A 2JHFA 4Q3EA 4MVJA 3G3EA 3VKUA 1DPGA 1KVRA 3CINA 1XKQA 1HLDA 2W2KB 1PJ4A 2X22A 3GEGA 3RUFA 4XX0A 4FFNA 3IAHA 2VHWA 1GR0A 5C7OO 1E5LA 3IQDB 4RZIA 1GU7A 4BNZA 4ALJA 1PZHA 4L8VA 5EJ2A 1J5PA 3TF5A 3T7CA 4PZDA 4YAKA 5I8WA 1E6EA 1CRWG 4XJTA 4XYBA 5CDGA 1GQ2A 3R3SA 2RHCA 1LDBA 4PG6A 1NFQA 1ZK4A 5I8ZA 3WXBA 4J2OA 2Z5LA 1NFRA 5JAZA 2NVWA 5F3RA 4RORA 5KOIA 1I2BA 3SVTA 3TFQA 4AJ1A 1K3TA 1NYTA 3H5AA 5JSFA 4G5HA 5L7WA 1D7OA 1J0XO 1Y9AA 2EKLA 1CQIA 1F0YA 2PWZA 3DL2A 5BNIA 3PEFA 3HHPA 2GRAA 2Y99A 1I01A 2YV2A 2NTNA 4FPXA 1SOWA 4RF4A 2AHRA 2B83A 3WGYA 1BVUA 2POQX 1VL6A 4B8WA 2Q1WA 3K5PA 2W90A 3FPLA 1D1SA 1NAHA 3KYCA 2G1UA 3H8VA 5G4KA 2PH3A 3GF4A 1YBAA 2X0JA 4PZCA 1PU2A 1I32A 3AFNA 3VZPA 1BW9B 2FR8A 4HFJA 1DLIA 5CP8A 3HDHA 2Q4EA 3CMMA 1SEVA 3QA9A 4A0SA 1R0LA 1ZJZA 2OP1A 1WAMA 2EKQA 3H3JA 3P7MA 3ZI0A 1N2SA 3MOIA 3DBLB 3PWZA 1C1XA 7ADHA 1SB9A 1D1TA 4CJXA 1YH3A 4N5LA 4J2HA 4XIYA 3GVPA 4BMNA 4NDNE 1E7SA 5TIIA 1OFGA 4JJIA 3RBVA 4OL9A 2PGDA 1R16A 4R1SA 1EUDA 1ZZEA 2XXBA 4DXHA 1AXEA 3V1YA 1MV8A 4M54A 1I3MA 3TL2A 3TZKA 1Z6ZA 3D4OA 3Q1LA 2PV7A 5DCUA 2I66A 1T2CA 1ISJA 4QECA 1PIWA 2ZQYA 5I9MA 3Q9NA 4YJDA 5IZ4A 1C1DA 1RM4A 3JYPA 4TWRA 3C24A 1ZXBA 4YAJA 2GN9A 3WICA 2DLDA 2AA3A 2BFOA 2HO5A 1EUCA 1Q2XA 2B5VA 3S2FA 5HM8A 1ENPA 1EEHA 1ONNA 5JO0A 2PD3A 3IUSA 3PZBA 4LCEA 1RWBA 3RUIA 3HB4X 4YEDA 1ZK0A 2PK3A 3U4HA 1H9AA 1XWFA 4CLOB 1BSVA 3U09A 1ADCA 3TZCA 4CLDA 3DMTC 3ZWPA 4J43A 1ONOA 2B0JA 4P4LA 4TMFA 3FPCA 2P9GA 4M49A 1HDCA 4KUEA 1ZFNA 4OQZA 1VL8A 2HAEA 2X86A 4BV9A 1U8FO 1OAAA 1ZK2A 2VRCA 1UDBA 3PGJA 2VHZA 5CDYA 2OXIA 4R3NA 1IZ9A 4RQTA 3FD8A 4RF5A 1I30A 2BF7A 3CTMA 5JLAA 4WCFA 3LYLA 1ISHA 1A5ZA 2P2SA 3JD1A 4CLRA 1GYRA
chains in the Genus database with same CATH superfamily
3FPBA 2XVAA 3JWHA 4NJEB 4DLAA 1BE8A 1TD1A 7MDHA 2CZGA 4NYIQ 2HSEA 3S8EA 1ZOLA 4ISCA 4DIUA 3QI7A 3IALA 4K6CA 4PLGA 2JFZA 3BYZA 1LSJA 1A9RA 3T5MA 3AUUA 4MVCA 3PPYA 1LPPA 4O0MA 4XVQA 4B17A 3TSWA 4QLBA 2IW3A 4CTJA 4DJJA 1CNMA 2WKSA 2QTGA 4AURA 3L1KA 5LUAA 1EE9A 1KC3A 1XCBA 2RI6A 3AO0B 3DZIA 3GBPA 1U4SA 4RVDA 4WXYB 3TR6A 4EHJA 2PMDA 2ZBUA 4NOMA 4OBXA 4UHJA 5F35A 3TLKA 4HQRA 2GYUA 3TE7A 3JALA 4UM8B 3WL5A 3A9TA 4DIFA 2CB9A 2RFLA 2IEIA 5FOUA 1Z2PX 4G25A 3LXUX 2J3HA 1E1RD 3LZDA 5FJJA 2XRZA 1CJVC 1E5VA 4DRYA 4W7SA 3E9MA 1SUWA 4WH0A 2G25A 3ANSA 2RGWA 2REQA 2ORWA 4NH0A 4R41A 4X8MA 3ZTWA 1D5WA 3ZBUA 3JQAA 2VNKA 3IKVA 4I1OA 1YZUA 4GR9A 2BM8A 4RVSA 3K92A 2OBBA 3D4LA 1ADYA 3L8EA 4B5LA 1W47A 3VH1A 2YWXA 1NXQA 5ALHA 2WKPA 5IUKC 1KXZA 4BBZA 2NP7A 2PUBA 2DBYA 2PANA 3EMKA 4KXQA 2BM0A 1JFFA 2GJKA 3EG5A 1H4SA 3T7TA 2MIIA 5AR1A 4NFHA 2A0UA 2IHBA 1NMSA 2Q49A 2RH5A 4HSEA 2VNSA 3T35A 1M2WA 3JZFA 4C22A 2X0IA 2WZQA 5K9ZA 5CEFA 4PNZA 3Q10A 3ED5A 4IEFB 3R7FA 3V48A 3U3ZA 4XVCA 2DR2A 2G63A 3BFKA 4LMRA 3GT7A 2XYRA 2VAWA 2F9MA 3IQFA 4PVCA 2C4HA 3L8ZA 4MKIA 4QELA 3V4FA 4L73A 4X45A 3ZHBA 4ZU1X 4KIGA 3I2FA 4CI0B 2A9FA 4D0NA 4MUAA 1G8FA 3WGLA 4CMIB 2FJ0A 3OH8A 3PJEA 3URKA 4DLWA 1PAUA 3BA6A 3T3HA 4BFYA 3ZCSA 3VR1A 2I54A 2FPSA 5BSTA 3CC8A 5CAEB 2X8JA 3OMLA 1U1DA 2BKEA 2ZB4A 1PW7A 3PTLA 4GRAA 5LDGA 1DT3A 1AQYA 2ZWAA 1VSQA 5BV0A 2QP4A 5LZ5A 1F5SA 3IVXA 2IT1A 4YGYA 5FAKA 3UIEA 3EQ7A 4ARIA 4EP1A 1M54A 3PZRA 4M9ZA 4WKGA 3P19A 4MVJE 2OY0A 3CX6A 1YZHA 1MBZA 5AVOA 5T4EA 1OZ0A 2DUWA 1E1NA 3ONFA 5KNCH 1W4ZA 2WF9A 4ZK2A 3RGWS 2J0EA 3PDIA 4YCSA 2CJWB 3EVTA 3RSZA 1TUEA 2GYYA 2O2XA 3JY6A 3ROZA 4U7DA 1QE5A 2DCMA 3UJNA 1R0KA 1V6AA 1K66A 3QX7A 3EIXA 1RABA 3G5MA 1KBQA 4LJRA 5D00A 2WHQA 3EIQA 4GXNA 1W75A 2AX4A 3IB6A 2QUAA 4WNAA 1TQHA 1H8ED 3LTNC 1KWGA 2PZKA 2IZ5A 4MKHA 1EVEA 2VPXA 4KDCA 2BFAA 3OMWA 1ZJWA 3Q8XB 1R4MA 2R11A 1JEYB 1UQRA 2PGNA 4PLFA 5CM8B 1FY2A 1U7HA 3N3AC 3KZCA 3SYMA 4HZIA 1GQRA 5EZQA 3GRUA 4KYVA 4XRGA 4OQXA 3E5NA 1M0WA 1C14A 3K9GA 6LDHA 2XQVA 5JZOA 5I4KA 1B6RA 1MIHA 1U0EA 4H08A 3U1TA 3SHTA 4D7AA 2JEZA 3TG8A 3ZIDA 1XNGA 4CBVA 5TXGA 2FSVC 2K6GA 2XOKD 4Q1BA 4B7ZA 4EITA 3RWBA 5KAMA 3VOAA 3Q0EA 4PZUA 3BMNB 3DT8A 1O77A 1ZPDA 3CN9A 4RSRA 2X1VA 1JIXA 4F4CA 4OI4A 3ZGXA 4CIDA 5G4KB 2NXEA 4EVSA 3P26A 1VL1A 3HPQA 3T52A 5LYJF 4CGZA 4DSNA 3QLUC 5JS2A 2VCHA 1T9ZA 1XJ0A 4JMLA 2WD9A 1IN8A 3QLTA 4S2EA 4RY8A 1PJSA 5KSYA 3RU3A 2XODA 4K6HA 1MTOA 1NXVA 3BM5A 5ADVA 4UBJA 4HUQA 2BFCA 3N2LA 4L07A 3VZQA 2PQ2A 1AC5A 2QQEA 3CGGA 3GFSA 3ND7A 4RF2A 3ROTA 3PUKA 4EYKA 5ALKA 5IN4A 5KOJB 4AS3A 1RLUA 4BMOB 1I3KA 3ZVKA 2BBSA 5HUHA 3CU5A 3LK7A 4ENPA 1C30B 3ECAA 1UMCB 3IA2A 1TO6A 5EYPB 2IKQA 2CJFA 1F1JA 1JP7A 2DBVO 2CFTA 3RT7A 2H29A 2OLEA 4WDQA 4AYTA 4BWGA 1IC6A 2ZE8A 2HFKA 5EKTA 3LT5A 1MJNA 3DV0B 3OQMA 2HLNA 4B46A 1BVHA 2NZVG 5DGCA 4JLMA 2J5QA 4FUQA 1EFVB 3CF6R 4UPEA 2AGVA 1GTG1 4OAQA 4ZOLB 4KP7A 1UMBB 3QKSB 3LX4A 4XDHA 1A7UA 3V3KA 1S8AA 2PVPA 3UENA 2E87A 4D6XA 2P9HA 2P9JA 5E3IA 3U5TA 1Y9ZA 3X1KA 1T24A 2QTNA 3TOSA 2P6UA 2XYGA 3QEAZ 1XRLA 4UU8A 4EKNB 3WLLA 3L4KA 2B9EA 4QJ3A 3UGKA 1EJ0A 2ZI7A 1TA4A 4K87A 4B4OA 1C3OB 5FV7A 3AETA 3EVFA 2ZSAA 4JXXA 3OF2A 5HXAA 5FB3A 4PTYA 5HA5A 1WIWA 2DCUA 3DAFA 4PHTA 3WLMA 4HMOA 4Y6RA 1T9GR 3RNOA 1H0RA 4YMWA 1JDUA 4YMHA 1Q7BA 3BHIA 1YD7A 2Q99A 2QD4A 3JQGA 1NQUA 4KMMA 4BHTA 1YOBA 2DH5A 3ETCA 4FYYA 1T6BY 1JEEA 3KQWA 3B6IA 3I8SA 2IITA 3ZGOA 1U2TA 1UBHS 3HDGA 1KP9A 1U11A 3LOUA 2UUOA 5AKKA 5KKAA 5C3MA 3AESB 5ELLA 5THKA 3WMXA 4KVFA 4R9NA 3UAYA 1UOPA 5IT9A 2P65A 4DZTA 3HADA 2AUNA 2CHEA 3ANNA 5JD3A 5BT8A 1MW9X 4LJ9A 4O2AB 1JA1A 4QHSA 4X9XA 4RNDB 5BWBA 1S8OA 4TKZA 1Z07A 3E2MA 1F3OA 4ETIA 4LF9B 2ZS7A 2O8NA 4MZDA 1NBWB 1TKBA 1TYBE 4J16C 4I1RA 3QOXA 4IG9A 3C85A 3QPBA 3T7JA 4BKPA 4FFVA 5B55A 1GGKA 5JTUA 3RLIA 4L51A 2BKAA 4ICIA 4JXJA 3D7RA 3MWDB 3GARA 3ODGA 4UDXX 1X3SA 5F7XA 1F4VA 1JAZA 1ENYA 2FSIA 2Y8EA 1M1YE 1IXSB 4G9GA 5FP0A 1YIAA 2GXSA 2P2CA 3HSSA 2ZWVA 4WBNF 3OEED 3SSNA 3I3SR 1B6GA 1CSEE 4IF6A 4LE2A 4RENA 3EDMA 5JZBA 3OZXA 3MS7A 1GARA 1D0IA 1SOAA 4Y1RA 2B1IA 4JC0A 5JS6A 4A15A 4URFA 5FEMA 5EZ6B 1FLAA 3UOWA 2E82A 4M7OA 2XQFA 4S12A 2RD2A 3ZCVA 1JL3A 2AK3A 2VXBA 4TTTS 5DEOA 1H0HA 2Y4NA 4MKGA 2ZKLA 3FNGA 3R7WB 3AHCA 3KPWA 4BQEA 3AP2A 3L1IA 5BUQA 4W5QA 1EHYA 1C7IA 1Y3CE 3NEYA 1GWNA 1DIRA 1YDGA 3HB5X 3HCPA 3OIYA 2ZTMA 2PIAA 3ZI4A 4WE3A 1L5RA 5F2NA 3QJ5A 1JAYA 1KFEB 2CDBA 4Q34A 1X9GA 4TS3A 4Y3UA 2AFHB 5ERGB 3Q40A 3WFIA 4ES6A 4F84A 2PH7A 3EGXA 3TFWA 1J00A 1XAIA 3HY6A 3C3KA 3SZLA 4IFIA 2WAAA 1QDLB 1NDQA 3QXGA 3C3YA 3LKVA 4JJ4A 5D5HA 5AMXA 2YRWA 1TIBA 2ECKA 1RJEA 1W2GA 1GUBA 1FF9A 1YB5A 1A4XA 4IX1A 4PGGA 3RRJA 4AMUA 2OVFA 4GZ3A 3C2QA 1UODA 1RQGA 3SJAA 2CYAA 3I28A 3VTFA 4RHUA 3ZNOA 2BEKA 5JSZA 2GFHA 3LT2A 3SK0A 3CLHA 4ERXA 4NJEA 1E3SA 3JS5A 2V9CA 5IAOA 5M7EA 1NNEA 2AG6A 2H1CA 3PXBA 5BR7A 3TNJA 4LF7B 4KUGA 3IAUA 2FW9A 4PY2A 4DMGA 1NUTA 1J20A 4IYRA 4FOLA 5BWMA 3OZUA 4RD0A 2IZ6A 2YW2A 2ZBQA 4MV5A 5DWQA 2BR3A 3E7XA 4FS3A 1J07A 3OJEA 3FDIA 3RUDA 2JI4A 1DARA 4MPJA 3I1YA 2DSTA 1UXKA 3AJDA 1W85B 2OGZA 5SYAA 5DE3A 5DOZA 2D7DA 2HXYA 5MGBA 1NNUA 3U19A 3NALA 4OHPA 1CZNA 3NHSA 4KFRA 4YDQA 2ZJZA 4KPGA 2H1HA 4EW3A 1IPEA 4US2R 4WXEA 1W44A 3LY5A 1JVBA 3GYGA 5JYBA 2JCYA 121PA 1QKJA 4YRGA 1VFNA 2H9AA 2Z3ZA 3GNTA 1PJQA 4YJHA 3AG5A 1F7VA 1MFPA 4Q3CA 4QLAA 2YHIA 5IK2D 4XPIB 4BY9E 3MGBA 2HCTA 3RARA 1HNXB 4L1KA 5KSOA 2G17A 1L8OA 4HATA 1TZ2A 2BJHA 4PX2A 4YX9A 4BQOA 3GFGA 2X1HA 1CY7A 2OV1A 3B3AA 4P3YA 3NPMA 2F3RA 1LCIA 2BSXA 4DJTA 1LSSA 3W3ZB 1VOTA 4GL2A 4C1BA 2BMJA 3JQBA 4EHHA 2VVTA 3COZA 4Q66C 1ZJ4A 2GPJA 2XEXA 3C15C 2YRFA 1Y3DE 1Y5MA 3OZ7A 5DI3A 1COZA 1XVAA 1G3RA 2IOHA 2NNLD 4IIVA 4YCCA 5BN4A 5KWEA 2HA4A 4EWLA 3WLEA 3LDHA 1E9RA 2QE7D 4YREA 1CQPA 1RI4A 4CMIA 5LP6A 4DEYA 1G55A 5IASA 1T4GA 4BNIA 4AX4A 2CLHB 1JPJA 1Q22A 2ODAA 4L76A 4EL5A 3S6JA 5D3MB 2A9RA 3NBAA 1TZKA 4IX9A 4W1QA 4HN2A 3GN2A 4F7WA 1BOFA 2P5YA 2RGUA 1IM5A 2HNKA 4DRXA 1JIKA 2A86A 4DVJA 2JFXA 2J9XB 2WHPB 4WERA 3KKNA 2IZ1A 3CH6A 2ZTSA 4M0DA 3V00A 4TYWA 4B33A 4G0OA 5ARDA 2DUMA 2XKJE 4LXIA 1RFLA 2CVHA 2ILVA 3ND5A 4NHEA 3GUHA 3TTUA 2YWJA 3UMFA 2AZMA 3M6MD 1KI9A 1SZPA 3T5AA 2ODTX 5BSWA 1JXAA 4LJLA 4CKEA 5K5EA 4QHTA 3HZRA 2VAXA 4RJTA 5EP1A 1N0HA 2BDUA 4L7VA 1KYQA 4LRYA 1T3ZA 4QFMA 5J59A 5JV5A 3HJNA 1ZAYA 3CN7A 3LWBA 4P0PB 4OF4A 1L4BA 4MP8A 4X0EA 1OC2A 1QR2A 1R0YA 5ALWA 1RPTA 3UATA 4QG3A 4W5NA 2VZ9A 5JH7F 3QU5A 4TLAA 2I6FA 4WNAB 4XXHA 4CMJA 1KL7A 2VK8A 3N53A 1HQKA 1JWAB 5HZHA 3V1MA 4HAXA 1JEJA 4KQHA 5H59A 2ZT8A 1RKXA 3WQQA 1SHZA 4KIJA 1C3EA 1K6JA 1XSEA 2J9FB 1N5KA 3AEQA 4MWGA 3UAGA 1F0NA 3BFVA 4XB2A 5DKFA 5FPTA 5D3QA 3FHCB 2MSDB 3EYAA 4RGBA 3W5HA 3UANA 3I01M 2C4VA 2GAAA 1HNWB 3OJFA 1C0LA 4QBHA 5CXSA 3WYAA 2CE7A 3K1AB 5DTMA 3HO6A 2R9VA 1D03A 1SU6A 4YJGA 5LP6C 3SGLA 5HR5A 1I2ZA 1OFUX 3AF4A 3JYNA 5D85A 1N6IA 2QA5A 1MNQA 2WAXA 3HP7A 1T0IA 2QD1A 3RSCA 3LQQA 1GV0A 3A3OA 3R4VA 1YC2A 1TUGA 1E9EA 2FGKA 4LRWA 4B9AA 2ZW9A 3KALA 4CFSA 4PSDA 5H4HA 5FL7D 1D9XA 4I3GA 3R5TA 4OXIA 3HCWA 4U9HS 1P1FA 3R8XA 1E8DA 3QPVA 3GRZA 2QN7A 3NJ8A 1T9DA 2A0KA 4GUDA 2FPGA 1W5BA 1IU9A 3TRFA 1PBTA 3ZTTA 2WNHA 4R2MA 3EXEA 4LA4A 2CFOA 4LMAA 4IRMA 2PGAA 4UXIA 5C34B 1VIMA 3Q7EA 2OOKA 3ISTA 4O02B 4TRJA 3FTQA 3WL6A 4KNYA 1RRMA 1AUVA 3GDOA 1ZINA 5I6DA 1R37A 4QC2A 4BVEA 2Q29A 2BC9A 1DQSA 3OIUA 5J58A 2H63A 4DQVA 1DBIA 2UZIR 3G85A 2JCVA 5BO5A 1PW5A 1XF1A 3KUXA 1KK1A 4CEIA 4EHIA 3GLGB 1OIXA 2PS0A 4HP8A 3WDSA 1P33A 4CUJA 2QPLA 2EJWA 5H0IA 1WDTA 4BV8A 3N58A 5BN3B 2ZLBA 4ZA2A 1UMBA 3QKSA 2GZSA 5J63A 3ZE8A 4Z54A 2Z5VA 3AZOA 4Y9RA 1ZH8A 4ZOCA 1T0JB 3NDPA 1DLJA 1XVIA 3EQ2A 3L2OB 4LDPA 1RYEA 3H16A 1OAOC 1LVHA 1WXEA 1YJBA 2VSNA 2B21A 1OMOA 5EMHA 3T7SA 4D0SA 1KRWA 9ABPA 4QQFA 5J4HA 4MTLA 1M74A 1H6AA 3Q7PA 1DEHA 2DBZA 1JLSA 2GXUA 3NHFA 1WPQA 3Q3EA 4KQXA 5K03A 1P1RA 3GJ8A 4FLFA 1SOUA 3AEKA 3I9KA 3BIJA 4EJSB 4RM2A 3C4QA 3A32A 2C7PA 3BE8A 3R3WA 1HDYA 2CYCA 1ZI8A 2AC2A 4WADA 4I50B 1XZKA 3IOCA 3KUUA 5TY0A 1M1UA 1ZH2A 5BSEA 3JQGB 3DPIA 5JALA 1NJSA 2OL4A 1JA9A 4MRAA 5IN5A 1P3JA 1W6UA 3TLYA 3TZ6A 5JRJA 1CQXA 2P5TB 2ZETA 4HAUA 1RD4A 5CGQB 2JLZA 2LKDA 1NG1A 4N0QA 5CJ2A 3CWCA 2WUEA 3EODA 3VYTB 2HH9A 3OHMA 3TJZA 1G8KA 2IX9A 4EMSA 4Y2UA 4UU1A 4UOEA 3ZHRA 4B6PA 4MQEB 2GZMA 3JD0A 4NESA 3SHVA 2LR0A 1TKAA 2YHSA 3R4CA 5H81A 5TVKA 4KR9A 1YQGA 3S99A 3K0FA 3KB8A 2PLFA 3HYCA 2ZUUA 1ACMA 4GVXA 3GJ5A 2D4AA 4KK3A 1G7TA 3HZOA 4BNDB 4CPDA 5IULC 4Q93A 1XMVA 2O54A 2QRJA 4Q3BA 1QONA 3T99A 4DR5B 2FF7A 3B5IA 1PV1A 2M1XA 3PPIA 1KZ4A 5FO1A 3RHTA 3UWKA 1XTVA 4FFLA 5EPEA 2FPIB 1POXA 4JBLA 2XMCA 3IVRA 3HKCB 2EGUA 1F8XA 4MUJA 2ZIZA 2GEKA 2PRIA 3ZHUA 1Z88A 1ODTC 3RJ9A 1BMTA 4IZHA 1B7GO 4BLPA 4KPFC 4GX2A 4Y1EA 1B3BA 4D4GA 5BV8A 1I10A 1B4DA 2AMYA 4JXZA 4B6RA 4TRNA 3CT6A 1ZLYA 4YRSA 2VK4A 4OHBA 1CRLA 3W5UA 2IYZA 4ZHSA 2P11A 4CT0A 2FGJA 2B3DA 4BNUA 3TS1A 4EJ6A 4A2PA 4EABA 3L1JA 1M1NA 3BTOA 1EI9A 4JS0A 1NQVA 3PDHA 4GQIA 2GCIA 1BCRA 3ICQB 2BR5A 1NU8A 5TARA 1XTPA 2CMKA 1CY2A 1JA0A 2QMOA 3CNEA 3CXRA 2ZREA 3MLAA 4RD6A 4UHFA 4E11A 1BEZA 5A4AA 3WBFA 3BMQA 5JJLA 1J0EA 3BREA 4CTNA 2D5IA 3ZLUA 4B2YA 4D9MA 4YQZA 2FX5A 1LF0A 1P0PA 1GZ4A 3RAGA 4FLMA 5JAOA 1KS9A 5LQAA 1Z6XA 1Z73A 4DCGA 1SIWA 4PO9A 5FLKA 4UAUA 3ZW9A 2FZKA 5CYFA 5C8XA 5JZ9A 3AW9A 5JY6A 1W1WA 2QLMA 5DBIA 1KVQA 4CKBB 1UBOS 3KSBC 4ZANA 1EFLA 1U3DA 1ZI6A 2Z2KA 1OA0A 3DEYX 2I76A 4PX5A 2VQ6A 1AX9A 2F1OA 2TMDA 4GD3Q 4I3FA 2WVJA 2VNJA 1GILA 3A7EA 4KQ2A 3ZHYA 4QQ8A 5CPFA 1AKRA 3VA7A 3DTVB 4TZKA 3NYQA 3AVWA 1FA9A 1KVSA 4BAUA 3JWJA 3UHFA 4FKZA 1NVUQ 1RRPA 4LNUB 4XH9B 4B9EA 1IK4A 1W49A 3U60B 3LCVB 2QRMA 1VHDA 1QAQA 2JEOA 4BO1A 3RVJA 3DXYA 4FYXA 1MRNA 2WJZB 2FP4A 3KT0A 4S1TA 5REQA 3DDCA 1USWA 1Y7TA 2AOTA 3HKDA 3NBUA 3U3JA 1QF7A 4IR7A 4KFSA 1E5DA 4EG4A 4ZI2A 2CDCA 5FX2A 5BVHB 4OMUA 2NXCA 5I4CA 3CRZA 4W5OA 2B8WA 3I5MA 5T67A 1AO3A 5I9BA 3RUHA 2ANBA 4A10A 4EX7A 1APBA 3T3IA 1QU3A 1REQB 4GSLA 4BDTA 5BQXA 1H2RS 1E3EA 1QZ3A 1XQ6A 2QR3A 1XNQB 4BWVA 1Q6ZA 3CF4A 3QWFA 4M0UA 4Y9SA 4A6XA 5IX8A 4BE4A 4DOMA 3ZE6A 1X38A 2Q5JA 3A1NA 2ZJBA 2ZROA 2QX4A 3RKRA 3PQEA 2WJ4A 1CUFA 3IMCA 3K53A 2Q62A 3L8GA 3PIRA 4RIEA 1P6XA 4PBSA 4X54A 3QEBZ 3V1LA 2IUFA 3MINB 2O6HA 1XHLA 4FSDA 3DNMA 1R6AA 1L4UA 2R62A 3HLYA 1PD1A 4Q3NA 3P9QA 5A9TA 2R2AA 3U61B 1Y8RB 1P7WA 3HCOA 1QVWA 1N2XA 1M2GA 3WLSA 3ETNA 5IBPA 2IYNA 1Z5VA 3T94A 4Q1VA 3NBFA 4F9TA 2WPDA 4NENA 1CE8A 2EKDA 3H17A 1XZAA 2QMQA 1KMHA 3DE6X 3MJRA 1MRSA 1XHEA 2V0CA 4Z1MA 4DYHA 1O9GA 3NEPX 4TLLB 4NYJR 2CXUA 4DNFA 3A4VA 5JO9A 1VXRA 4CDMA 3ECCA 4PC3A 3AGPA 4ZFNA 1EHIA 1DSSG 1RXUA 1ZIXA 2NV0A 3EQZA 5D3MA 2AYXA 2ZRFA 3DBRB 5JCOA 2HMAA 1BXGB 2C9ZA 2ZB3A 3IRUA 3UJPA 3AKEA 1Q5PA 4Z3OA 1ZH0A 2Z3WA 2J45A 3IHKA 5EUCA 4AWBA 5AVUA 1OHHD 3KXLA 4PM4A 3HJAA 3U3MA 3DXZA 4LFAB 2IEGA 2I3ZA 4LBZA 3GJ7A 1JDZA 3D7KA 2PUTA 3F74A 4PCAA 3ROEA 2XZDA 2V1UA 1M5RA 1LX7A 2BZSA 2IYVA 3PG5A 5HIAA 2HF7A 5G2OA 5CFRA 4WMLA 3T3NA 1YMUA 1MQ9A 3O82A 4RTLA 2WUFA 1XXHA 2QQ0A 2R2GA 4FBMA 1CUBA 1ETUA 1XD9A 2W71A 2VPIA 1X7ZB 3EGDA 4K9RA 3L93A 4CKEB 4NV3A 4BTEA 4OQYA 3RREA 1D2AA 4ZK6A 2ERYA 1QQAA 1HYEA 3EVBA 2OYRA 1NKVA 2QT0A 1UWLA 2Q4TA 3LC2O 4J0KA 3UMSA 1PNRA 4FXOA 3KSUA 3TDKA 4DEVA 4DLKA 2QLNA 5BNWA 1MW8X 1J4AA 2QVBA 5IYZA 3L02A 4XQ9A 1R2QA 2HDNB 2V5VA 1ZD4A 2MSKA 3RNLA 3PQ4A 2PUFA 1G16A 3OBIA 1FJGB 3EZ7A 3ONEA 3SY8A 1E1DA 4YRFA 4WBNB 5KB3A 4K2HA 3GJ3A 4MW5A 4N0MA 3H99A 4H16A 1J8VA 3ASYA 4MRRA 2OWDA 2YV3A 4EPTA 4REQB 1RE1A 5IBQA 1B73A 1C9EA 3AP1A 3FRHA 4CEIB 2WA2A 3SYTA 1EUQA 4Z1MD 2I2BA 5AD1A 2A9QA 2WWIA 1U94A 3LBYA 3K0CC 4MYRA 3WYFA 3MAJA 3UYKA 4E46A 1K4YA 4MUEA 1PJ8A 1Q0LA 2QRKA 3QKWA 4M46A 1RQRA 1JH9A 3C6YA 1FFXB 1TADA 3CTVA 1N2BA 2OG2A 2YV4A 2V97A 3SJZA 2FWAA 2G7MC 1RSZA 2WDPA 5DXAA 5JVDB 2MYUA 3B78A 3SXUB 3I76A 1QV9A 1JEOA 1EGAA 1NYRA 4JLOA 2I9PA 4EAQA 1JW9B 1QFXA 3P9XA 5B1YA 1G42A 3T0GA 3E18A 1P81A 2W4IA 3EGEA 4JKIA 4HEA6 3D6NB 5AJZA 3TZEA 2OGTA 5U9CA 3BKXA 5B1IA 4YALA 4ZT4A 1KJZA 3PUHA 1YQXA 4ZVSA 1Z0IA 3ZC3A 3H42B 3CS3A 1I3OA 5JPIA 5JCJA 3HJUA 3FF4A 3UUFA 1ADFA 4WOKA 2BUAA 4IEEA 1R4NB 4CMEA 4IPTA 2IHKA 2WMOB 4TKLA 1XTIA 3B38A 3NTUA 3WOVA 4BWYA 4B3IA 1UXIA 1HTBA 1U3TA 3M3DA 3TCXB 4RTSA 1YOVA 5HIIA 3FWZA 3TXYA 5CITA 3TQOA 3DAPA 4UULA 1QHIA 1XRMA 3QPCA 4I81A 2PKQO 1EFUA 1ZZGA 1YR1A 2NUAB 2C4UA 4MULA 3DE7X 4LX0A 1OV4A 4Y1GA 4E08A 1D4ZA 3UMBA 3PWKA 1NU6A 2JJ2D 1DWPA 2IOQA 1GO2A 4K03A 2XWPA 4QL3A 4V0KA 4B81A 4HWOA 3DEFA 3SNHA 5DSZA 3PFBA 5GONF 2BT4A 3O84A 1RP1A 2G77B 2GO1A 4JJAA 4AMYA 1EP1B 4M86A 1XALA 4JY7A 2P1RA 4PRZA 3HO1A 1FVXA 4UNRA 1UJ2A 1N2GA 4IEIA 1A8QA 1H2BA 3LCJA 4RPCA 1PNOA 3TO5A 1TRKA 1VL2A 2JFVA 3TKLA 3CZ5A 3HKCA 3BD9A 4EZBA 2C61A 2XHEA 2EDAA 1VSUA 2BAGA 4RFLA 4Z7OB 1RXYA 2VTEA 5ITZA 3HWSA 1WTCA 3OU7A 2NTVA 3QIVA 1JKXA 3HN2A 5IWAB 1EDZA 4D43A 1R1DA 1U7ZA 3L0YA 2F3UA 3HJFA 2C2ZA 2JFPA 4XGRA 3CH5A 2GUGA 3KYDB 5KCZA 4ZAGA 3VC2A 3X2SA 4EQ6B 3L4BA 1Y4ZA 3FGPA 4XM0A 1YQ9A 1UIMA 5DMXA 3T15A 4CN8A 4MHTA 2Q3HA 4PAMA 4RDIA 1NJGA 1T1RA 1V5IA 4HO1X 3T3OA 1Z0ZA 1CJSA 2V7PA 3H0KA 2VP4A 2X6QA 3GFRA 3QELA 2HU2A 3CPSA 3LFTA 5CYPA 4FDTA 4DCVA 3O1JC 1DRKA 3ZLJA 4LV5B 3WB9A 4PFKA 1IB0A 3X1MA 1XTTA 5E9QA 5CDFA 1ZN9A 2HKIA 4FE3A 5F5NA 3ZBPA 5F9HA 5MFZA 4UJ5A 1K8RA 4KQGA 9ATCA 2YXEA 5BWOA 3GG9A 2UZ3A 4DR7B 2BFDA 1GKYA 2ONZA 2DECA 1QIEA 3BRWA 4UCXA 2DPMA 2VNAA 2NW6A 4POAA 3OPNA 2DT8A 4BFCA 2OEPA 2ZRLA 1U7TA 2W37A 1E4OA 2P41A 3GN1A 4QXMA 4LCBA 2E89A 4NV1A 4UNIA 5DM60 4BLQA 2O2ZA 1Z5PA 1X86B 4OGGA 1VHQA 2O8DB 2XW6A 1CFJA 2E48A 2I3AA 3GLHB 3UCXA 4CMKA 1HR0B 1F6WA 2WILA 5KYUB 1AV6A 4EG3A 4Y6OA 3AHIA 3SIRA 2CVFA 4DNQA 5FFFA 1VLLA 1KH3A 4J0IA 4D2IA 4YV7A 1FPQA 2IZOA 3N2GA 1LBSA 4UUMA 5DSTA 2HCBA 1CYEA 3GAAA 3ONNA 2C3PA 4G5XA 3KJIA 5E4FA 4ARUA 1QH8B 4R8LA 3OX2A 4F2DA 1O94C 3SVZA 2OCLA 4DIEA 5DN6A 1EXNA 1K27A 3WGHA 1BCRB 1WPGA 4GYYA 1SC4A 3DCJA 3GLVA 3AKCA 5FO0A 4IMIB 4DMHA 3CG4A 2VATA 4GMGA 1B2RA 5K09A 1K92A 2PZLA 3KELA 5I5EA 3KYCB 4B43A 5KX5B 2P68A 2R4QA 1NUSA 4IZOA 4NMHA 1GN9A 1G17A 4RS4A 3RS9A 3AOGA 1PVOA 1NLZA 1ZQ9A 5EFZA 4TTPA 4AKHA 2O7QA 3DD1A 3H1AA 1V1JA 4M76B 2N47A 1W8DA 3ZI7A 1J21A 5K4GA 3C70A 4EKYA 3GT4A 3QE3A 4R0NA 3OZWA 4CKBA 3UMCA 2AC4A 1GG8A 3RTEA 1Y6FA 4JAVC 2Y1KA 3GEDA 2RGXA 1SGWA 3GJRA 4HZUA 3PL5A 1Y6QA 4PYMA 4WY2A 3TBKA 5LIRA 1G18A 3MELA 2IH5A 1DDOA 5FI5A 3TL6A 2OZPA 1FW8A 2R00C 3ZIAA 1ZM9A 3DTVA 1YR8A 3PXCX 3VKGA 1R5OA 1LU9A 1U2DC 3FOCA 5TEWA 2QVCA 1I8TA 5LOVA 5U1PA 1X1BA 3DWEX 2EJUA 2NQTA 2QX6A 2VBFA 2JIMA 5DDIP 1VSBA 3NTQA 5FBLB 5IAJA 3VVBA 3DVRX 4AWXA 2NUTA 3FTCA 1HZJA 1U0JA 3LRTA 1NMZA 3U62A 4YT8A 3O4JA 4QM7A 1ZRMA 3R5HA 4JV5B 1KY5A 3NVAA 2QD5A 2GPAA 3HI6A 4YMTA 5CB4B 4I1UA 5ER6A 2CEKA 3HU2A 2C8LA 1M2OB 1H3FA 4TKMA 5AJYA 2PTGA 1BDMA 4NNJA 1MDFA 4ENRA 4EKEA 1QGOA 4ZTBA 1NR5A 3TVDA 4RC9A 2Q0SA 3OA2A 1EBFA 1NN1A 4CMHA 4EYEA 4N03A 4LN1A 3Q0IA 1T1EA 2WKQA 1WSDA 3ORRA 1JG7A 1MV5A 2VRWA 4B47A 2YY6A 3LC1O 1IIRA 3AUAA 4ZCIA 4A36A 1K8ZB 4NR0A 2JAOA 2OILA 4YI3A 2Q4RA 3RJ5A 3P2KA 3CE9A 2A1IA 2D0IA 4OXKA 2VHCA 4OU5A 5DCYA 3AGQA 2ONJA 3ZH9B 2GN8A 2IEYA 1EIWA 2ZRHA 4JBGA 1NW9B 3LXRA 3M34A 4ZMSA 1S6YA 3U49A 4UDNA 3JWIA 1CUDA 4TKVB 3E03A 4NAHA 2AYYA 1W0KA 3NH9A 1OX4B 5H4GA 1T10A 3F5FA 1W36B 2FE4A 1L7OA 4EB6A 3MAAC 2PYDA 2D2VA 2DTXA 4QXAA 5EZ5A 3MS4A 3B3QA 3EG9B 3HMQA 2RG7A 3TQSA 3U17A 4LYGA 3NFYA 5K0LA 4YAGA 1R0SA 2FUKA 2QM8A 3PNVA 4XSGA 1M2KA 1XJQA 1U04A 2A7XA 2C5FA 2F3QA 3B60A 3M6VA 2K2WA 1K8YB 5D87A 5EZYA 4QQKA 5CVEA 3CLUD 3FYSA 1IEWA 4ALNA 2OKCA 2FCRA 2LIPA 2ZJFA 3R20A 4F04A 1L5MA 2XUZA 1P9WA 5GPBA 3EXG2 3U3DA 3Q72A 5E9JA 5KYKA 1QTRA 2ZIVB 2PSSA 2I99A 4ZP1A 4HRYA 1N0IA 4JIMA 1X2BA 1QHFA 1U8ZA 3UK6A 4UATA 1O8BA 3D3WB 3N74A 1RYDA 3PIIA 1RHRA 4OY3A 4YP1A 2E6KA 1NZFA 1Z25A 1XEXB 3GR6A 4J16A 3G0CA 4WK6A 3TW6A 1BWSA 2XI4A 3BB4A 5AM4A 4YY3B 3OM0A 3COSA 3H1BA 2HJ9A 3EQ9A 4HH3C 5LQNA 1U2DA 5KEIA 3HA7A 3DP7A 3VPDA 1CG6A 3PNBA 3DZJA 1Y9JA 4BKQA 3GT3A 4QM6A 4MICA 5E3HA 3F7TA 5LWQA 5EWMB 2I6UA 4UUOA 1JLLB 1AKNA 2XYQA 2EG5A 3OE1A 4HUTA 1ZOOA 2B5WA 1QKIA 1Q1ZA 3PUYA 4YRQA 1GL6A 1M9NA 2ORYA 3BJIC 3AR6A 1AA9A 3PPWA 1C5KA 3T9EA 1A2OA 3JSXA 5AKEA 2MSNA 3WNVA 4AYWA 5BQFA 5I7OA 4ARZA 2AYZA 3HBLA 1JS1X 3HBMA 1IHDA 3GPCA 2XDAA 4TUYB 2UUCB 3TUJC 3GLQA 3K0HA 5T4BA 1X19A 4WNCA 1XJCA 3ZYCA 4RDXA 5JANA 1R3UA 2XBLA 4ESOA 5HKAA 4L8GA 5C0OE 5HJEA 2OZVA 3GU3A 1KYYA 3P2IA 3KEOA 3H2SA 3QXXA 3H11B 1QFYA 4ACAA 5EJ7A 4MGZR 4US1R 5JQGB 1ZYUA 1QQ7A 2H2AA 2HMTA 1UBKS 3QPAA 3CJQA 3FYUB 3G8AA 1CF9A 4ZVPA 2OMEA 4JL5A 1BN7A 2Q21A 5IF9A 2F64A 2HRDA 4ZPXA 1IEQA 3H5LA 1HYQA 3WYNA 1X80B 1Z15A 3EVNA 3WRYC 2Q27A 2P6OA 3GGSA 3KVOA 2X3FA 1FTQA 3DLBA 1XTUA 1OI4A 1Q2UA 2NG1A 2ADFA 1JEYA 2WBLC 5CLFA 1N3IA 3OWXA 4JJKA 2Z3VA 3EBLA 2MDTA 4LYYA 5CJPA 4CMAA 5KYWA 3FPAA 5G0TA 3AERA 1I24A 3TLCA 1WQ1R 2IPMA 1V35A 4I9HA 4IGIA 4CVNA 3GOQA 4TQUS 5FF9A 2V0GA 1EK5A 5AI4A 5EFOA 3A6HA 4AMGA 2WIGA 1H0SA 2O2CA 1WEHA 2ZITA 3A9WA 4HBZA 4YV0A 2HRZA 5EI5A 1CXZA 4TWAA 1N2IA 1OROA 5H02A 5IH7A 2YN0A 1OFVA 1CULC 4AJEA 4EW6A 5JXIA 3R3VA 2GLUA 3VC7A 2CWDA 3T12A 1BA3A 1Z4PX 2BJVA 4J0CA 5JSYA 1W4LA 4JCCA 4YVFA 2PSDA 5JCXA 4TZ0A 4QJIA 2W6NA 3D6TB 3S2EA 3DZGA 1L0BA 7GPBA 3MWEB 3M8KA 1NQXA 2WNSA 2ZB7A 1OI3A 3NKLA 5K4AA 3R7AA 2HXSA 1KJ9A 3KCNA 5LN1A 4RH3A 3IPRA 4MW2A 3D8RA 3I2YX 2BFCB 4NBVA 1JAXA 3DL4A 5FH9A 1FX0A 3R24A 1NBME 3KSRA 1BTOA 2XD9A 2Z5FA 3PU6A 2NSYA 4HPXB 4RPGA 4KQMA 4XD7A 5BOVA 4CCYB 2XIJA 2HIHA 1O87A 3MWGA 4HZGA 2NXNA 2FW8A 1S02A 4JSRA 4ZOAA 2YUTA 5CFOA 4DUYB 4FXPA 2GM9A 3GJYA 1Z2OX 4RFSB 4QTTB 1WXWA 5DGXA 1YDFA 4MUBA 4OBBA 1ZM2A 4PRKA 4R68A 3MXTA 3X2EA 3SLKA 2OD7A 5KTMA 3T1TA 4ZT3A 3AC0A 1YHNA 5FL7A 1WKBA 2Y9YA 4H0FA 3RKUA 2XKKA 3AL0C 5JSKA 2OCGA 2J0QA 2ZBPA 1WQ4A 3QENA 2H4ZA 4LVNA 4UTRA 4IILA 4F9EA 3RBXA 1X8LA 2C9DA 1T43A 3FYDA 3HNRA 1I4WA 2Y1DA 4W4TA 5FI0B 5JNRA 1WW3A 1PLKA 3WWZA 4EQ6A 3F4LA 2ZUFA 3TLMA 3GVXA 5MGNA 1A8SA 1G9SA 4Y6GB 3FSGA 2A7QA 5F1KA 4UTPA 3ZGYA 2C96A 2FJPA 3EE6A 4C0SA 4E5NA 1SKMA 4XOUA 3BE5A 1G20E 1O97C 1XZLA 4IDCA 1TQ2A 2ZRNA 3M89A 1Z4IA 1H2AS 4OXRA 1K89A 5A3VA 4B3SB 1PJTA 1J2JA 1FVOA 3EA4A 2EATA 2OORA 2O1SA 3SEQA 4DDTA 1TU0A 1NUQA 3FX2A 3REQB 4ECEA 2WEKA 3IDOA 1EZZA 4G8BA 1BXZA 3G17A 1Y3IA 4IZIA 4FGSA 4RPLA 1LWOA 1RU3A 1YA4A 2WB4A 3QKUA 4KKVA 2BOVA 2JHPA 1OCEA 3H4MA 3P2EA 3Q0TA 1NVAA 4V39A 4UM9D 2LD4A 3L6BA 4CETA 2DFLA 3OPXA 1U7OA 4J29A 1R10A 4EFKA 4HRAA 1CQZA 2H4YA 4RPKA 3AVPA 3H2KA 4F3YA 4ARBA 4HAYA 5A5VA 1MENA 4DA7A 3OFJA 2QE6A 2CLIB 1XMQB 5KVQA 1MOSA 1TRHA 2ONKA 1Q17A 2ST1A 5JQWA 1UBEA 6Q21A 3ZHOA 1T8YA 3GLHA 1KI2A 5KVVA 2GM4A 3QWIA 5F5XA 3DNFA 4LXQA 4MI6A 3FRIA 2R8ZA 4TYPA 2G0AA 2XGGA 4M0KA 1BMQA 2VBIA 2YX1A 1WOMA 4FFRA 4LXXA 4LXHA 2JA1A 3BILA 1TVKB 2W8BA 3F78A 3G0BA 1TXGA 1GNQA 4LG1A 1C8BA 2P40A 2ZAYA 2OLJA 1E69A 3WMEA 1QO0A 2XQIA 1O4VA 1XLWA 2XMBA 3O8QA 4AJJA 3D0RA 3IDAA 1Z28A 4MUHA 4M1KA 2X9NA 4TV8A 4KK4A 5C5IA 3C3CA 4M1EA 4EK9A 1QHSA 1EK6A 2DFVA 1TLFA 1DXOA 2WJYA 4HDRB 4QDUA 3PDCA 3QHQA 1O1YA 2CXQA 5IJZA 2J6CA 3M1LA 2CSXA 2NNWB 3W5AA 4Z9XA 3V1KA 1EBUA 5J2TA 4XJSA 10MHA 1BC5A 3NGLA 5LB2A 4BNLA 2HV9A 2PWYA 4QUGA 4NX2A 1RVV1 2QDXA 3H5RA 4WJLA 2BBOA 2NPFA 3ROKA 4E4YA 1VLJA 1Z4LA 3BQNB 4TV8F 2R3SA 1P4SA 3Q3JB 4TXJA 5ALRA 3VPAA 3LA6A 3DMDA 3H1PA 4I5EA 4NL4H 3U48A 4QDZA 2BKXA 2V59A 4HDSB 2Q1YA 3TIVA 3MJDA 1WXHA 2HA3A 2WVGA 4YJ2A