4GBMA

Sulfotransferase domain from the curacin biosynthetic pathway
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SRLPGIIFILSSPRSGSTLLRVMLAGHSSLFSPPELHLLPFNTMKERQEQLNLSYLGEGLQKTFMEVKNLDATASQALIKDLESQNLSIQQVYGMLQENIAPRLLVDKSPTYAMEPTILERGEALFANSKYIYLVRHPYSVIESFVRMRMQKLVGLGEENPYRVAEQVWAKSNQNILNFLSQLEPERQHQIRYEDLVKKPQQVLSQLCDFLNVPFEPELLQPYQGDRMTGGVHAASLSISDPNFLKHNTIDESLADKWKTIQLPYPLKSETQRIASQLSYELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of functional group activation by sulfotransferases in complex metabolic pathways.
pubmed doi rcsb
source organism Moorea producta
molecule tags Transferase
molecule keywords CurM Sulfotransferase
total genus 101
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gbmA00
4PZLA 3U3KA 3HYRA 3D8BA 1JJVA 2F3RA 1P62B 4C0BA 4MDEA 1KSGA 1IONA 1N5KA 4B2LA 2DFLA 3Q3JB 4Q66C 1E2GA 1SXJB 5C18A 3PEVA 3U6KA 4C2UA 1QF9A 1VIAA 3QPVA 4LDJA 2QT1A 2ZUDA 4JLJA 2MMGA 5C46F 3W8RA 4HATA 2D3WA 2IYZA 1OF1A 2FZLA 2WIAA 4MDFA 2QQEA 5JRJA 2FGKA 1P75A 2OXRA 2OE2A 3AP2A 3QIAA 2B6HA 3FMFA 1ZUIA 2VA8A 3H2YA 2XXAB 1KSJA 2XB4A 3FYHA 4MGKR 2GXAA 2F1JA 2WWFA 1KK0A 1OKKA 4A6XA 2OAP1 1TQDA 1XXHB 2ORWA 4LBVA 2BBWA 3LLUA 1GL7A 5BW8A 2P6NA 2QMUA 2VP9A 1Q1BA 4KFTA 2VPPA 2FDCA 4ZDWA 4QC2A 4TLEA 1DOAA 4ZKEA 5CDFE 3FFBA 3U60B 2WBLC 2DWQA 3NBZC 3K0SA 4MGYR 4JLBA 2FV8A 2W6ID 2ZYVX 2ZITA 4OL0A 4D80A 1VHTA 2ZYUX 2JJ2A 3A36A 2WAYA 1M34E 3M4YA 1L7VC 3WP1B 2JLSA 3AF3A 3C41J 4QHSA 5BN3A 1W46A 4QGHA 5KDDA 4TMZA 3CF6R 2FX3A 3QQ5A 5P21A 3WBJA 2FFAA 1Z83A 2W6IA 3HR8A 5FTJA 1Z0FA 1UJ2A 2RCNA 1S9HA 3Q7PA 4DJTA 3A1WA 4ZKDA 5SZKB 4A9AA 2QSZA 2CE2X 4X8MA 5GADl 4Q4JA 3K0CA 3HU1A 2QEQA 4AYWA 2BEKA 2NZ8A 2BBOA 3AB3A 2WWXA 2VF7A 2YOGA 1GKIA 4FCWA 4Q00A 2CLCX 5JHGB 4ZI2A 3WHLA 2B21A 1Z0IA 2ZE7A 3LBHA 2F1RA 5EE5B 2EWVA 1LVGA 3K0FA 3SFVA 4TTQA 4RFSB 2P5TB 3QY0A 1W0JA 1Z07A 2C96A 1YVDA 2F9MA 2J1LA 2V55B 1XD9A 2J0UA 3K9GA 3IKJA 5E7JA 1TNDA 1M7BA 1AGPA 2BIFA 1VG0B 3QSYA 2WPDD 2EFGA 1OH8A 4RZUA 1VCMA 4RD6A 1Z0AA 3BJIC 4NE2A 2OBLA 5FI0B 2RB4A 5C4GB 1I4TD 1Q12A 1U81A 1FPMA 4XIGS 1XNJA 3U3OA 1Q1EA 1DELA 1H65A 1EWQA 2IXFA 1KKMA 5FBQB 5CYPA 3GEIA 4HLUC 4U02A 3GJ4A 4KCGA 1E2KA 4PXAA 1ZNZA 2ZROA 2VP2A 4NL4H 3SU8A 1IBRA 1EWRA 1OW3B 2QENA 4GMDA 2IS1A 3VR5A 2XOKD 1MH1A 4YMUA 1SKYB 4NCNA 4BFUA 3ADCA 4TSFD 4AY2A 4JSTA 4QM6A 1Z06A 3B9QA 3IGFA 5AJYA 2GTPA 3KQUA 4HB3A 2XXAA 1NVVQ 2JIZD 2ZRFA 4YLGA 4B73A 1CJVC 2GILA 1AS0A 3P26A 4WW0A 1GVNB 1K6MA 2EFDB 1YKSA 1ZVQA 4ESHA 4NBSA 4OJKA 1P60A 3CPHA 4JLDA 5B57C 4F93B 5IRCD 2WOJA 5HR5A 2IC5A 1E0SA 2ZI5A 1K5GA 2KWIA 3NEJA 4A8JB 3QKRA 3VQTA 1SHZA 1LNZA 2FGJA 1Z08A 3M1IA 4HDCA 3QKRB 1TPZA 3BFXA 3H86A 3R7WA 3TSWA 1I4DD 5CK5A 3IBYA 4Q1EA 1E79A 1GL9B 1GDDA 5M04A 2ZSFA 1ZUHA 4G5RA 3CRW1 4EFLA 2ZRHA 3FHCB 4P33A 2H7VA 3P20A 1ZD8A 1XMVA 4LK2A 4EPRA 4DLTA 3Q72A 1W0KA 3UWKA 3VR3A 1CJKC 3LVQE 3LW8A 4C3ZA 2QM7A 5JCPA 2CJWB 4Y0AA 4R2HA 1II9A 1PZNA 5FPYA 1AGRA 1IJEA 3EZ6A 4MKIA 1E2JA 5FUYA 4BPBA 3IIKA 2P6UA 4D0NA 1QHXA 4QRHA 1EESA 1U9IA 1KK1A 1GRNA 3MMPA 3VKHA 2HXSA 2RGCA 3BRWD 4TMTA 3PEYA 3BD9A 1Z0KA 2IBMA 5JZVA 2JLYA 4F4IA 3PXGA 4OK5A 4JBXA 3THWA 1XTKA 1XTJA 1P9WA 1R2QA 3N2EA 4B3BA 4PO1A 4YDHB 4CZ2A 1RJ9A 2CEAA 4LJ7A 2BMEA 4KLZA 3ND9A 2QAJA 1PV4A 2QN6A 3THXB 1NVVR 3W5IA 4C2TA 4BZQA 1FZQA 4IKEA 2GVDC 2A3RA 1XD2A 4LI0A 4DRZA 2JCSA 3MD0A 5DIFA 3WXMA 2O5VA 3IO3A 1HQYE 4LJYA 2KBEA 1MO6A 2DHRA 2X8AA 2ERYA 1NKSA 3IUYA 1G5PA 1OIWA 4B3XA 5EP1A 3AKCA 4FINA 3SYLA 3AKDA 5FOTA 4PQRA 5TDHA 3RSLA 5JI3E 3PFIA 3RSOA 4US1R 3SR0A 3CRMA 3B2EA 3EASA 2D62A 1LFDB 2UZ3A 1D9ZA 2ZETA 4Z1MA 4DLVA 3CX6A 3EZ9A 1XCMA 1E2FA 1UBEA 3UG7A 1CEEA 1II0A 1GNRA 3SEAA 3VFDA 2CHQA 3SDZA 4G5QA 2BHRA 3LA6A 4BRWA 5GJCA 1A4RA 4D25A 2ORIA 5TMPA 2QBYB 1GKYA 4H9GA 2REXB 2Q6TA 2ZUBA 1FMLA 1YZKA 1KIMA 4B35A 2VRWA 4Q9HA 4KFUA 4HEJA 2C2HA 3T1VA 2F7SA 2PCJA 1MABB 1B0UA 5A5GA 5DN6A 1ZP6A 2RGBA 3KJGA 3NHAA 1G3MA 2PLRA 4HLCA 5E7MA 5K8LA 2VHUA 4YONB 3KX2A 4DWJA 4U7DA 2ZU6A 4B6FA 8OHMA 1NN5A 4C0KA 3QUSA 3MWKA 1YE8A 4L4UA 4WXPA 3DPUA 2ZYTX 3QXSA 3OEHD 5FOVA 4DDTA 1OPXA 3SC3A 2IYXA 3AVQA 5HTKA 2C03A 3R7WB 1WMSA 2EW1A 2ZM5A 3FKQA 3KTAB 2YVUA 4HZIA 5BQ5A 2REOA 1UADA 4C4PA 1NIPA 2J7KA 3SYNA 2W2XA 1RZ3A 2HCBA 2GJ9A 3NKVA 4NCJA 2FH5B 3B9PA 3I61A 2XZLA 1UKVY 1WE2A 4HAZA 1J70A 3TAHA 3A58B 4YMSA 2X2EA 1SVKA 3QF4A 2WHXA 3U3MA 3CRRA 2QPTA 2G1JA 4DCSA 4LC1A 1KAOA 5EUMA 4DLYA 1TU3A 1I2DA 1BKDR 4I1UA 3ZZUA 1XPRA 1R0ZA 4FW9A 3R9XA 2C04A 1IY0A 2AX4A 4JSYA 1WBDA 2GESA 3TW4A 4DDVA 1TUEA 2XOKA 3RRZA 5C2JB 4DUGD 3NVAA 3AVYA 1N6LA 3TSOA 2P0EA 1R0YA 4V0KA 2ZPTX 3IBGA 1KI6B 1SULA 1YRBA 2QORA 1XF9A 2XITA 5A0FA 1IQPA 2C78A 2CVHA 5A4JA 4EPTA 2C9OA 4JL6A 1UKYA 1KK3A 2A2ZA 4XD7A 2XZPA 3DMDA 3WMGA 4LYFA 1G8YA 1G8FA 1LS1A 1UFQA 4NU0A 4C0JA 1P2VA 3BB3A 3WNBA 2HXYA 4RJLA 3AV0B 1NN1A 3CX8A 3A37A 1JR3E 2ZQ5A 1P73A 1TEXA 3TKLA 3GFOA 3MLEA 4OQLA 1X1SA 5EP2A 4DSTA 1E9EA 1R5NA 3LLMA 3OZXA 5FOWA 3K53A 2RHDA 4M1WA 5G40A 4C7OB 1GG2A 4BQSA 2PX3A 1NBME 4ESVA 2ZRDA 3OEED 1NVXQ 3FTQA 1Y3AA 1EG7A 4EJSC 3BOSA 3MFYA 4A15A 1G16A 2IYTA 4GOJA 1NSFA 2ZREA 4XTCS 2VSOA 4RKFA 1JPJA 5JI2E 5DI9A 2Y8EA 3CONA 621PA 3IEUA 4NPHA 4F4JA 1XEXA 5TB5A 3AQ4A 4W7SA 2NPFA 1D2EA 1PUIA 3GLGA 2C77A 1VYTA 1UF9A 2JLUA 1XD2B 1XU4A 1N6NA 4PO8A 2ZI4A 2VBCA 4LHVA 1Y63A 1L4YA 5CB6A 2NO7A 4PHTA 4IDQA 2ZRBA 3LVRE 2IUUA 2FSHA 2AR7A 1KOFA 1Z2AA 3NIBA 2JLQA 4NTZA 1HYQA 4OJQA 4PPQA 2MSCB 2SHKA 3EG5A 3ZLJA 3HU3A 1EFTA 3MSXA 1EFHA 2F1IA 2X19A 5EQTA 3NDPA 3U4QA 1E2QA 4GP6A 3SBDA 1L4UA 4D4JA 1CULC 2GEUA 1QHIA 4EUNA 1DAFA 1ZW6A 2GJ8A 2R6AA 4XJXA 5E7IA 4D4MA 4FWTA 3GJXC 4IVQA 5D3QA 4WBSA 2CHGA 4KLNA 4NP6A 2D06A 1IOZA 1Z29A 3TMKA 1Z63A 4Q7MB 3QXCA 2WKQA 4TMWA 1KO7A 1KMHA 4HAUA 4TYWA 1VTKA 4IOJA 4M2LA 3OFND 1II8A 2CLDX 2DY1A 1YR7A 1U90A 2OESA 4G0NA 5DH9A 3FMPB 1HQCA 3QEOA 5G3YA 2FSIA 3ZD6A 4M1OA 2C99A 2D2FA 3FKSD 1FQJA 3F3YA 3MJHA 3KXLA 2V9PA 1NF3A 3B13B 2FFHA 2YNMA 4HUQA 2P5SA 4IDPA 2GCOA 2ZRIA 4LHXA 5FPSA 4YMVA 1OH7A 1CRPA 1QVRA 2FF7A 1AS2A 1R8QA 3BORA 1X86B 2BJVA 2ZI7A 3QVUA 1PJRA 3RS3A 2FG5A 3ZGXA 1OE0A 4M9ZA 3AF4A 2AKAB 4NMMA 4GZMA 4OHYA 4HB2A 2BBTA 2ZJ8A 3ADKA 2R44A 5JECA 3O8CA 4XWAA 1W2GA 4TTRA 1ETUA 3WNCA 3D7MA 3WYAA 3L82B 4A36A 4XD7D 4Q4HB 1UBCA 1X8LA 2MSEB 1XJ0A 3QPUA 1Z5ZA 3QKSA 4LJ5A 5SZHB 4D2IA 4ZDIA 4NKRA 1VCOA 2JJ1D 2ZRPA 4WIAA 1TTTA 1XEWX 4D4KA 4CT5A 4TZ0A 5E3HA 4E5UA 2OZEA 5J4LA 1L2TA 4PX9A 4HZUA 1XMJA 4PQYA 3RNLA 1G18A 1G8HA 4WOPA 4H1UA 4RD2A 1NG1A 2WICA 3EZFA 3K0AB 1SZPA 2CMKA 1P2UA 2QUZA 4TL7A 1P4SA 3DM9B 4CEIA 4MYCA 1X6VA 1P9RA 4DSNA 4UJ5A 2K5UA 1KI3A 1G3UA 4ZPXA 4Z8XA 1E0KA 1A1VA 2WJVA 3BXZA 2NZJA 1E6CA 1MKYA 1XEFA 4IVPA 4TLDA 4DUGA 1DAMA 4P4UA 1EK0A 2QNRA 1NY5A 2TMKA 1OKKD 4Q9JA 4M4SA 3K0EA 2BCJQ 3DEFA 4QBIA 4B47A 4GP7A 4GT1A 3U7GA 3T1OA 4D0LB 2QTHA 4PFSA 4A2QA 4ZCLA 3MWJA 1P6XA 3SHFA 2IYSA 4M22A 2CXXA 3CR7A 3IPXA 4O3MA 4LJ4A 4LPSA 5DISB 1KSFX 3HYTA 2V3CC 1SVIA 2KSQA 2W00A 1DARA 1ZNXA 2RGNC 4TYYA 2J0UB 4B43A 1G64A 2IT1A 1GOTA 3BH6A 1COWA 3QE0A 4OI2A 3UMRA 3V9PA 5LD2C 1ZCAA 6Q21A 2P3SA 3IEVA 2RMKA 4XH9B 2QP4A 1E9RA 4IEEA 3HP1A 5GVRA 2J41A 2P6RA 4AK9A 5L3SA 1KY3A 2CCGA 4RCYA 2BWJA 3RDPA 4P4TA 3EA0A 3BB4A 2ZJZA 5IK2D 3O8RA 4JVMA 2C98A 3K70D 3CNLA 4RZ3A 3JZMA 3OIUA 4GI7A 4JMPA 3SFZA 2DFKB 4DLXA 3AP1A 3CF0A 1IN6A 1LF5A 1OXXK 1VHLA 1CR0A 1Z6TA 4FCVA 2YWHA 2G1KA 4JJZA 4BFVA 4DZZA 3X1WA 3O8DA 3RC8A 1AQUA 1HE8B 1TU4A 4DB4A 2DFTA 1F3OA 1ZJ6A 1DAHA 3CUEF 4TYQA 3BAFA 2JAQA 4QKQA 4TQ9A 1NL3A 1M8PA 2ZE6A 3A1TA 3HPRA 3G5UA 4WA7A 2J9RA 1WB9A 3Q5EA 2FEOA 4KV9A 5JJIA 4D0GA 3MAAC 2PZFA 2ZRLA 3ZZ0A 4HZUB 3U4QB 4IDHA 5IDVA 4M1MA 2N42A 1D6JA 2MMCA 3KKQA 4LBWA 5AJWA 5FR2A 5B64A 3BH7A 3JVVA 5BWMA 4EQ6B 2WJJA 2GCNA 4HYYA 2KB0A 1M6NA 4MYTA 3V4FA 1F6BA 3NH9A 3EW9A 4TTPA 5TY0A 4MUAA 2QY9A 5KUTA 2IYUA 2ERXA 3CM0A 2XEXA 4IOLA 4RFSA 4ACBA 3AUYA 1MOZA 1ZD9A 2P67A 1AQYA 5JWRA 4YMTA 4L9WA 3NTUA 3Q9LA 4UQOA 1KNQA 4P3YA 3RABA 2X1VA 4GOKA 1Z6YA 3D31A 3TJZA 2ZJ2A 5JRZA 5J47A 3HU2A 1UM8A 3ZS8A 3A1SA 4FD2A 2AK3A 2WSSD 4Q7JB 5CM8B 3QKUA 3W8NA 5L3VA 1NNEA 1FQKA 2YWGA 1D2NA 1NBMD 3N70A 4M21A 4DSUA 3CZPA 5TV2A 2ANBA 2BC9A 2I3BA 1N5JA 4FMDB 3PJRA 4LJ6A 5B30A 4IXMA 3KB1A 3H0KA 1Z6GA 4DLRA 2GBLA 2RKOA 5IF9A 3FHTA 2HEIA 2WJHA 2FMXA 1N6PA 1KO5A 3P27A 1Z8FA 5FL3A 4JLNA 5FFMA 5HKKD 4I99A 1W49A 2ONJA 3H4MA 5D3MB 3UIEA 1X1RA 3AM1A 2GZHA 1G7SA 1T0JB 821PA 4NYMR 2JDIA 3ECCA 4Z54A 1F2TB 1KI4A 4TMVA 3LQQA 1E1RD 2ZI3A 3UATA 4TQUS 2Q21A 4JS0A 2GHIA 5DYIA 2UKDA 2O8DB 4GFDA 2WJGA 2BMDA 2IUTA 5EP3A 4NYJR 1U98A 4OBEA 5AJZA 2GXSA 5EXSA 3PIRA 2ZSBA 1RYHA 1LB1B 3ZQJA 4EJSA 3B5JA 2O8EB 1GM5A 1JAHA 4OQXA 2W6JD 1XRJA 4F38A 5FTMA 3W6OA 2QU8A 2GCPA 1Z6XA 1RW4A 1XDBA 3HR7A 1KDTA 2VH5R 3LX5A 2CK3A 3GLHA 3EIHA 1OHHD 3QJYA 4KVAA 3NWJA 2B7BA 4Z8YA 4BEJA 2XTMA 3A4LA 2G77B 3A1UA 2UZIR 3FPAA 5DI3A 5J5CA 5DO9A 1KY2A 3IDQA 1X8KA 5CDFA 4MRRA 2AK2A 4US2R 2OM2A 3I62A 1CP2A 2EVWX 5GJBA 1FTSA 1HTWA 4R98A 2AL7A 3EC1A 2R62A 4NCKA 3RS2A 5AUPB 2RGXA 4URWR 1Z47A 4DC9A 5EE1A 3THWB 1G17A 2ONKA 3B85A 4URVR 4EDHA 5JBQA 5FOXA 1S9DA 3EA5A 3I1FA 1JR3A 2XX3A 1Q3HA 3K9NA 3KFXA 1G21E 2IYWA 2GKSA 1Q0UA 1TMKA 4XWOA 1SVMA 3TRFA 1E2LA 1HE1C 4TLBA 3T1QA 3TR0A 1YHNA 5JLJA 1FP6A 1US8B 3TR5A 2GJKA 4W5HA 1P3JA 2OCBA 2V7QA 2QRZA 2ZJBA 4URXR 2HF9A 3F5FA 4TMXA 3UMFA 4Q1AA 1DS6A 4KBGA 4DLUA 3VR6A 1XPUA 3KJIA 5FBVB 4OK3A 1J2JA 2BV3A 3EWSA 2XB2A 3ASYA 1KI9A 1A2KC 4JLKA 3NHBA 4IW3B 4TT3D 1OFHA 3S1AB 2DB3A 4JVNA 2NMVA 2IS2A 2GEVA 4N3NA 4JVSB 4AD8A 5AJXA 2IYYA 2VHTA 2RGNA 3MGCA 1OB5A 3FOZA 1KDOA 1N6KA 3LAWA 5IK2A 3C16C 4JLMA 5GVSA 1XZQA 2NG1A 4P4SB 3GLFE 2LKCA 2PBRA 2O8CA 3R9WA 2H5EA 3CB4A 5EXPA 3EZ2A 3TIFA 4GPTA 2EFEB 2V54A 3T61A 1OFUX 2XTZA 4DLSA 1EX7A 1H8EA 2RGAA 2VP4A 2WKPA 3UWOA 2DBYA 3NG1A 3GQBA 2Q9CA 4B48A 1KDRA 3DZDA 2C95A 3AEZA 3GEEA 1DAKA 3ND8A 1KMHB 4GNKA 1G8GA 1IY2A 1PLLA 3DM5A 1XJQA 1DPFA 1ESNA 2AD1A 3K09A 1JALA 2H57A 1CJUC 5KSPA 5CITA 1DADA 1IXSB 3LXXA 4P0TA 5F2EA 2F1HA 3EIQA 4JBYA 5D3MA 3U44B 1Z6AA 2I1VB 4NCHA 2ZR7A 3T12A 2JJ1A 5JSZA 2FE4A 3I8XA 1NLFA 3LV8A 1S8FA 3KKPA 3Q8XB 4DVGA 3R9IA 3KKMA 4GBMA 5JCZA 4QJ4A 2YINC 4DHEA 5GJWC 3OAAD 3IPYA 2DWOA 2GVZC 2KBFA 2W0SA 1T0HB 2XNDD 1BO6A 1GNPA 1IXRC 2BCGY 1XP8A 5FPTA 1J8YF 4JZKA 1JR6A 2NO1A 4A2PA 4A8JC 5E4FA 4HLUA 4BFXA 2N46A 2VEDA 1N6RA 3SZRA 2OFWA 1DEKA 2QGZA 4S35A 1RJ9B 2J87A 4AIIA 1GKUB 2PLFA 2JGNA 4JLAA 4MKGA 4DDUA 1N6HA 4KO8A 1XB2A 2AN9A 2LKDA 4RD3A 5FUVA 1YR8A 3W9YA 5BN4A 5DNYB 1E99A 1NIJA 1D8TA 3THYA 1KHTA 2O0JA 3GCGA 1CR4A 2V1XA 1E9FA 3VX4A 4HUTA 5F9HA 1XJCA 1PUJA 4DIEA 1AM4D 1H8ED 2ZANA 4QBFA 1V43A 1P9NA 4PC2A 1ELOA 1TF7A 4LC0A 2W2TA 3Q5DA 1VCIA 1A5TA 5K8TA 3T34A 1P5ZB 2KI5A 2WPDA 3PVSA 4E03A 3LD9A 4MITA 1QHYA 4M1SA 3GLIE 3MWLA 2IF2A 721PA 2IA5A 1NJGA 1Q1ZA 4G5OA 3ZDQA 1CRQA 4XOIA 4CYMA 1CR2A 1H8HD 1NLYA 1TADA 4C9BA 3A6PC 1W44A 1ZNYA 4TLCA 3NBYC 5KU1A 4F91B 1G5TA 3PEUA 2OLKA 3R20A 4B34A 4LV8B 2CDNA 2ZYWX 4B2IA 4D26A 3ZVRA 3PITA 2ZUCA 3H84A 3SJAA 2C5LA 2OLJA 4LBZA 3OIWA 1PVOA 5LPNA 3SNHA 5L3SB 4HI0E 4OQFA 2XNDA 3AVTA 4EJSB 3GJ6A 1SKYE 2G6BA 3IILA 5AUOB 1QG2A 4L15A 4PSVA 3EPLA 4KAXA 2QG6A 2R8RA 3B1VA 4DEYA 1NMYA 4ARZA 4V02A 1BIFA 1P72A 3GLGE 4UNNA 2ZAMA 3TUJC 2QZ4A 4Q9IA 4JYCA 3F0TA 4IHQA 2J46A 4IEIA 5H68A 4HAWA 2BMJA 1T4GA 2IHBA 1KI7A 2QI9C 3RRNA 4IXNA 3AVPA 3REGA 2IS6A 1ZCBA 4V0NA 5CYOA 2HT1A 1RRFA 2CHVA 1P2TA 2VHQA 1KMQA 1C9KA 1Q1QA 1CJTC 1E0AA 1R5BA 4M9XA 4E07A 4EPWA 4M1YA 4Q1CA 3U44A 5KPDA 1XTIA 4G01B 2IW3A 2PH1A 4QGFA 1W36D 2VIIA 2WMOB 3P4XA 4KFRA 4HAVA 4HDOB 3ZVMA 1IJFA 4DLWA 4F7WA 4Q4HA 2ZVQX 2YKGA 2A30A 3CZQA 1OHHA 5K8IA 3W3AA 3PQCA 1EFRD 1U8YA 1E9CA 4N1AA 4DCUA 2DFNA 2YZ2A 5JS8A 3ASZA 2W6JA 5GJVC 4A92A 3AVXA 1U0JA 4I1OA 4XVUA 5KNCA 2O52A 1PLKA 1Q22A 1A7JA 4U5XA 4A8JA 1G7RA 2CLSA 3KB2A 3GPLA 3RYTC 4POAA 1UDXA 3BWDD 2Q3MA 2JLVA 4BFYA 2LCFA 3AUXA 5J4VA 1XMSA 1XEXB 3OIVA 4GMXA 1XTSA 2GETA 3KJHA 3J81k 4UNRA 1NKTA 1W48A 5EXTA 1XFAA 2ATVA 3OE7D 3CNOA 3CWQA 4D6PA 1CKEA 1YZGA 2QTVB 1BMFD 1JQLB 3GLIB 3EAQA 1HT1E 3TE6A 1RFLA 4HAXA 1EFCA 2LWIA 4JL5A 3SQXA 1XX6A 4LJ9A 1ZU5A 4FWIB 5DHAA 5JWOA 2VSFA 4CDGA 4ZO4A 4EPXA 3LXRA 3ZIAD 2YC2C 2NOAA 4F92B 1X8JA 3GJ3A 2IYQA 3LH5A 4B33A 4W5WA 2HF8A 1CR1A 2JDID 4IRUB 5B2ZA 4QFMA 2FOLA 3L2OB 3ZIAA 4PSAA 2BM1A 1KAGA 1NBMA 4OI1A 1E2DA 2ASEA 1E2EA 1F48A 1QRAA 2QQ0A 4Q4LA 1ANKA 1R10A 3QBTA 4MRSA 1W4RA 3IIJA 4PC1A 3T5GA 3U61B 1SVLA 2HUPA 1S96A 3KKNA 4Z1MD 2GZAA 1F2UB 1TAGA 2JATA 3CH5A 2C9YA 4IOMA 2VP5A 4QHYA 2CNWA 1SXJD 1G8PA 3HDTA 3B1ZA 1HT2E 2I4IA 4WXRA 1KO8A 2JJ8A 4NYIQ 4Y0VA 3I3SR 4QJ3A 5UKDA 3QENA 4CEJB 1W0KD 4JYBA 2GAAA 4YC7A 1AJEA 5ELXA 4ZIRB 3GP8A 1KJWA 2WWWA 2OBNA 3JZAA 2W2VA 2AFIE 3BERA 4TWZA 4EFNA 1W1WA 4PHGA 4B44A 1O3YA 1N5IA 1T9HA 3WYFA 1N3BA 4EQ6A 1X3SA 4KSBA 2CL7X 1L8QA 2J0VA 4UNQA 5LD2B 3EPJA 2ANCA 3L43A 2EQBA 3B7GA 3LRPA 4FMDF 2IF0A 2IYLD 1TQ6A 2J3EA 4MRPA 2D7DA 5FUXA 4B3GA 3Q85A 4I81A 1TQ4A 2OEPA 2P2LA 3C8UA 2QM8A 3E70C 4PC7A 1SXJE 1W4BA 3VR2A 2QTFA 4A0GA 3KUDA 4AURA 1Q20A 1ZM9A 2QROA 1SXJC 2OV2A 3RWMB 4AI6A 2FFBA 4D4LA 4Q7KA 4E09A 2GEDA 4ILEA 1XXHA 4NYIR 4RY2A 1VG8A 4N0DA 1JPNA 3PUVA 1NLZA 2PMKA 2CJWA 2VP0A 1GNQA 1GITA 2F3TA 5FH9A 1CJMA 2ZSAA 3X1XA 1RE0A 4C0SA 4CW7A 1G4UR 5CM9C 1KO4A 5FL7D 3SHWA 1JEEA 3L0SA 1M7GA 3DHWC 4PAQA 3GLFB 4PO9A 2PJZA 4BRUA 3X1DA 1ONBA 4PANA 1ZUNB 5L3RA 5FBLB 2O8FB 2ZJ5A 1QZXA 521PA 2AHOA 4BECA 2ZRNA 2ZU0C 4PZYA 2O8FA 5G53C 3DVLA 3EIEA 4K8OA 4V0ME 2OILA 1E9BA 3T1TA 5L3QB 4GRAA 4ZIRA 2RGDA 1QDEA 2WAXA 4OYHA 4P31A 5CK4A 4BWYA 4CIDA 1XZPA 1JI0A 1XBTA 1J8MF 5JMTA 5DE3A 4PHFA 1FX0A 1R4AA 3CRQA 3VU9B 1G1MA 1J90A 1ZNWA 2FPKA 1YR6A 5EZ6B 1RIFA 4A0FA 2PZEA 2NQ2C 2DYKA 5H8WA 4LV6A 1T91A 4LBYA 3HWSA 4PAMA 2DR3A 1ESMA 2W0MA 2ZSEA 3C4JA 1Z22A 1YRAA 1DVRA 5F9FA 3P1JA 4NCIA 2REBA 3AVOA 4Q4AA 4PSKA 3OIYA 2MSDB 4JLVA 4EAQA 5HPYB 4DCNA 4MYUA 1CBUA 1AN0A 2A5JA 4MRVA 1TQ2A 1MABA 1N2CE 5K8UA 3CPJB 3PENA 1CXZA 1Q57A 3R8CA 4A0RA 1G4AE 2XJ4A 3C7KA 1FUUA 4P32A 2QL6A 5TVKA 5LB4A 3TVDA 2QBYA 5FOUA 4US0R 3EPHA 1ZM7A 3ZH9B 3MUFA 1CIPA 2YOHA 1SKQA 3TH5A 1WQ1R 1S2MA 2VF8A 1F60A 1ZD1A 2OUKA 4ARZB 4CF7A 1G3RA 2AKYA 5AJVB 1WCV1 2OSBA 4Q9KA 1OH6A 4N0EA 1FNNA 1OFTA 4Q02A 1KI1A 3L8YA 1B23P 4TLAA 4PPGA 1D5CA 3F8TA 4AWXA 3LBIA 3T35A 3QF4B 2IXEA 3MWYW 4B74A 5FBWB 1MV5A 3FB4A 3GLGB 5L3QA 2OAQ1 2YV5A 1QHSA 3SQWA 2WM9B 5KSYA 1XCGB 5JHHB 5L8VA 2PX0A 3S1AA 5FPKA 4KFSA 3E1SA 4OHVA 2FSFA 3B1XA 5BYKA 1UKEA 1UKZA 2WV9A 3OF5A 5FTNA 1UAAA 4TT3A 3NC1C 3CO5A 4QGAA 5CIWA 1IY1A 1M7HA 1MR3F 2NO9A 5B58C 2VQSA 1G5RA 4QG7A 4IFBA 1G6HA 1C1YA 3OESA 2F43B 4BFTA 1FMJA 4MGIR 3KKOA 1DTSA 2ORVA 1NVUQ 3KXKA 4OI4A 3GMTA 1N0VC 1KDPA 4M9QA 2ZJYA 4FXPA 5FI1B 3OAAA 1M2OB 1RYFA 2ZI9A 3DL0A 2BEJA 3K0AA 4NYMQ 4S2EA 5DLQC 3UXMA 2BBSA 3BE4A 3PUYA 4LJAA 1ZC3A 4AYXA 2X2FA 5IT5A 4A1FA 2QGNA 4HDQB 1BOFA 1CS4C 2R6FA 2XJ9A 3B1YA 3U7HB 3FDIA 1FW6A 5F3WB 4G5GA 1JEDA 1ZBDA 1U94A 4XSGA 5EZ5A 2QRNA 3QBVA 2D7CA 3TUIC 3I72A 2ODNA 4IDNA 4ZV4A 4B32A 2IWHA 3FMIA 2PEZA 2XGJA 4O2RA 1E1QD 4DDWA 2PJRA 4PHHA 4I1VA 1IXZA 1YZLA 2H8KA 2YWEA 4F4CA 4BUJA 3WMEA 4X8HA 3FE2A 4LJ8A 2GK6A 1FX0B 4RSGA 3UKDA 3UG6A 2GF0A 4HUQB 1P61B 2GRJA 2I1QA 4Q48A 3TK1A 3AVWA 1N5LA 2AFHE 1GWNA 4OQMA 4B75A 1OIXA 4ASUA 3MG9A 1LTQA 4AC9A 4BLOA 1I2MA 1NY6A 3CR8A 1TX4B 4AKGA 1NMZA 1HY3A 4Q21A 5FL7A 3AVVA 2HT6A 1OLOA 1FNMA 1OT3A 1UBFA 3GJ0A 4ITRC 4RD4A 5JJLA 2GCOB 4Q7LA 3SI7A 3SJCA 1JNYA 2VP6A 1G19A 3I73A 1G291 1YZQA 4KSCA 4LWZA 2Q9BA 1FL9A 4II7A 2RAPA 4FN5A 4KHZA 3PEWA 1E98A 3FVQA 3TVTA 4W5JA 4L16A 5CLQA 2NTYC 2QMOA 4WZ6A 4MUBA 5JSZB 1G7CA 2PT7A 2V7QD 3CNNA 2OFXA 3CW2A 1Z0JA 1OXVA 2QT0A 4K81B 2WVJA 3KUCA 3FKSA 2JLWA 2CL0X 4DLZA 1W36C 4CEIB 2R6GA 4PC6A 4JT2A 4JIMA 4DXAA 3A4NA 3KDSE 2WWYA 1WF3A 1ZIOA 2BDTA 5FTKA 2EFHB 2IEZA 2ZTSA 5KO2A 5CJPA 3WY9A 3THYB 1T3SA 3TAUA 2V4ZA 4W9MC 2Q0HA 1D9XA 2YHSA 3ZVNA 1QVAA 1CLUA 4BFZA 2NGRA 5BXQC 1K8RA 4MKFA 4RZ2A 5DHFA 4HB0A 4TZ6A 2ZRCA 3HJNA 3AF2A 3GLHE 4DIDA 1N6OA 2OCYC 3CX7A 1W5SA 3AP3A 4FMBB 3TQCA 2O8BA 1QHHB 4PAOA 2RHMA 2O8CB 5JEDA 2HYDA 3K70C 3UMSA 1BYUA 2QPAA 3AGPA 2GBLC 5J40A 1A82A 2ZSDA 5J4YA 3PUWA 4EFMA 2FPMA 4RD0A 5LB2A 3PUZA 3WYGA 2ODEA 2HV8A 4JJKA 3A4MA 1KO1A 5FTLA 4CEJA 2G0NA 2D2EA 4GOXA 1GILA 4Q1FA 4A0HA 2GAOA 3TGPA 2CK3D 2ODWA 5JS7A 5TXGA 1VDZA 1FUKA 3MCAA 2AXPA 3B78A 3KQKA 2HLDA 2QE7A 4M9SA 4MYHA 1RVDA 2R2AA 4XSHA 2QMHA 4YDSA 5J4KA 1G7TA 3EX7C 1OXSC 1JAIA 2A5DA 4UJ3A 3SBEA 2R9VA 3ZYCA 1EGAA 2JLZA 1KZGB 2EYQA 1OB2A 1T5LA 3QXJA 5F98A 4MKHA 4ZCMA 1OXUA 3EXAA 4XWKA 4KJZA 1YQTA 3QPWA 1U0LA 2VO1A 1BS1A 1HUQA 1LF0A 2Q3HA 4PR0A 5HCNA 2G88A 5JFGA 221PA 3DZ8A 2BVNA 2QAGB 4LUCA 1F5NA 1GP2A 1KJZA 4BFSA 3IHWA 2WJYA 4LHWA 4MQBA 1KGDA 2IL1A 4QHTA 4XVQA 1IN8A 4RVCA 3VKGA 1GFIA 3L0PA 1YJ5A 4XVRA 4ON9A 2Z0MA 1U2RA 2CCJA 1ZYUA 2E1RA 3LO5A 4LHZA 1CU1A 1KZ7B 2AWNA 3CBQA 4GZLA 1TEVA 1QBKC 5DI3B 3ZD7A 1JBKA 3W6PA 2Z83A 4DT1B 3KTAA 1T6NA 4IDOA 3ZZTA 2AD5A 1MRSA 2FNAA 4JLOA 4QM7A 4Q01A 3T15A 2F55A 2JEOA 4PC3A 1E9DA 1COWD 2B92A 2D4HA 2ZS9A 3BB1A 4QNRA 3TBKA 4BGDA 2XAUA 3EPKA 2J7PA 3SYKA 1VCNA 2G9NA 2GJSA 4LYAA 3X1ZA 1RC8A 3G82C 5CIQA 2QP9X 3D3QA 4G1UC 1JQJC 1SXJA 1KI2A 3VR1A 4GSYA 1A2BA 1WA5A 1QHNA 4EKDA 2Z4RA 4B3DA 3ZJYA 2CVFA 1OJLA 1U8AA 1VECA 3E2IA 1HH4A 3RAPR 3UPUA 3K70B 3WHKA 1S3SA 2V8OA 1XXHE 5DN6D 3W6NA 1SVOA 2WMNB 4Z51A 1Z2CA 1U8ZA 2QPOA 3L8ZA 1NN0A 4M1TA 3SOPA 4AKHA 3NH6A 2Q9AA 2ZAOA 2ZR9A 5HCIA 5JEEA 1E2HA 1LV7A 4MRNA 3FFAA 3TLXA 1DO0A 3ZS9A 2A7QA 1E2MA 1ODFA 4NYJQ 5DGXA 2HJVA 3W5JA 1OSNA 4TN1A 1IN7A 4Q03A 1N0UA 1T8TA 2ZRGA 4PQFA 1E4VA 4Q47A 5SZIA 1U9IC 1NMXA 2QAGC 4AKIA 2VHJA 4KYUA 4CGZA 4NH0A 3ICQB 2ZS8A 1GRRA 2AWOA 4V0MA 2ZXUA 3AKEA 1SVSA 1OYWA 3IQWA 3WRXC 2JA1A 1AA9A 3RS5A 3VX3A 3RHFA 1IHUA 1RKBA 5AWFC 4RKEA 1YR9A 4L9SA 3I8SA 1GRQA 1HV8A 4URUR 3U7EB 1J7KA 4AG6A 1ZC4A 3X1YA 2G3YA 2GNOA 2QSYA 1GAJA 1KJYA 2JLRA 2XSZD 2HJGA 3AF1A 3QXXA 2F6RA 3GD7A 4LCBA 2BMFA 4C0HA 2RH5A 2Z43A 4MA4A 2E9SA 3T5DA 1SVWA 3I32A 4LOAA 3K1JA 1W47A 4QL3A 4RZXA 3NBFA 1W7AA 2IUSA 4U00A 4A6PA 4B2PA 4URYR 1PLJA 2IWRA 4J0QA 2GF9A 4L8GA 4FMCB 1NRJB 1Z3IX 3FMOB 3QOFA 1K5DA 1G20E 1XMIA 2YYZA 4O0MA 3L0IB 2EYUA 2B7CA 3A1VA 5HE8A 4RD1A 4C7OA 2VTKA 2FU5C 4TYPA 1UDWA 2EU8A 1KNXA 2UVQA 5ANRB 5EP4A 3FWYA 1YZUA 2KE5A 5G3ZA 4BLRA 3QKTA 2RGEA 4PTLA 1GZSA 4JLPA 3AF0A 3FHOA 3IIMA 2XTNA 1AK2A 2GXQA 4QBHA 4TL6A 3SS8A 3K09C 3G0HA 1EX6A 1E1RA 2G83A 4PPFA 4FCTA 3U3JA 1JJ7A 4EPYA 2B8WA 5TARA 4GDFA 1RRCA 1DAGA 2NO0A 3GEHA 1DG1G 4X8LA 4BE7B 4OI0A 4FIDA 1XPOA 3B8HA 5EJEA 5HKKA 2R6DA 4TMKA 4M0LA 4Q4AB 3D6TB 3WNDA 1J99A 2OHFA 2HLDD 2QE7D 3VTKA 1RRGA 3W90A 3BS4A 2GXUA 3BFVA 1TUIA 1R7RA 4TL9A 2FN4A 2PCLA 2WOOA 2C9CA 3CWZA 4MH0R 3LNCA 2J45A 3SJBA 2F43A 4IJMA 3B6EA 1ZIPA 3C15C 3CPEA 3VHLB 1S0UA 3VU9A 1ZM4A 4LX0A 1Q44A 2ZE5A 2YWFA 2ZR0A 2FSGA 4FMCF 3SN6A 1W5TA 2DCUA 3O47A 1AS3A 4LRWA 4CVNA 5G41A 4P4SA 4V03A 5LBIA 4BEBA 1DO2A 4HB4A 4UKDA 1XEWY 4DEXA 2BM0A 3VNVA 4JVLA 4NONA 3DKPA 2R6CA 4OQNA 3KZ1E 1E2NA 2J5XA 1IAQA 1VIYA 2ATXA 5EUQB 4LY6A 4BFWA 3KL4A 4BASA 2O8BB 2W83A 3I5XA 1R5OA 3QVVA 2XNSA 1Z28A 1DAIA 1RRPA 3GLFA 2DWPA 4R7ZA 3AKYA 1NP6A 3QI2A 2FFQA 1OIVA 3OFNA 3R8FA 1VMAA 3QG5A 1GUAA 2WTUA 4TSFA 3RLFA 1WDTA 1NSTA 2YC4C 1SQ5A 4O25A 4M53A 4Q1DA 3U2QA 1F2TA 3LQRA 4YQFA 2IX3A 4A2WA 4JKYA 3REFA 1KI6A 1AZTA 1R6BX 2JIZA 2WWHA 4D82A 3WP0A 2V6JA 5LDDC 2H18A 3RS4A 4UXIA 2NO6A 2J0SA 3DO6A 3VNUA 2V1UA 2IXGA 1U99A 4TL8A 5FUWA 3H1TA 4K46A 3CH4B 3PCRB 3I92A 4UXHA 4G5SA 1ZMXA 3U3RA 3BBPA 2EWWA 2C8VA 3ICEA 4CEHA 3NBXX 2JASA 3DDCA 1MT0A 1XCPA 1KSHA 4Q9LA 1E94E 2CBZA 4RFVA 4QBGB 1DBSA 5KNDA 3VKWA 5FR1A 1OV4A 4V0OA 5KYKA 4OKSA 4LYJA 1YZTA 1JECA 3GJ8A 2VL7A 4QNMA 4ZDJA 3M0EA 2WWGA 4Q4JB 3BIFA 1EXMA 3RRYA 1AIPA 3UANA 1E1QA 1LY1A 2HCJB 2O0KA 3RC3A 1E4YA 1Z0DA 4OHWA 1I4LD 1S3GA 3OEHA 3OEEA 5FPHA 1CF4A 1VG1A 4KBFA 4EPVA 5DSZA 4I4LA 3KQHA 2BOVA 2ZRMA 1II8B 3T06B 1F2UA 3C5HA 4NZYA 1HURA 1NI3A 5KSOA 1Q21A 3KJEA 1ZINA 4QGGA 4UNSA 2XSZA 4M1KA 1C4OA 2OCPA 4OK6A 2ODBA 3GFTA 3QNUA 1E0JA 2ZIAA 3BK7A 4RCZA 3U6BA 1KTVA 3AGQA 5EE3A 3K8YA 5EE9A 1E2IA 3X2SA 3O8BA 4NDZA 2E87A 4I1SA 1W4AA 4B71A 4BZXA 2O0HA 1MO4A 5BN5A 1US8A 2GA8A 1S1CA 1E2PA 1TF2A 2QA5A 1VPLA 1DG3A 3WMFA 3P32A 1G6OA 4WZBE 5KNBA 3GFPA 3K9LA 3IQXA 1FFHA 3PV0A 3MJRA 2A9KA 4QOSA 3SJZA 2EFCB 2H16A 2IYVA 2R65A 4KODA 4YMWA 1AZSC 1T3HA 1OFIA 2A5FA 3FGNA 4M8NE 4Q1BA 3W3ZB 2JJ2D 2OXCA 4IOKA 2KJQA 2WIBA 4BLQA 2CL6X 5FOSA 2GZDA 4DKXA 1WP9A 4L5BA 1UEJA 4HAYA 1KKLA 1OYYA 3GJ7A 2IS4A 1E69A 3C14C 2H92A 2FA9A 3GLIA 4JKIA 3B60A 4Q18A 3M6AA 5SZJA 2Q3FA 1DAEA 3ZVLA 2FZ4A 5KTYA 4URZR 4IVRA 3RANA 421PA 2AXNA 4B3CA 3EZ7A 2A5YB 1P2SA 5J4HA 3B1WA 1N0WA 121PA 3QEJA 5HZKA 1JB1A 4OHXA 4CRWB 4KITB 4CEHB 1BYIA 2PMDA 3CF2A 1VYUA 3C5CA 2V6IA 5AR1A 3RS0A 3V00A 3K0CC 4R9UC 3EC2A 4B76A 2J7PD 1WBBA 1FTNA 2ZJAA 3THXA 2WJIA 2NIPA 2GDJA 2FJUA 2ZRAA 3BFKA 1MO3A 2NPIA 5DYGA 4KVGA 1QHHA 2HYIC 1S4QA 1JXOA 4KI0A 1TL7C 3WRYC 1NJFA 3TSZA 3U7FB 3EARA 2QAGA 4DSOA 1YU9A 4IFEA 1WRBA 3PR1A 3CKLA 3TQFA 3LX8A 2DPXA 4O2LA 2VHCA 2ZJOA 1IN5A 2ZE8A 1GIAA 2OO7A 2PZGA 2D74A 2X77A 2QP3A 2ZRKA 4AYTA 3V4RA 4JT4A 3K9HA 2OG2A 1KYIA 1Q3TA 3KFVA 3BC1A 3Q7QA 3RS7A 2L0XA 3ADDA 2A78A 1QG4A 3KXIA 5HE9A 4C0LA 4C0AC 4YXWD 1JXMA 1E79D 4GL2A 2ZEJA 3LY5A 3NC0C 1E3MA 4B3FX 2HDNB 2YOFA 4QXAA 2Z6VA 2H1LA 1CTQA 2W58A 4EIWA 4UNPA 2ECKA 2BKUA 3N2IA 1G3QA 3I5YA 3N5CA 4LHYA 3LBNA 1IN4A 4HLQB 4DB2A 2ZRJA 4G3XA 4JL8A 2GK7A 5AK0A 3ADBA 4DT1A 1LW7A 3PG5A 2QMEA 1E9SA 1SHKA 1R0WA 1ZU4A 4AG5A 5KPJA 2IEYA 4PPNA 3TUZC 1W4CA 1RPZA 1EFUA 3W34A 3QG1A 4FI3C 4QJ5A 1TF5A 5KSZA 1KI8A 3BH0A 1O87A 1GTVA 3RVBA 3UK6A 2Z4SA 3VAAA 1MRNA 1N25A 4V0LA 4H1VA 2ZS7A 1G41A 1UBGA 3BGWA 1FOEB 1U0HC 2CNWD 3RRMA 3VMFA 5AUNB 5EXXA 1OH5A 2PL3A 2YJTD 3LFUA 4KXFB 4AKEA 1R0XA 2WZQA 1LS6A 2OFOA 3QF7A 5E95A 2WWIA 4D81A 4BLSA 3WBKA 3E5HA 3JVUA 5KHOC 4WZAE 2B8TA 1JR3D 4TQAA 3CRVA 2IYRA 4LGMA 4ZI3A 2BKEA 4DCTA 5KDLA 2H17A 1NG9A 5IHPA 4BLTA 1R8SA 1MO5A 4HSEA 1W36B 4Q19A 3LWNA 4MGZR 3OHMA 3GJ5A 4A82A 3RWOA 4ACAA 3ZQ6A 3NEYA 5H1YA 3IO5A 5H70A 4DCVA 4WVFA 4C30A 5KOYA 3DOFA 1BMFA 1ZAKA 1FP7A 4WAUA 1DE0A 3HPQA 1GSIA 4LYHA 5EE0A 5BYJA 3KQNA 1T5IA 2CCKA 4PZZA 3OE7A 3LDAA 5CLLA 5FBRB 4CT4B 1ZM3A 2O8EA 3VR4A 2XZOA 1E96A 1H8HA 3QXHA 5CJ2A 5CB8A 1XTQA 2WSSA 2WKRA 3L0OA 4UXJA 4OHZA 2ZVPX 4LSGA 5JWHA 1ZM2A 3K0FB 2GWHA 3GLHB 3DKVA 1T3LA 3TW8B 4ZDKA 4C0QC 2O8DA 4BZPA 1XWIA 2CE7A 2ZI6A 2VSXA 3TNFA 1NN3A 3EWAA 1AKYA 1HA3A 1XD8A 4E22A 4KU4A 5KDOA 1OXTA 2OT3B 3PUXA 1BH2A 2IK8A 4ASUD 3AVUA 4YXWA 3P4YA 2P65A 1UPTA 2FWRA 1G3IA 3LW7A 5AUQA 4BLPA 4A4DA 1G9XA 3THOA 1E9AA 4ABYA 2F9LA 2FPLA 1M74A 4TYNA 1XTRA 3DOEA 3VHXA 1W2HA 3DMNA 3SE0A 5C1BA 5JJKA 1IM2A 3MRSA 3CIOA 5HZHA 3NDBB 2G0TA 2J59A 1ZRHA 1VG9B 2OCAA 1GL6A 2PEYA 2VLIA 4LV5B 2FEMA 4ERNA 4R2IA 2BJWA 2JLXA 2IHYA 1NVWQ 3U5ZB 3B82A 1EFRA 1UEIA 1VKJA 1WXQA 1D2MA 1SGWA 1KK2A 1YZNA 3CLVA 3NXSA 4JBWA 2A5GA 4KYIB 1QHGA 2VYFA 4LPKA 4XTRA 3I4LA 1HEIA 3A8TA 2RGGA 4HLDA 1V5WA 4B6EA 2OBMA 4DBLC 2WSMA 4ZCIA 3KQLA 3ONWA 4NHOA 1E32A 1P7CA 1M1YE 4X8OA 2J0QA 4Q5IA 4LZZA 3AH8A 1AKEA 1S1MA 1W0JD 2N1BA 4R71A 2Z5FA 1T8UA 1VYVA 3IHLA 2PT5A 3QKSB 5C4MA 2GJAA 1N6IA 3ETLA
chains in the Genus database with same CATH superfamily
4NZMA 4PZLA 2VPWA 3D8BA 3HYRA 4EITA 5HOEA 4IRXA 3MBKA 4ZMSA 1XG5A 1IONA 4B2LA 2DFLA 3UK1A 2O59A 1P1JA 5IVPA 3JASB 1M8GA 4KACA 1E2GA 1SXJB 4UMFA 3UZUA 1QF9A 4UUNA 3NXKA 3PF8A 2Z8YM 4QTXA 1KJJA 2X0RA 3ZY2A 1PS0A 4ZAWA 5ERXA 1EXNA 1NBWB 1PG2A 3AR2A 4GDMA 3WLRA 1OX4B 3W8RA 4I2VA 2D3WA 4LE2A 4UAUA 2WIAA 4MDFA 3S2EA 1WABA 3DXFA 3T3IA 2HV9A 2BKAA 2QQEA 5DX1A 5EPOA 5JRJA 1JU4A 4ATNA 4HWOA 4RVFA 2OXRA 5K3OA 5DGDA 3H1BA 4RJIA 3MRVA 4BNTA 2B6HA 3FMFA 3NANA 4R8RA 1EGVB 2WE7A 2VA8A 5LCXA 3V4PB 5G1NA 2G4VA 2PGIA 2GXAA 2ZSIA 4QTUB 1KORA 3RTDA 1FYWA 1HQKA 1KK0A 5B36A 1U7HA 2EC5A 1CHDA 2PSHA 4FYKA 4LBVA 3U4GA 2BBWA 3GELA 4YRSA 4GBJA 2Q29A 1PU2A 1I2ZA 2P62A 2VC2B 1GADO 3L7DA 3ETHA 4KFTA 5A7HA 2VPPA 2Q5IA 2G9VA 2OM6A 2PX4A 3AFMA 4HYEA 4RVDA 4TLEA 4ZKEA 3WLSA 5CDFE 3PR3A 4NNPA 5K9ZA 2DWQA 5CVTA 1A8QA 4O02B 2X0FA 2YFKA 3AM5A 5HDBB 4JELA 3WI7A 3HRHA 1EJBA 1GVHA 4JLBA 4CLEA 3BTUA 2W6ID 4DMFA 2C4VA 2O07A 1VHTA 1S7GA 3A36A 3K1AA 3M1YA 3M4YA 1PFKA 4QDUA 1L7VC 4O4LA 1P29A 4DLNA 3LVFO 4WBNF 2XF2A 1CQPA 2XMGA 4QHSA 2VQDA 1EQ2A 4YCAA 3IE0A 3L0CA 4EO7A 4QGHA 5KDDA 4G0OA 4TMZA 2FX3A 3QQ5A 2H4ZA 2W6IA 3OVMA 2W37A 1KGSA 3Q7PA 1UJ2A 4C22A 4L9RA 5SZKB 2HSDA 2HX1A 4HDKB 3VO1A 2QSZA 4X8MA 4X91A 1ZI6A 4Y2VA 3IUMA 2AQIA 4P58A 1GQYA 2PVCA 5AKLA 3HU1A 4QOFA 4AYWA 3DTVA 2BEKA 1CDDA 3ZGLA 2BBOA 4DILA 5T7BA 4I50B 2CZGA 2WWXA 3ICCA 2VF7A 2YICA 1DGQA 1GKIA 4FCWA 2ZUTA 3ZD9A 1WZUA 1M8FA 4Z9FA 3ND6A 2CLCX 5JHGB 5EFOA 2B21A 1ZITA 2UYOA 3O1IC 4YEDA 3LBHA 3IKLA 1NF2A 2F1RA 2IYAA 3A3NA 3QX8A 4OOEA 5EE5B 2Y0EA 2P5TB 1NLUA 1W0JA 1NVEA 2C96A 2CUTA 2HFJA 1QZUA 2WTAA 5CA0B 2GFQA 4P83A 2J0UA 1H2HA 3K9GA 3NDJA 4WXMA 2V6GA 3RKUA 3EPRA 4UUPA 3OUZA 1M7BA 1AGPA 3O2JA 2C8JA 4KQEA 4R3NA 3WWOA 4AU1A 2WPDD 2VPXA 2ROQA 3HNPA 4ZCQA 4DCPA 4EG8A 1OH8A 1CB7A 1VCMA 1D2HA 4UBOA 3UV3A 3VNAA 4RD6A 5FI0B 5C4GB 4DIOA 2IHZA 2NTVA 2V98A 3HUUA 4PYMA 3IT2A 3CXUA 3OPVA 4XIGS 3OIDA 1JHPA 1MAUA 1Q1EA 2OHIA 2UAGA 2JFFA 5F64A 1NAHA 4TSRA 1KKMA 4CLXA 5BN5B 3USES 4TXNA 2DLCX 1QRDA 1E2KA 4AS3A 1UDBA 1ZNZA 3I2KA 1BRMA 1G59A 2B98A 2YN4A 1OW3B 4PNZA 4AZ3B 2VDUE 1V6CA 3UHOA 1HI9A 1MH1A 2YYAA 1MW9X 5CYFA 5J2TF 1U6KA 3WGGA 2A94A 3STUA 3AL2A 1UJ6A 3OCWA 4QM6A 1Z06A 4V1CA 2GD0A 4ZO8A 2GTPA 3KQUA 1JTEA 4QYWA 1IPEA 1IUNA 3IQIX 4K3UA 3SJ7A 3BXOA 1AVTA 4HQ0A 2IXDA 1D6NA 2ZRFA 4K88A 4B73A 1CJVC 2GILA 5IVDA 2WG1A 4YYEA 4UBMA 3P26A 3RFTA 4WW0A 1X7GA 2H3EA 1PJCA 4EECA 3FYUC 3IUSA 1K6MA 2QRLA 3QLJA 4QQFA 3ZNPA 2EFDB 3K05A 4KKXB 1YKSA 3T7EA 3ZTWA 4ZN6A 4JQZA 4OJKA 1TK9A 1MENA 3D4BA 3VPHA 4B9AA 1QRRA 1AB6A 1YIDA 2DTEA 2A84A 2XGSA 4LOHA 5EJMA 2WOJA 3KV1A 1O58A 3HSYA 3OX4A 1RR6A 1EVIA 1XUOA 4O1IA 5EPEA 1ZX1A 4A8JB 1UL1X 3QKRA 4XWYA 1SHZA 2GN6A 5GTDA 3V1YA 2FGJA 1KY5A 2BFFA 3OT4A 4WD3A 1RADA 3R7WA 4EABA 1SXIA 4YDQA 3IBYA 3LTNC 3PJEA 1GDDA 3CX4A 3RG2A 1LWNA 2ZSFA 1G21B 3HDVA 4G8CA 2EDAA 4L4SA 4EFLA 3L1KA 1Z68A 4P33A 3MHTA 2VEOA 2GHRA 3D02A 3VR6D 5EIXA 4LK2A 5IPFA 1OILA 3Q72A 1W0KA 3U40A 4HWTA 2WM3A 4K9PA 2F67A 2NUPB 1MX1A 3G2IA 3WVNA 3LW8A 5CFPA 1JFTA 2AZ4A 1N2JA 1Q5PA 1QAQA 4LRUA 3MWDA 1J0EA 4NVRA 4F3TA 5FPYA 4PFQA 1AGRA 3V3TA 1JFFA 2HA3A 3VTFA 3L9WA 4UARA 4L9AA 4G4JA 2WZBA 3IIKA 1W4LA 1ZGZA 4D0NA 2NO4A 2LPMA 4YRQA 5AJUA 3QE9Y 1E5TA 1XCJA 1N9GA 2RHGB 1YRWA 3MMPA 3VSBA 3QYPA 3SC4A 4BKRA 3BD9A 4LFAB 1M2GA 2JIBA 1U7DA 4HH1A 5JZVA 2JLYA 1Y82A 4XGQA 3BL8A 2L17A 4JBXA 1KAHA 1M8KA 3KPYA 4X20A 5REQB 4EYGA 3THWA 2ZIVB 3QJGA 3DZIA 3QWHA 5CD1A 3KBOA 1EK6A 1SCUB 3SZOA 2FRDC 2ZYSA 2ZDQA 3N2EA 4M1EA 4PO1A 1N32B 4QYMA 2DF8A 1RJ9A 3EISA 2BGGA 2YFQA 4KLZA 4LJ7A 5A4FS 1MQAA 4C4RA 3THXB 3INGA 2G25A 4NK4A 1NVVR 1WUYA 4BZQA 1I2AA 1XQWA 1J7JA 1PYGA 4DR1B 1HX7A 2A0UA 3I9V6 5KSWB 2FSUA 1WPQA 1XD2A 4BJ3A 5HBRA 3DTTA 2ZYRA 3MD0A 5DIFA 4M86A 1RXCA 4TTVA 1UFKA 1SQFA 1YI8A 2BI8A 3GUHA 1R9NA 5JYCA 3URKA 1A9SA 3S28A 4DPMA 1P2GA 4F46A 2ERYA 1ENOA 3DD1A 5IABA 1T8YA 2B61A 3IUYA 4HGRA 5F52A 2J48A 1FFXB 3F47A 1FFAA 1H0KA 1C0EA 4JFAA 3MTQA 1KR5A 2HJRA 3MPOA 2C5EA 3EUAA 1VJGA 3AKCA 3K5IA 1XO1A 4Z7QB 4F4DA 2WD8A 2P27A 4PQRA 2GZRA 4MCHA 1DXYA 4R0MA 4HWSA 1VP9A 1E4OA 1XN1A 4I1YA 5JI3E 1NE2A 3H7AA 2FB9A 4US1R 3SR0A 1HMYA 2WINI 2DBZA 1LFDB 3NAQA 3WE7A 4AW9A 3HJBA 1EBFA 2IEDA 4IINA 1JUDA 4TKZA 4DLVA 4OXIA 5L9AA 3EZ9A 3HTXA 1SXPA 1N1GA 3QITA 1PWHA 1UBEA 4NOKA 3LT1A 1GNRA 3WYEA 2OENG 3NTRA 3PHBE 1MORA 3SDZA 4CNQA 1A5AB 2BHRA 3RHTA 2NUTB 4RDCA 3R74A 4ZMRA 3TD9A 3BMOB 3QA9A 2XVXA 1WY5A 3INRA 3J80A 4LVOA 2HH9A 2WUVA 1GKYA 4XCXA 3U7QA 2REXB 4TTTS 3A2NA 2CLIB 4TKMA 5CX1B 4Q9HA 2GYUA 1A72A 1HLGA 2HA0A 4H77A 3ORFA 4K2HA 2BN4A 5DYTA 3RSQA 3B52X 4OBWA 4Y2XA 4CIWA 1EP1B 1B0UA 5DN6A 4B4VA 3NHAA 2BF7A 4HLCA 5E7MA 2Q4TA 3MGAA 4NZNA 4GLJA 4U7DA 1N1MA 4K05A 4B3IA 3JATA 4AJKA 1PK8A 1UJ5A 1G8MA 1G66A 5BR1A 4QEDA 3RRBA 3OEHD 3VVBA 1SKUA 2VYNA 3AB7A 4IDBA 1KWKA 3AVQA 4URFA 2V3VA 5HTKA 1VRVA 7GPBA 5D51S 1Y6ZA 2C03A 3A9TA 1JKJB 1WMSA 2EW1A 1OC2A 4HZIA 5DNYB 3VNRA 2C7OA 1QIDA 1D0SA 1A2OA 3UGJA 3R0QA 4PAWA 1FF9A 1WUHS 2W2XA 1SC9A 1VJ0A 2GJ9A 2QTBA 2VN8A 3K5WA 3NKVA 4P82A 3E6AA 5CT9A 4IX1A 1UKVY 3BE8A 5ESWA 3Q8LA 3TAHA 1PYOA 1TVKB 4YMSA 4RAOA 2WHXA 5B57C 4NK5A 1L3CA 2QI9F 4IRMA 1KAOA 3WTBA 1TU3A 1I2DA 1RKXA 3WL7A 2RBEA 4ZQCB 3VSEA 4QG3A 1C7QA 4FW9A 3E18A 2JNWA 4JD5A 5KTNA 2C04A 4LEIA 1F1BA 1DDGA 3TOZA 1HYHA 2Y76A 2CEKA 3TEMA 5JNUA 4UUMA 2Y67A 2IGTA 2GESA 4DDVA 3OQ1A 1ILEA 5DYWA 1N2CA 5C2JB 1YU6A 4YCBA 5AM0A 1KZHA 3RFCA 2Q7DA 2HPZA 3BRWA 1JKIA 3QLUA 4NDAA 3TSOA 1C3OA 4B6QA 1PDWA 3U4HA 1SUBA 2ZPTX 3D7KA 5A3JA 4ZYXA 4UTXA 1M1YA 4BMSA 4G86A 3R41A 2XITA 4MCJA 1IQPA 5A0FA 3WLNA 2CVHA 3NTVA 3P9KA 4QNNA 3M3DA 4JL6A 2ZSHA 1UKYA 1Q19A 2A2ZA 3BYZA 3FDFA 3NHZA 1SXHA 1PNTA 2O1SA 2YV3A 4LYFA 1LS1A 5FJJA 3WMGA 3ZR4B 1C8BA 5AW5A 1PGPA 4ZGGA 3BB3A 2HXYA 1DJOA 4HH0A 4A27A 3A37A 1JR3E 3DAOA 3B3FA 3ZX4A 2ZQ5A 3W5DA 2H31A 2X2OA 1KHHA 1KJIA 1T5BA 4RMGA 2D3TA 4PBSA 2BZ1A 3KKKA 3LLMA 1PX0A 3OZXA 1O57A 3K53A 2H8GA 2Q45A 3WWYA 2DP4E 3FCUB 4PS1A 5K3BA 4BQSA 3OEED 5F7JA 3QU2A 2W2LD 2WHQA 3BOSA 4EG1A 1WXHA 3OX2A 5A2GA 4WL0A 4BU0A 4GM4A 2ZREA 2XMDA 4RKFA 4XTCS 2Q07A 2IE0A 2IPOA 3D3EA 3EFBA 1E2UA 1EVLA 5DI9A 1OI4A 4ZD6A 3NHMA 3ZCQA 1S2GA 4F4JA 5TB5A 3AQ4A 3ZE9A 4W7SA 2CFIA 4KE7A 4INPA 3QV2A 4EMTA 3WFZA 1UPAA 2AJBA 4J29A 3W3AD 3KAJA 3DAGA 4O4IA 1XD2B 1K2VN 3QK7A 3VR5H 4DV3B 2ZI4A 4LHVA 1IDOA 3KWJA 1C1XA 5DJ5A 4C7JA 2ADOA 3WDSA 5ALZA 4I9HA 3OLXA 5IS2A 1RM4A 1KH1A 1ZL0A 3AR5A 1Z2AA 3HABA 1J06A 2BFCB 2JLQA 2KPOA 3KKLA 3L8DA 3KV3O 1YASA 1Z0UA 2MSCB 1FNCA 3EGDB 2V7UA 3GB9A 2HIAA 2VUHB 3BDVA 3HU3A 3O21A 4XM1A 4ZU3A 3RREA 3FUCA 5EIAA 1EFTA 3VRHA 1TEHA 1EFHA 3MSXA 4OAOA 1IZYA 2F1IA 1M34A 2Y27A 4WECA 4DYDA 1XAIA 2W8ZA 3HE3A 3ROXA 1CVRA 1LNQA 2GEUA 2R7AA 3NM6B 3RTAA 3SR3A 5LOVA 1AMUA 1U9YA 1EE1A 3IV9A 3R7DA 4EUNA 1V6SA 3UUGA 3T5AA 2R6AA 1EHYA 4FWTA 1E7SA 3E4DA 4PLFA 1UAYA 4IVQA 1OREA 5D3QA 2JIQA 3G0BA 3WR5A 4CG2A 5ICSA 1KYXA 2D06A 2A9PA 2IJGX 2HJWA 4LXGA 1SUSA 1IOZA 1QRTA 3PWZA 1XNQB 1GPJA 3WA7A 4BJ6A 4MQUA 3O8OA 1YJBA 2XNKA 4OYLA 4S1WA 4W1SA 2YRXA 1V8FA 4XGNA 3UK2A 4DWWA 5BVHB 3GLQA 4HDRB 3VH3A 3H2GA 1V1RB 5AW2A 4TYWA 4KH0A 2DH6A 2E4AA 1SIUA 1DIGA 2I55A 2Q1YA 3OFND 5AHWA 4ANFA 4EKNB 1R8XA 1HEYA 2ON6A 5H4GA 1D0IA 1II8A 5EKDA 3KHUA 3BJMA 3CKMA 4ZVLA 1YR7A 1U90A 3PPXA 2D5LA 3O5AA 4WZAA 5DH9A 5G0WA 3AY6A 4C76A 3PUHA 1KA9H 1ONNA 4IDFA 1FBNA 3FKSD 2WHEA 1KU0A 2HUNA 3LP6A 5C5IA 1L4FA 1L7PA 3KXLA 5A71A 1TFUA 2AG6A 4QOHA 4Y9DA 1XTTA 3ESDA 4EB6B 5LQAA 1DLJA 2L42A 3NRBA 2P5SA 2ZRIA 1CRZA 3FBWA 2Y66A 3NAGA 1QVRA 2QX7A 2FF7A 2GN1A 4ZOLB 1FZTA 3DBOB 1GQOA 1RXIA 4TUYF 1YRQA 3TN7A 5DWDA 1Z7YA 5A62A 1OE0A 2R8PA 4M9ZA 5TF0A 2WYVA 4GZMA 4XW2A 5CCEA 3JWHA 3ADKA 4LDRA 1EHIA 1H23A 4C01A 2PZLA 2YHAA 3E2PA 3WNCA 2VQ3A 2IHNA 2JGIA 1BEEA 4X7PA 3WYAA 3QOYA 4A36A 5JT1A 1MG5A 1IMOA 3LYHA 4ZVVA 4D2IA 2D1YA 4ZDIA 5KYNA 2P7HA 4D02A 1DEAA 3TLMA 4NKRA 1ZESA 2JJ1D 1LBHA 2PX2A 2ZRPA 4WIAA 3SLKA 3WGJA 3IP9A 1DBVO 1XAJA 4Y2GA 5EHZA 2Y9MB 4LQLA 4TZ0A 5EZYA 3FCYA 3HEMA 4PLWA 5KI6A 4QGSA 1L2TA 4Z4FA 1BH6A 3L1UA 4PQYA 1XMJA 1MV8A 3ODPA 5HP4A 3GJRA 4H1UA 4WOPA 4RD2A 3EZFA 2QRHA 4JT8A 1Y34E 1V3VA 3AU8A 1EA5A 1JDNA 1WHTA 3FCSB 4X1YA 1L7RA 5BWLA 3HYCA 3H3JA 4GXTA 3JAKA 1OLSB 3ZH2A 1DOHA 4QPNA 3RC2A 4B6SA 1F20A 1P9RA 2NO5A 3QLTA 5E9AA 4DCOA 4RA9A 4DSNA 3BE6A 3TEJA 3EG9A 3M6WA 2ZVDA 4TTSA 2F48A 5LMZA 2YMLA 3H05A 1BN7A 3EDQA 4OGLA 1PFUA 1U1GA 1MKYA 3U7RA 4IVPA 4GOOD 3NJ8A 1NY5A 4BMNA 3DHNA 1XQ1A 4GLLA 1UUFA 1XKQA 1ZK2A 3AW8A 4M4SA 4MGEA 4QBIA 1UWKA 3ULKA 1EBBA 5DWQA 3D5TA 3FLAA 4IIDA 4PFSA 2IITA 2NQ8A 4A2QA 4D0LB 1HRDA 4ZCLA 4AAYA 1Y1QA 3T3DA 4Z1OA 4ZK2A 3IT3A 4M22A 1T9KA 2I80A 3IPXA 4LJ4A 5DISB 1W88A 1TYDE 2MINA 2WP0A 4JR2A 4UCQA 2V3CC 1DARA 1PT8A 1ZNXA 2P6OA 4RA6B 4C2AA 1G64A 1UPUA 1WHSA 1PAUA 2C54A 2OAEA 3O1HB 4OI2A 4E6EA 2I8AA 2P3SA 2QP4A 3K1YA 1OA1A 4YGYA 3HP1A 5GVRA 1XZMA 3OJLA 3EDMA 4FR2A 1RLOA 1K06A 4C7XA 5J2TA 3ABQB 2I8LA 3N5KA 4UAGA 3BB4A 3RDPA 2A1UB 2ZB2A 3D54D 4EBBA 4WLUA 2J30A 3RU7A 4D56A 4CIBA 5K4HA 2C98A 1QE5A 3TD2A 1R3UA 1W5EA 2JD1A 1J22A 3JZMA 2VK4A 4JMPA 1EUDA 5CM2Z 2WV7A 2Q2VA 4YREA 5A3RA 2DFKB 1KE2A 4P1ZA 3CF0A 5EQJB 5H4HA 1JPVA 3UUFA 2Q28A 3AFIA 2ID4A 1GT6A 3IA7A 3GDWA 2I3ZA 3MS7A 5DM70 3ZEAA 2YWHA 4BC1A 3FD8A 4UCWA 5DMXA 5I9SA 3X1WA 4DZZA 3O8DA 1IBMB 1F3OA 2X9VA 1DAHA 3CUEF 1V4NA 3RIEA 3BAFA 3FNFA 4J9UE 4N7BA 4MVJH 3IE1A 1NL3A 1M8PA 3QW2A 4X00A 3U17A 3ZJ4A 2Q4EA 3LBYA 3COJA 3HPRA 1PEAA 3CRZA 3G5UA 2J9RA 1WB9A 2FEOA 4RNDB 4GYKA 4AO7A 1B41A 1Y1LA 3MAAC 3TGWA 1K0UA 1GNSA 1SUDA 1LLCA 4HZUB 3WKBA 3M4NA 1N7JA 2B0CA 3U4QB 1KMIY 4MB6A 3DMTA 2N42A 4M1MA 3AJRA 4LBWA 5AJWA 3D8RA 1ONOA 5FR2A 1RWNA 5TS3A 3DW3X 1CQJA 4NU8X 1PQPA 5CDTA 1K9VF 3FRJA 3N1UA 3DAHA 2KB0A 1IIRA 1N2OA 3U7JA 1M6NA 4OHFA 1GA4A 4RPJA 1JLLB 2EBUA 3NU1A 2FZEA 4TV9F 5BN4B 2C7RA 1Q11A 2WAAA 1PP4A 2XCOA 4MI9A 4U0KA 2Q49A 2YUTA 1U1EA 4MTLA 4F60A 2IYUA 2ERXA 2ZTVA 2VUUA 2XEXA 3CM0A 3DBHA 2MDTA 4IOLA 4RFLA 3RK0A 4EH1A 3S81A 2K7FA 3O73A 1KEPA 3EYAA 1O94C 1ZD9A 5FI5A 1YFJA 4JJ8A 2XY4A 3HKCA 4A5SA 5FDFA 5FNVB 2P67A 3AINA 6LDHA 3C48A 3WGHA 5JWRA 1A69A 1CE8B 3RGWS 2HAEA 2JIDA 1Q6ZA 1LQ2A 3AERB 2UYQA 3FBTA 2RBKA 2VUTA 1OYVA 2ZJ2A 5JRZA 2GO7A 2X7XA 3HZZA 5J47A 2IZOA 3G8BA 1UM8A 2DUNA 2Y93A 3IP7A 3IUEA 4FD2A 2PA3A 5CM8B 5F12A 2FLVA 3QKUA 2QE6A 3SQDA 2DUJA 4FFBA 4WFIA 4BV9A 4BX9A 1I6MA 2ESRA 3G8YA 4UTRA 1EBUA 1I0IA 3IAFA 4YCJA 1BHQ1 4DSUA 1QZZA 1CZHA 5TMDA 5IAGA 2I3BA 4HPXB 5EY5B 2HIGA 4EAAA 3PJRA 2BM9A 2JFHA 3ANMA 3OD1A 4LJ6A 4IXMA 1QCYA 5HM6A 5L7YA 2G40A 3GAZA 4BN5A 3GCWA 3MCWA 1FDSA 4DLRA 1EG2A 4JH0A 5ARCA 4FFMA 1IH8A 3KYJB 4R1TA 2P30A 4R1LA 4XVHA 5CXSA 4OCZA 4TS1A 3RE1A 3T0GA 2PNFA 4S24A 2Q2WA 5A9RA 5IF9A 1U6JA 5IX8A 1MGPA 3FJYA 4OP1A 4G0WA 2PS1A 1ISSA 4J90A 3W6UA 1RZVA 5FFMA 4BTVA 5HKKD 2BEWA 3NHFA 1YB7A 4QUIA 3UIEA 2BI7A 1T4CB 2Q3CA 2GZHA 3MJTA 3S7TA 2NWQA 2O1EA 1XFDA 2JDIA 3ECCA 1U3FA 4KQ1A 1QQ7A 4ND5A 3WGYA 4ZC1A 5LQJA 1YQWA 1ZFNA 4N41A 1KI4A 3DMPA 2I67A 3LQQA 2LCIA 1FFYA 2X9QA 5AW9A 4WKCA 4A6DA 1KTIA 2EBWA 2J5RA 4L78A 2NZXA 5A9SA 2XV1A 4FMPA 4BKUA 2O8DB 2Y0BA 3U1BA 3Q6IA 2BMDA 3WFJA 2RG1A 5CA0A 1HDOA 4XWWA 1U98A 2RG7A 3FUWA 4OBEA 5FB3A 1D0VA 1VSVA 3C6MA 3ZQJA 4EJSA 4F5DA 1GN8A 3G49A 4YJ3F 5ES4B 5G1PA 2O8EB 4OQXA 3VC2A 1SNYA 1E5VA 4KSYA 1J21A 1Z4JA 5AT1A 1E6LA 2P9QA 1RXYA 4RABA 4F38A 2QU8A 3SKXA 3L6UA 1KAEA 3PI6A 1XDBA 1I13A 2VH5R 5BO5A 4E15A 1YJXA 3K2IA 2O3RA 3OBIA 5CFOA 1NTRA 5M5BA 4MR7B 1ES9A 2UZIR 5JZ9A 4RHYA 5EVJA 3U3DA 2IEBA 4WOCA 3IDQA 4KE9A 3ZC3A 5JXGA 4MRRA 2RD2A 4Y6OA 3ET5A 4US2R 1YD7A 4Q3CA 4UUQA 1ZSVA 1CP2A 2EVWX 2H9YA 2JJQA 2V0CA 3K9BA 3PWKA 4LECA 4R16A 4R98A 2R62A 3RS2A 3NUQA 3OCVA 3WJ7A 1QJCA 5GY7A 5DNDA 4EB0A 1G17A 1F3LA 5GV7A 3TLKA 1L5HB 1D2AA 4URVR 3EWNA 1GPBA 1S9DA 1L4LA 1KIFA 1SH7A 1SM4A 1U2ZA 3GEMA 3I1FA 1D2GA 2XX3A 3L04A 3K9NA 4MUNA 1G21E 2IYWA 1T5DX 2EX1A 3ORSA 4EHKA 1HE1C 5CA1B 3DVQX 2P2DA 3IOMA 3DMFA 4CF3A 1C4WA 1QHFA 4BO4A 2GJKA 1PJBA 2VHEA 3TJRA 3GBSA 1WKCA 2OCBA 3CZMA 2GN0A 4L2IB 3WHIA 1VPTA 2ZJBA 4ZC8A 5T4BA 5KINB 2PXAA 3OTQA 4Z7OB 3F5FA 4UQPA 1R00A 3TXXA 2GBPA 5B4VA 1K97A 4PN7A 4XQ9A 2Q1SA 1N2CB 4DREA 3LZ6A 2VWHA 1XPUA 5B3JA 4GI3A 5FBVB 4FX5A 4QFBA 5E9QA 4YUXA 4DRYA 3R0IA 1JQKA 1KI9A 3WLAA 1A2KC 1J4AA 1PWZA 3NHBA 3ORRA 3QELB 2ODPA 4B7UA 4JVNA 4BP3A 2DB3A 4NABA 2P5YA 2AQ8A 4N3NA 4X54A 4JVSB 4KPEC 3G9QA 3QVLA 4JC5A 4JXJA 4UU8A 2ZCVA 5FO1A 3KK0A 5B12A 2YHIA 4JSTA 1Z36A 3KUKA 1CVLA 5TRTA 3PDWA 1GEGA 1G0OA 1QAOA 2A88A 4CDNA 1AKTA 1YAJA 3VJLA 2VJYA 4ZHSA 2NG1A 1NSYA 3GLFE 3S44A 3GJYA 4KP7A 5FPPA 3UAWA 4YAIA 4YRTA 2LKCA 3R44A 4TT8A 3P9NA 3P94A 5I45A 2H5EA 2O8CA 3PGVA 1K4YA 2NPOA 1Z5NA 4EY8A 2CLFB 4WXEA 4GPTA 2O5CA 2QRKA 3T61A 2FEWB 4H7IA 4L4ZA 4GD3Q 1YOVB 2CXRA 3EOAI 3JATB 1H8EA 2WKPA 3OICA 4YMHA 3TG8A 3LPLA 2DBYA 3NG1A 1T0IA 3UAVA 3B51X 2AYZA 3F6PA 5IUKC 4EP1A 4B31A 1STOA 5K0SA 2W9XA 4CMEC 3DZDA 1P4RA 1YI1A 1YB5A 4NS4A 4UNIA 3GEEA 1Y4AE 2LUOA 4MWGA 4OG2A 1KMHB 1EXVA 4GAEA 3R5JA 1HE2A 5ADVA 1IY2A 1TC2A 3DM5A 4WK2B 3MTGA 5EG5A 1DPFA 1KIAA 2AD1A 3AXSA 3O82A 3RK4A 4N8EA 1IXSB 3LXXA 1I33A 4PSDA 5F2EA 4E33A 4JBYA 3U44B 1Z6AA 1QKIA 1XU9A 2CUNA 3Q0IA 1IZ0A 5B3AA 1LCIA 3DBLB 1FJ2A 4GLBA 4H08A 3MLAA 3OTWA 1J8DA 3BMQA 4GXNA 4XDHA 4AJJA 4DRXB 3UN1A 2FE4A 1LDBA 4QAQA 3FGZA 2FW0A 3LV8A 1GPUA 4PCLA 3KHTA 4DVGA 1K5HA 1YNOA 4RH3A 2E89A 3OLCX 4XA8A 3R9IA 5SY6A 4COKA 1BFUA 3MWEA 4GBMA 1J42A 4NBNA 4D57A 5A0TA 1HNXB 2FPGA 4O33A 5DN9A 1I3CA 2AH5A 2YINC 4NNJA 3V8VA 4YDRA 4RGBA 2PZMA 3UH1A 4DSAA 1FFXA 2RJOA 3JQAB 3PUJA 1WAMA 2P90A 2W0SA 1T0HB 1BO6A 1GNPA 4BHTA 2VYCA 1V4VA 1U28A 3A4IA 1XP8A 1EP3B 5ICMA 2NO1A 5E4FA 4RE6A 4HBZA 3SC6A 2IZ7A 1N6RA 1DEKA 2QGZA 1CC1S 1RJ9B 4XPZA 3SXPA 5IDXA 2PRJA 3L4JA 1DTWA 1B1CA 1IB6A 1V35A 2B25A 5EHIA 1I9GA 1VYHA 3HFSA 3I2GA 4H7JA 4D45A 4CM1A 1KQOA 5BUQA 1QQ5A 4YP7A 2NVOA 2JGNA 2VI5A 3DV9A 3A1CA 3E8SA 3CF4G 3DWGA 1MFPA 1QPBA 2PJDA 4GX1A 4MPPA 4ER7A 2J3LA 5CNIA 3LUCA 1XB2A 5G4KB 5D6NA 2IX9A 3C8DA 1YR8A 2XRYA 3W5UA 1NIJA 1HDGO 1ZUD1 4DTIA 1Z15A 2GJ4A 2N1MA 5DM4A 1KHTA 2O0JA 5FQOA 5DBGA 1UIRA 3MERA 1YMVA 2D0OB 3GN1A 3VVMA 5A6VA 4RULA 2D7JA 1CJBA 1SKMA 3RAEC 1MJ5A 4UEKA 1PUJA 4BV2A 1WDWB 4CCWA 2VTBA 3PD1A 2DQZA 1V43A 3PQ7A 5E4YA 1JQ5A 1TF7A 2W2TA 4DM4A 3AUJB 4WNAA 1JLMA 3W9SA 1THZA 5K8TA 5LMCA 4EA6A 3B3QA 2WPDA 3PVSA 2GWRA 1JHYA 2JI4A 2CWWA 4GHWA 4MULA 1VSQA 3EAFA 1AKUA 4EVRA 3MJFA 3LPCA 1XV5A 5DXJA 2OC4A 2YZMA 3AFHA 4G5OA 3O8QB 5J4HA 3HCNA 4CYMA 5BWNA 1TADA 2IP1A 2R4QA 2IP4A 2YIMA 3NWEA 1W44A 3OQVA 5CAEB 3SEZA 3AEKA 3M6XA 3GAMA 1SG0A 5KU1A 1MQ9A 3OLWA 4D9JA 4F91B 2OLKA 3R20A 1YBMA 3PGMA 4BMOB 4J7XA 1JYEA 3KZXA 4OGGA 4I50F 5IT4A 4D26A 3ZVRA 3PITA 4RWZA 5C9ZA 3NCTA 1E77A 4WDRA 3V48A 2PH7A 3FTPA 3H97A 2RAVA 2KHZA 4NOJA 4O59O 1X92A 4ENRA 3BA6A 1RYMA 2IP2A 1VJ1A 2XNDA 3ZV5A 5C5CA 3AVTA 3TE7A 2VQEB 3IILA 1ISMA 3EGEA 3V4LA 3ZWNA 5BV7A 1UR5A 4LQ4A 2X58A 3EPLA 3EFEA 4KAXA 4B82A 2OCIA 3L7NA 2EQ5A 2EX4A 4QXPA 1NMYA 4XQ0A 5C0OE 4V02A 2G8NA 4OXYA 4UULA 1NURA 2QM0A 2B4RO 4KXLA 4OL9A 2I54A 5WRFA 3TUJC 5HWSA 4AJOA 4X9XA 5TGTA 4NIMA 2ZIXB 3F0TA 1VZ3A 1CUFA 5EWJB 2JH9A 2X15A 1T4GA 4HAWA 4J4HA 4NXMB 2V6BA 3QY9A 4IXNA 3L84A 1KJ9A 5TSDA 1DXHA 1M6WA 2IS6A 4V0NA 3JQ8B 1J9ZA 3N7TA 4OMDA 3OWHA 3HEAA 3OPXA 2GK3A 4UFNA 1ZXLA 3HC7A 2C4UA 2PRSA 4E07A 1V8OA 1DRJA 4MLDA 3LMKA 1TCCA 4C4TA 2YJ6A 1T8WA 3E53A 3I9LA 1AV7A 3U44A 4C0WA 4G01B 2B9EA 1SRRA 2EL7A 2YH2A 3ITNA 5JTUA 3HL4A 3P4XA 4IS2A 1Z2EA 4HAVA 3NP9A 4HDOB 3W05A 3AYZB 5E2BA 2P7IA 1O03A 3IBTA 3ZWMA 4BMZA 2FP3A 4N1AA 3RIYA 4MAMA 3Q98A 5IT9A 2XGOA 4R9VA 4YALA 2VJBA 4ND6A 4MCAA 1DJQA 5JS8A 2A0YA 1YFLA 2FXVA 2AKEA 3ASZA 4I1OA 3EODA 1YRLA 1ZXBA 3PFWO 1PLKA 1K8YB 4PLYA 4U5XA 3TNJA 4ECAA 3KB2A 1JEYA 4PONA 4ZARA 4YUVA 1SBCA 4POAA 3BWDD 3OQIB 1E8DA 3EFHA 4CQMB 1Q17A 4IVNA 4L3VA 1BE0A 4FTWA 2XVYA 2J9GA 1XZFA 5J4VA 1JH8A 3TI9A 2REQA 2GETA 1N5RA 3GWGA 3K8QA 3KM0A 3ZW9A 2CV0A 4R1OA 1M6HA 1DP4A 1I4EB 1NKTA 1R9JA 2QQFA 3WYNA 3WKDA 3KD2A 3AUUA 1SJ9A 4Z7NB 1ULAA 3OBBA 4KXYA 3FH0A 1YZGA 1BMFD 1PT5A 4OSOA 1C9NA 5IZ4A 5E2IA 1NYLA 1WEHA 3GXOA 5KKNB 3QGMA 1E64A 4JDUA 3OZWA 2LWIA 2ZSUA 3UXEA 2A58A 2GR9A 3O8OB 3RVPA 1PZMA 4E0BA 4D97A 4CDGA 4K2AA 2NVUA 4ZO4A 5AK5A 4EPXA 1TYCA 4ZVTA 4F92B 2JPDA 4PN3A 2V0GA 1ZA1A 1FXWA 2AEJA 3D3KA 5CT8A 5I4KA 2IYQA 3NHRA 1FX1A 2R1VB 4YNBA 1QFJA 1XC7A 2R68A 2O06A 2G0AA 3ROFA 4IRUB 5B2ZA 1IJBA 1GPKA 1ZJWA 4QFMA 4OY3A 1OAOA 4G0PA 4JR1A 1LPPA 2NU6A 3BX1A 1ZCFA 4ICIA 3ZIAA 2HO4A 1MA3A 1KAGA 2AOVA 2R4TA 2ASEA 1GJRA 1V7QA 1GZ7A 4UM5A 2QYSA 1QRAA 2QQ0A 2AYXA 3ACBA 3C6KA 3QBTA 5BSMA 1XDWA 4N3AA 3P0RA 4CTJA 3G0DA 1ADCA 2R48A 2ZDGA 3H9JA 4NBTA 3CH7A 5A7GA 4R1PA 1N5OX 3T5GA 1SVLA 5EIBD 5HCUA 3O90A 2XQIA 4GPD1 2GK4A 1FDTA 4RWEA 1S96A 2C5SA 4EHFA 4Z1MD 4R83A 1F2UB 1TAGA 2RJNA 2JATA 3CH5A 4EUFA 4MV0A 2AI2A 2WDPA 1ENPA 4IOMA 3I37X 1D4OA 2CMDA 2XYRA 4L08A 2JJ8A 5EIFA 3UENA 3SK0A 4Y0VA 5A4IS 3UMMA 3TB4A 1C50A 4M9CA 1VL0A 1X0XA 1W0KD 3E7FA 5ELLA 2GAAA 1JG1A 2XLCA 3IOYA 3RUAA 1XVLA 3QBJA 1JLHA 3GP8A 2WWWA 4FZJA 2AEFA 4V2IA 1ECCA 2VHXA 2AFIE 3EK2A 3KPUA 2HCRA 3BERA 1EZ1A 3GVIA 1Z4NA 1JAYA 2JIMA 4HMQA 3D64A 3WWDA 3KYDB 5CB4F 3RYFA 4AF7A 2RH4A 2A14A 3G8CA 4RKYA 4ALIA 1N5IA 1GPAA 4AKSA 2OMKA 4RELA 4JMLA 1ND6A 3ONNA 5COBA 3AIIA 2CL7X 2ZOSA 1QANA 1WWKA 3EPJA 3IAEA 5DP1A 2EQBA 3LIPA 3RUIA 1EJ6A 1IG3A 3VPGA 4RK5A 5FFNA 2IF0A 2PWPA 1SO8A 2Q0SA 4HGNA 1TQ6A 3UA4A 1C29B 4C06A 3L1VA 5FUXA 3VR6H 3Q85A 3T8YA 5DHTA 4CF5A 3KYCA 2O4UX 1N9GB 2FY8A 2P2LA 1FDOA 2TSYB 3ROTA 1W4BA 2C29D 3CTMA 3MCZA 1SOUA 1NJ2A 2JCGA 5F51A 4O4JF 4BO0A 2BHNA 4I36A 1V7PC 5FLXA 3CUWA 1H2XA 3NHUA 1Q20A 1ZM9A 4RH1A 3TSYA 4W5OA 4AI6A 3V7UA 1BHO1 2ACKA 2FFBA 3H6GA 3SOZA 4D4LA 4E09A 1N33B 3WLLA 1A1SA 2GEDA 1XXHA 4ILEA 4UBJA 4MINA 1BGXT 2R4UA 3LYLA 3PUVA 2PMKA 4I8XA 1E5QA 4EY6A 2FUNB 2JAPA 4P3XA 3VPSA 4EG6A 2P77A 4X61A 2IPMA 4B6OA 2NAFA 1V41E