4GBMA

Sulfotransferase domain from the curacin biosynthetic pathway
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SRLPGIIFILSSPRSGSTLLRVMLAGHSSLFSPPELHLLPFNTMKERQEQLNLSYLGEGLQKTFMEVKNLDATASQALIKDLESQNLSIQQVYGMLQENIAPRLLVDKSPTYAMEPTILERGEALFANSKYIYLVRHPYSVIESFVRMRMQKLVGLGEENPYRVAEQVWAKSNQNILNFLSQLEPERQHQIRYEDLVKKPQQVLSQLCDFLNVPFEPELLQPYQGDRMTGGVHAASLSISDPNFLKHNTIDESLADKWKTIQLPYPLKSETQRIASQLSYELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of functional group activation by sulfotransferases in complex metabolic pathways.
pubmed doi rcsb
source organism Moorea producta
molecule tags Transferase
molecule keywords CurM Sulfotransferase
total genus 101
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gbmA00
4IVRA 1CJKC 1P9WA 2A3RA 2OILA 2YINC 4NL4H 3UMRA 1SXJB 1D9XA 3FYHA 1CR1A 3QKRA 3EC2A 4CT5A 2HYIC 5CLLA 2WBLC 4XWOA 4II7A 3MLEA 1R5BA 4GI7A 1OSNA 3QF7A 4PHTA 1T91A 3T15A 3TQFA 3NDPA 2ZRFA 2OLJA 5JSZB 3HYTA 2G88A 4UJ3A 4ERNA 2ATXA 5IDVA 2WJJA 3X1XA 3I62A 3PXGA 1T5IA 3NC1C 5CB6A 4A36A 5BN4A 1OB2A 1SVKA 3M6AA 2XITA 3D3QA 8OHMA 3MJRA 2GXAA 4RZ2A 1EGAA 4ZCLA 1MH1A 4U7DA 2NO0A 4Q9KA 1B23P 3NBFA 1JXMA 2DWQA 4TWZA 3TSWA 5EXPA 1G5RA 2KBEA 2QM8A 3NTUA 3DPUA 1II9A 1IM2A 2EFGA 2HYDA 4C30A 1XEFA 1XEWX 2CHGA 2CL6X 5EP1A 1KMHA 4CF7A 1R6BX 2GCOA 3CONA 3CX7A 1KY3A 4EAQA 3KJGA 2XNDD 4WIAA 1GRQA 4D4LA 4W5WA 1N2CE 3WP1B 2VF8A 3LX5A 2X1VA 3SQWA 4R7ZA 2ZSEA 4KBGA 4D81A 3FGNA 2F9MA 1WQ1R 3KQKA 2VEDA 4W5JA 4YMVA 1HY3A 3KTAA 1KJYA 1W4AA 3V00A 1S4QA 3U3MA 3KX2A 2D2EA 3B60A 4OQLA 4PQYA 2J0UB 1U2RA 1JAHA 1ZM2A 4CEJA 1GFIA 3GJ5A 4Q1DA 2WJVA 2LKDA 3EPHA 4C2TA 3C8UA 3U3OA 1TADA 4W5HA 5B57C 4BE7B 2E87A 1NN5A 1XPUA 1EFTA 2P67A 2IX3A 1A1VA 4AKIA 3ND8A 3B13B 3H2YA 4TTQA 2JGNA 3PG5A 4TQUS 3HU3A 2ZRAA 4PPNA 4Q4LA 1FQJA 2IUSA 4TN1A 3K0SA 4US1R 2FMXA 4OHZA 3U7HB 3SYNA 3GCGA 5HTKA 2FX3A 3ETLA 2XTZA 4A1FA 1XCMA 2AHOA 2P0EA 4HZIA 4TLDA 5TY0A 3WRXC 2O5VA 4E22A 2AXPA 1XWIA 5IK2A 3AVYA 4Q9HA 5K8LA 2D4HA 4MYTA 3ZGXA 3QJYA 4BRUA 4JL5A 1UKYA 3KB1A 4HB3A 3CX6A 5TB5A 1NIJA 1MABA 1J99A 1SKQA 3RAPR 3WYGA 1E79D 2ZETA 1D9ZA 1DO2A 1OIVA 4HLUC 3GQBA 4LGMA 3VX3A 2RHMA 5F3WB 3V4RA 2IHBA 1Z22A 3EG5A 2NO6A 3DKPA 1VCMA 4TMWA 3RSLA 3TKLA 1T5LA 4PC2A 5JWRA 1VIYA 3P20A 1IY0A 1W0JD 1AGRA 3PFIA 3GLFA 2XXAB 1CR2A 4LHVA 2IYLD 3KL4A 4RD1A 3U4QA 1YRAA 3THYB 4PPGA 4ASUA 4ACAA 1SVWA 5GJWC 2HCJB 3THXB 1MOZA 2FJUA 4V03A 4PFSA 1Z83A 4TL6A 5FOUA 2IF2A 1TAGA 5KDOA 4L9WA 3OFND 1YZNA 4X8HA 4NYIR 3UG7A 3UIEA 3W90A 4EPRA 4POAA 2YYZA 2HXSA 1H8ED 2CHVA 4PTLA 3T1TA 1W4CA 4WZ6A 2H7VA 1HUQA 2A30A 3EIEA 1XCPA 3WYAA 2AFIE 3U7FB 1Q57A 5K8IA 4Q03A 3TUZC 3NKVA 4B73A 4Y0AA 4OK6A 4RFSA 2J46A 2PT5A 3QENA 3B82A 3HR8A 5FTMA 1OKKD 3LBHA 4IRUB 2GESA 2QSYA 4FCWA 1M7GA 1Y3AA 5HPYB 4IOJA 2MSDB 4C7OA 4CEIB 2JLWA 3VR2A 3DHWC 1FNMA 1SXJE 2FE4A 4DUGD 2MSEB 1EXMA 5GJVC 4DZZA 4B74A 4B3CA 1G7RA 1KYIA 1N6PA 5JLJA 4IVPA 2OBMA 2MSCB 4V02A 1V5WA 5JS7A 3CRQA 1TEVA 2XJ4A 1RIFA 3K9HA 2ZJYA 1U81A 1S3SA 4MGKR 2BBSA 4V0KA 3R9WA 1KKMA 5KPJA 4MH0R 4HDCA 3B78A 4PXAA 1N6RA 4N1AA 2IEYA 4UNQA 3QY0A 1G3IA 2JIZA 3K0AA 4LBYA 2BWJA 2VTKA 2WJIA 5FOVA 4B3BA 2QT0A 3CPJB 1WMSA 3AF4A 1M6NA 2IS4A 4M9SA 2R2AA 3EZ9A 4Q7MB 2VSOA 2W6JA 2RGCA 3Q5EA 3P4YA 4JT2A 3U3JA 1AM4D 1NG1A 3B2EA 4OJKA 4A0GA 4DLYA 5BN5A 1YR7A 4BFSA 1OHHD 2OZEA 2JLVA 2OUKA 4JSTA 2ONJA 1RFLA 4JLKA 5BYKA 1MRNA 1KK1A 4OQXA 1ZM3A 5A0FA 1MO6A 2VHUA 1R5NA 1VTKA 2H1LA 2VP5A 5B30A 1IJFA 2JIZD 4Q1FA 3QKTA 2ZUBA 4M53A 4WXPA 1F6BA 4YXWA 1BH2A 2UVQA 4QGGA 3QIAA 1PLKA 2QY9A 3V4FA 2FFQA 2XZPA 4V0OA 2ZEJA 2F1IA 2JAQA 2QP9X 4X8OA 4LYFA 3MWLA 4KSBA 4Q4AA 2O8BA 4LYHA 4GDFA 1BO6A 4AYTA 2GBLA 4C3ZA 1KDOA 1ESNA 1IHUA 1IY2A 2VA8A 3TUIC 5JEEA 1KDPA 2CL0X 4QGFA 2A5DA 4UNSA 4ASUD 3OE7D 3K0FA 3RS5A 4XSHA 4B32A 2CE2X 2C99A 4HUQA 3BFKA 4PAMA 1ZUIA 3QSYA 3R9XA 2GK7A 5EE9A 3K8YA 4AKEA 1QHHA 2VHCA 2C9OA 1PV4A 2CXXA 2GXSA 1P9NA 3ZIAA 1XRJA 2OXCA 4M1WA 4ESVA 1G41A 1NG9A 2O8EB 1AKYA 2A78A 1E4YA 1HYQA 2XX3A 3KFVA 2VP6A 1KSJA 3VKGA 3U2QA 4DIEA 1CJMA 1CEEA 1X8LA 2ZIAA 4PO1A 4JLJA 1NKSA 2MMCA 4UJ5A 1LW7A 4KYUA 3U44B 2F1JA 2IHYA 3RS7A 4DCVA 2YVUA 1MR3F 3IO3A 2RCNA 2B8TA 4GBMA 2IC5A 3LXRA 1HV8A 1XTKA 5F98A 1J7KA 1KK2A 3D6TB 2A7QA 4MRRA 4Q9LA 1DAHA 4IOLA 2O8CB 2R6FA 4O0MA 2LKCA 3AVPA 1II8A 4TMXA 4OQFA 4FINA 2R62A 1N6LA 5TDHA 2QGNA 4Q66C 3QKSA 2QN6A 1KOFA 2C78A 1CKEA 3K1JA 4YDSA 4OJQA 4DEXA 3OFNA 4PO9A 1A4RA 1IONA 4Z8YA 3DZ8A 4AWXA 1C4OA 1NLFA 4GZMA 4DCTA 1OH5A 4OHVA 3S1AB 3X1YA 4B6EA 1WB9A 5TARA 2RB4A 3CBQA 3VQTA 1E2GA 1VMAA 2W6IA 3MCAA 4OK5A 3R7WB 1O3YA 1NF3A 4B44A 4ZDKA 4LJ6A 4K46A 2GXQA 4JT4A 2ZS7A 3D31A 4L9SA 521PA 5KDLA 5AUPB 4FCVA 1FFHA 2NIPA 1E9FA 3BH7A 3CF2A 1O87A 1PUJA 2P3SA 3N2EA 3TUJC 3Q8XB 1E4VA 1Z6XA 2C2HA 4K81B 1G3QA 1OW3B 2RGNC 2C03A 2D62A 3ONWA 1PUIA 1WA5A 1IN8A 1N5IA 3A4MA 3GMTA 3HR7A 4FWIB 3ADCA 2RGDA 3MFYA 1RPZA 5L3QA 4K8OA 5TMPA 4PANA 2AFHE 4ZDJA 2ZJ5A 5C18A 1P6XA 4HAYA 1GUAA 4RD4A 2D7CA 5DIFA 2I1VB 2VQSA 4YMTA 2FOLA 3QVVA 4XOIA 4A0HA 4FWTA 1XEWY 4BFXA 3NC0C 2YWHA 1H8HD 1NVVQ 4J0QA 5DI9A 2IYTA 2QMHA 4NCNA 1E2IA 4WAUA 1LNZA 1F2UB 5HCNA 3GJ4A 2GCPA 1CTQA 2TMKA 1ONBA 1G7CA 3RS0A 1KI4A 2B7CA 2ERYA 2HUPA 4FCTA 1TU3A 5EQTA 2Q9BA 2YOGA 1OH6A 2V9PA 1XD2B 2WWFA 2GNOA 4H1VA 3LAWA 5FPHA 1VECA 1M7HA 4BFTA 4DLUA 4JLOA 1G3UA 2QL6A 4F92B 2W2TA 4G5GA 4DSUA 5BW8A 1UBGA 5JHHB 2EFDB 4MA4A 1XTQA 1ZUHA 1L4YA 1SZPA 5EXSA 4BFZA 1FW6A 4L4UA 1JR6A 1XJCA 1WRBA 2JLSA 2JEOA 4M9ZA 1NLZA 1G4UR 2Z0MA 1TUIA 3FB4A 1S96A 3AVUA 4TZ0A 3PUYA 4Q02A 4CT4B 5GVSA 3NEJA 4GL2A 2ZTSA 4C0QC 4HI0E 2PBRA 1R8SA 3SC3A 3LFUA 4NBSA 3BFXA 3CH5A 3FTQA 3PVSA 3TVDA 1SQ5A 2O0JA 4ZCIA 2FEMA 3RS3A 1ZINA 5G53C 2HT1A 1F2UA 4MRPA 2QENA 3WP0A 1T0HB 2PEZA 3CRMA 3VTKA 5KSOA 4AG6A 1GNQA 1KY2A 1X8KA 3K09C 2CE7A 5FBWB 2ODNA 1LF5A 1GOTA 3FFAA 4PZZA 4P33A 1AZTA 2FGJA 2R44A 5EE1A 4R2HA 4XJXA 3U7EB 3UKDA 4DIDA 2H16A 5L3QB 1XZQA 2HLDD 3FMOB 2HF8A 1EFUA 2OO7A 4KLNA 3LD9A 2XTNA 4A82A 1AKEA 2ZJ8A 4V0ME 2VIIA 4QGAA 2Q9CA 2XNDA 1G8PA 3LV8A 3SBDA 3WY9A 1IAQA 4JYBA 1AQUA 2BKUA 4LJ8A 4F4IA 4Q1CA 1KMQA 5P21A 3H1TA 5FUVA 1UBFA 2N46A 2G1JA 3T5DA 2O8DA 4MGYR 3ZQJA 3KJIA 4RZ3A 3S1AA 5H70A 5K8UA 1Z07A 1NBMD 2ZRIA 2HEIA 4AG5A 4FMDF 1D8TA 4EUNA 1OXVA 2KI5A 2ZRPA 1U98A 4W9MC 2R9VA 3L8ZA 1MO5A 3QKSB 3REGA 3C5CA 1GDDA 4PC6A 4M21A 3K09A 5KPDA 3B1VA 3DOFA 1XJ0A 4OHXA 4YMWA 3FWYA 4BRWA 3U60B 1W36D 1Z3IX 5B2ZA 1ZAKA 1FP6A 2ZRLA 3U61B 2XZOA 1GRRA 2PMDA 1KO7A 3FOZA 1RW4A 5DN6D 5LDDC 1YRBA 4Q4JB 4YXWD 4LYJA 1DBSA 1RRFA 3DMNA 2VP0A 1WCV1 3U44A 1A7JA 1K8RA 4EPWA 1UFQA 2X2FA 1XXHB 1EK0A 5FUXA 3ZZUA 4DDVA 2BEJA 2BEKA 2AKAB 3DOEA 4FMDB 4G3XA 3SQXA 2J0VA 3HDTA 5KYKA 3PJRA 1X6VA 2ODWA 3EA5A 2ORIA 5EE3A 2XGJA 5SZJA 2O8EA 2NPIA 3KUCA 1YE8A 1H8EA 3CX8A 2ZANA 1PVOA 2W0MA 4QNRA 1J90A 1QHHB 1PLJA 5L8VA 1CJVC 2GWHA 3E70C 2BC9A 2PT7A 3CM0A 4GOXA 1OFIA 3PEUA 3KQUA 2VYFA 3W8NA 1CR4A 3LVQE 2DR3A 1UBCA 621PA 3K0FB 4B48A 1ZD8A 1P62B 1E9AA 3NIBA 3WNDA 1XMVA 3P1JA 3A37A 3L82B 4AI6A 5J4KA 2PH1A 2FSHA 1BKDR 1GILA 4JLVA 3WHKA 1X1RA 4XTRA 4Q4AB 4OQNA 3VR4A 4URZR 2EVWX 1KI3A 3WYFA 1N5JA 3KDSE 4FW9A 3PITA 3BK7A 3QE0A 1P72A 1P61B 2JJ1A 5LB4A 4OHWA 4BUJA 2ZI3A 4TTPA 1FNNA 2GJ8A 4ACBA 4DDWA 4Z1MD 1PZNA 5DH9A 4GNKA 5HE9A 1E0AA 1GWNA 4XD7D 4TSFD 4IDPA 5JJLA 1QHIA 5CK4A 2IYSA 5FBQB 5FOWA 1OKKA 4TZ6A 1NBMA 4HLDA 1ODFA 1QG2A 3FFBA 2OLKA 1UDWA 4DKXA 4Q7JB 1WF3A 3EZ7A 4A0RA 4BECA 2FSGA 3IHWA 2RGGA 3GLIB 3VNUA 2ORWA 1P3JA 1TU4A 1VYVA 1W5SA 1RJ9A 2ZROA 3I1FA 1WBDA 2XSZD 4KO8A 5DLQC 1JECA 2ZVPX 3RLFA 2FGKA 3QNUA 4IW3B 3LQRA 3RC8A 2QA5A 2BBOA 2ASEA 3BFVA 4G5QA 4BWYA 4EKDA 5CITA 1E9CA 2PX0A 3UXMA 4PAQA 1TQ2A 4FN5A 2JJ2D 2IWRA 4BFVA 2PZGA 1AK2A 1W5TA 3K0AB 3AVVA 2ZAOA 1CULC 2GILA 4LY6A 4F4JA 3GLIE 2QRZA 3WRYC 2FZ4A 2QGZA 4X8LA 1E1RA 4Q1BA 3E2IA 5AJYA 3FKQA 4D82A 4ABYA 2JLZA 1UF9A 3A8TA 1QG4A 2WMOB 4MKIA 1OH7A 4A9AA 3OF5A 1JQLB 2AN9A 2REOA 4XTCS 3QEOA 1DAFA 3B7GA 2C98A 4ZCMA 4EJSC 2FSFA 1CS4C 1YJ5A 1NVXQ 1W36C 4IJMA 3A1WA 5FOXA 3CB4A 4M1MA 4LDJA 5GJCA 1E9RA 1SKYE 3KKQA 1IJEA 3IEVA 1XCGB 1D2EA 1JQJC 1Z6AA 5HCIA 4BZPA 3K70D 3KZ1E 3W6OA 2RKOA 4RVCA 3T5GA 2BHRA 2WAYA 3ZD7A 4A0FA 1XD8A 1N6HA 2NQ2C 2GF9A 3CNOA 1W46A 3LDAA 4NTZA 2BVNA 3KQHA 4L15A 3FMPB 1LB1B 4LBWA 4WXRA 4IEEA 3K9NA 3B5JA 1G8GA 4NMMA 3K70C 2Q6TA 1SVOA 1N0UA 5AUQA 1XPOA 3LA6A 3Q3JB 3HPQA 5HZHA 5EP2A 3AVXA 1MKYA 2CL7X 1JAIA 3IHLA 3THYA 4XH9B 2ZJAA 2WSMA 3CW2A 1NNEA 4CEHB 2XXAA 4FMCB 1ZVQA 1Z63A 3KFXA 4QHYA 2BV3A 2FH5B 4BLQA 1T8TA 2J0QA 1FZQA 1XMSA 2X77A 2ZUDA 1I2MA 3IDQA 3O8RA 5DO9A 2ZI6A 3AVWA 4C2UA 1H8HA 4IOMA 3TRFA 5KU1A 3KJEA 4LHYA 2ZJZA 4KHZA 4QHSA 2ZREA 5FUWA 4KVGA 1Z6TA 2JJ1D 1NN3A 3OZXA 4RD6A 4NCKA 4KJZA 4P3YA 2DPXA 1E94E 2DWOA 4NYIQ 5JI2E 2BMEA 4MDFA 2HJVA 3SR0A 4A6XA 3PUVA 4D6PA 4JL8A 3P26A 5LBIA 3N70A 2Q21A 3LLMA 1ZJ6A 4BFYA 4HATA 1HURA 2CJWB 4MQBA 2BM1A 2IS1A 1XU4A 2E1RA 1F2TA 3ZS9A 3FPAA 1G16A 1KI8A 4CIDA 4DVGA 1KZ7B 4DBLC 2IYRA 1XDBA 1QHNA 2WOJA 3DDCA 4QBHA 5BQ5A 2JA1A 1E9EA 2ZRKA 2YOHA 2QE7A 3T1OA 4EQ6A 2V6JA 5E7IA 4AURA 5EZ6B 1Q1QA 1OFTA 1KSHA 3NH6A 4V0LA 4IKEA 2WWXA 4R71A 2C8VA 2ZJOA 2J0UA 1G9XA 1KI1A 4RCZA 1CR0A 3R8CA 2ZR7A 5M04A 4XSGA 1E2MA 3OIWA 2H18A 3GFOA 3KKPA 5JFGA 1KDRA 1EWQA 2CLDX 5FL7D 1E1QA 1Q1EA 1XZPA 3IUYA 2ZYTX 1XTRA 1P4SA 3CR7A 3TIFA 2AWNA 1KI9A 2GCOB 3RRMA 1A2BA 3C4JA 1CRPA 4OYHA 2F9LA 3CZQA 1COWD 1S9HA 1UPTA 4MYCA 2R8RA 3BGWA 3LVRE 4QGHA 3BRWD 3RABA 2K5UA 4M9QA 1KAOA 1Q0UA 2ZRGA 5IF9A 5JJKA 3U3KA 3AF3A 1MO4A 3FHCB 3SHWA 5LD2B 3ZIAD 1AS2A 2QBYB 5DI3A 2QORA 2W0SA 1ZD1A 2RGBA 3B9QA 4IEIA 4M1YA 2WOOA 3LRPA 4US2R 1G64A 4JBWA 1E2NA 5JHGB 2QROA 2R65A 3BB4A 3MG9A 4EIWA 2WZQA 3W34A 1GG2A 4URWR 5JI3E 1NJFA 3TVTA 4D25A 2QZ4A 3B85A 1KI2A 4IDHA 4Q01A 2HDNB 2G77B 4MRNA 1K5DA 1K5GA 1DAGA 4DLSA 2Z4SA 2ANCA 3SDZA 5JSZA 4ZI2A 2WWHA 4A4DA 1MRSA 4E07A 1IOZA 4QKQA 3J81k 1DPFA 5CJ2A 3BB1A 4DUGA 5EUMA 1ZMXA 2P5TB 5KSPA 3E5HA 1M2OB 1FX0A 4NE2A 3ZS8A 1YR6A 1GSIA 3QXHA 1SXJA 3I5XA 1BMFA 4I99A 5JWHA 2REBA 1W47A 1OPXA 1Q44A 4PQFA 5AUOB 4FMCF 1NBME 4DLWA 1SULA 5EE5B 2ZRNA 3HPRA 2OESA 1EWRA 3A4LA 2WIAA 3LH5A 1HE8B 3CPEA 1KTVA 4TL9A 5CIQA 4A8JA 5JCPA 3PR1A 1F3OA 4TQ9A 1IXRC 2ZE8A 3ADBA 1OXXK 2V7QD 2F43A 5CJPA 4WBSA 1U9IC 2VO1A 2GZAA 4RY2A 2VP9A 1KI6A 4Q1EA 2NGRA 2H8KA 4DT1A 1E9BA 5J4YA 1CLUA 1QHXA 5B64A 4A2WA 4TYPA 2FU5C 4HSEA 2XJ9A 4RKEA 4AYXA 5AJWA 4HB2A 4F7WA 2VF7A 1Z0AA 3ZD6A 4C9BA 1NRJB 3I5YA 3ZZTA 4KFUA 1KSGA 3SOPA 1KDTA 4D4MA 1U99A 2PJZA 1ZU4A 4IFBA 4RSGA 4LPSA 1RRGA 1FPMA 1NN0A 4EJSA 5AJZA 3VR3A 4JLNA 2LCFA 5J4HA 2GVDC 1OYWA 3W9YA 2CBZA 2IF0A 1W0KA 3AQ4A 4D26A 4RD0A 1E1QD 1KAGA 1HA3A 4B2LA 2V3CC 4DB2A 4I81A 2OBLA 4JBYA 3JVUA 3NBYC 4UQOA 2OE2A 5TVKA 3CF6R 1RVDA 3FKSA 4PPFA 2AD1A 4XIGS 4HDOB 2DCUA 3AP2A 3QPUA 2SHKA 4KVAA 4UXIA 1XTIA 4HZUA 4OKSA 1VCIA 1IBRA 1DARA 1NY6A 3A4NA 2KBFA 3KUDA 5FFMA 4Z54A 1HQCA 1R4AA 4QJ5A 1L2TA 2CVFA 5CIWA 3SJAA 1KHTA 3TLXA 2HXYA 2O8FB 1AZSC 3GJ8A 2PZFA 2G3YA 2RGXA 3AV0B 4UXHA 3R8FA 4ZO4A 5FUYA 1VG9B 4QBIA 1FP7A 1GL7A 1NVVR 2AXNA 1CF4A 3BIFA 4QBGB 4TYYA 2IYVA 4HYYA 1N5KA 3TK1A 1Z0KA 1TF7A 3F8TA 4Q4HB 4NH0A 3LW7A 2QAGA 5EXTA 1SVSA 2D2FA 2YC2C 1XB2A 1LF0A 3AKDA 1Z6GA 4E5UA 1S8FA 4PSKA 3JZMA 4A2PA 4EJSB 2KB0A 1I4TD 4MRVA 1RYHA 2OT3B 3ECCA 1NVUQ 3QEJA 1XTJA 4RD3A 4RCYA 4CGZA 1WE2A 1YZGA 2A5GA 2F6RA 4AY2A 2WAXA 4U02A 2JLRA 1ZU5A 2OAP1 4JVLA 4WZBE 4Q19A 3SU8A 4BFWA 2PJRA 1BS1A 2QMOA 1N6KA 3UMSA 1YZLA 2XNSA 4OI0A 5EZ5A 2JATA 2A5FA 2XTMA 1JR3D 3SJCA 1SVMA 1E2KA 3AGPA 1EFCA 2Q3MA 1NKTA 1Z8FA 2ZI4A 3I72A 4HAZA 3RNLA 5KSZA 4Q5IA 3CRRA 2CCJA 1QZXA 5L3SA 3DEFA 1DADA 4MGIR 1FMJA 1P60A 1MO3A 3ZVRA 1NIPA 5C4MA 5KNDA 3OAAD 1ZBDA 2EFHB 4NYJR 2CLCX 1E2LA 3SN6A 3TAUA 5H1YA 5FPKA 5SZHB 2G0TA 2D7DA 4A8JB 1P5ZB 5FR2A 3IBYA 1KNXA 4RZXA 2WKQA 3R9IA 1DAMA 2X2EA 4ZKDA 1YQTA 2QMUA 2CNWA 4DHEA 1VIAA 1OF1A 3O8CA 4DSNA 2A9KA 2G1KA 5D3QA 5C2JB 2V8OA 1Q22A 2DFTA 3BBPA 1G7SA 3PENA 5CLQA 1QDEA 1ELOA 3GLHE 2AK2A 2HF9A 4OI2A 1ZD9A 4EPVA 1FX0B 1E2JA 1A82A 1M8PA 3SFZA 3AB3A 4DEYA 5DYGA 2CCKA 2FPLA 1ETUA 2DWPA 3AEZA 4BEBA 1OFHA 2UZIR 4ZIRA 2GEDA 5G3ZA 4RZUA 2A2ZA 3R20A 5AR1A 2OCBA 3KKOA 4PSAA 3X2SA 4AC9A 5BXQC 4OBEA 1Z29A 5SZKB 3I73A 3MJHA 1OT3A 1QHYA 4M0LA 3CZPA 2JLXA 4YQFA 5H68A 1CXZA 3B1XA 3QF4B 1Z5ZA 4BLPA 4EFLA 4MDEA 4MKGA 1XP8A 1G7TA 2EWVA 2XEXA 1XF9A 2O52A 1KO5A 5DI3B 3D8BA 4B3FX 1CJTC 3FHTA 2GXUA 2QBYA 1N25A 4S2EA 1YHNA 2QMEA 4LV6A 1TPZA 1Z2CA 3AF1A 3KKMA 5DE3A 3RRYA 2R6CA 4WOPA 4ESHA 1VCOA 1E2DA 2J1LA 3ICQB 3U5ZB 1ZC3A 3H4MA 4JLPA 4TT3D 1R0YA 1TL7C 4B3DA 1E96A 1Q3TA 2BIFA 1UJ2A 4I1SA 4GFDA 5CK5A 1VG8A 4ILEA 3JZAA 3C5HA 2AR7A 2QP4A 1BMFD 4B2IA 3EWSA 4PHHA 4EPTA 5EP4A 4QC2A 4BPBA 3GEEA 3SYKA 3UWOA 4TMTA 4XD7A 1TX4B 4EDHA 2OM2A 2C77A 3CF0A 2XOKD 1IN6A 1QHGA 3IBGA 4A2QA 4DDUA 3RVBA 3I4LA 4ZDWA 4IDNA 4HLQB 4NCIA 2LWIA 2J3EA 4JLAA 5HE8A 1YZQA 3W8RA 2Z6VA 1XMJA 2FA9A 2GVZC 1HTWA 1GM5A 4XWAA 3B1YA 4EQ6B 3I61A 4LWZA 3UANA 2VBCA 4MGZR 1D5CA 2ZM5A 3BD9A 1GVNB 1AGPA 2WWIA 1JB1A 1T9HA 4P4UA 1F2TB 2N1BA 2CJWA 2YHSA 2VPPA 1NI3A 5C1BA 3GPLA 3OEED 3CKLA 1KJZA 2JCSA 1KSFX 3TW4A 3BH0A 1JALA 4FIDA 4D0LB 3DZDA 1P2VA 1COWA 4GOJA 4B33A 3GJ3A 2OXRA 4DLVA 3IIJA 5E7MA 1ZW6A 4Q21A 1M1YE 2EYQA 1J70A 4PSVA 4ARZA 2CCGA 1E3MA 2FF7A 2QQEA 3SE0A 2HJGA 3QVUA 1AN0A 3LQQA 3THWA 2GRJA 5FL7A 5B58C 1U0JA 3MWKA 3UG6A 1NLYA 1VKJA 4NCHA 3LNCA 3GEHA 5JEDA 3EPKA 3EZ6A 3BOSA 3QKUA 1RRCA 4YMSA 3AVTA 3O47A 4F38A 4C0JA 4DCSA 4OHYA 4JSYA 3RS2A 1NL3A 3CWQA 2Q9AA 1P2UA 1JEEA 1OE0A 3MSXA 4CEHA 1R5OA 3EIQA 4XVQA 2VRWA 4LC0A 1XX6A 5GVRA 4JVSB 4B3XA 2J45A 3EARA 1G3MA 3BS4A 1AIPA 1GRNA 1OXUA 2BCGY 3G82C 3L0PA 3BWDD 1NSFA 2CVHA 2H17A 4D0NA 4DC9A 3LX8A 1IXZA 2C95A 4M4SA 1U94A 2GCNA 3OIVA 3AH8A 4L16A 2RGAA 1TF2A 3RRNA 3K70B 5A5GA 1Y63A 2RHDA 3MUFA 121PA 3SFVA 2Y8EA 2JDIA 2ZRBA 4LK2A 1TQ6A 1VHLA 1YZTA 4CW7A 1C9KA 2UKDA 3Q9LA 4URYR 3K0CA 3BH6A 2PX3A 1EFRA 3W5IA 1QRAA 1T3LA 2IS2A 4FD2A 3ZJYA 1P73A 2BCJQ 4GMXA 1OH8A 2DFKB 2QPTA 4A15A 1XJQA 3AP1A 4HAWA 3U3RA 3KJHA 1NMZA 4KXFB 4B3GA 2ZQ5A 3AF2A 4IOKA 1GKUB 3EW9A 3KKNA 2Z5FA 3NWJA 3VNVA 3B8HA 3I3SR 3NDBB 1T3HA 1SXJC 4MKHA 3HWSA 3VMFA 3ZQ6A 3MGCA 2J7PA 2PCJA 3GLGA 3ZH9B 3LO5A 3QBTA 2GF0A 4TLBA 1S1CA 5EE0A 2GZHA 4QOSA 4DLTA 5JECA 2GTPA 2J0SA 1N6IA 1G4AE 1L8QA 1R0ZA 2ODEA 2ODBA 3MRSA 2IWHA 3PEYA 1W1WA 3VR1A 1DAEA 1HT2E 1US8B 1VG1A 3SI7A 2IS6A 1T6NA 2GDJA 2YJTD 2XSZA 2H5EA 2IYUA 2WVJA 5FL3A 4JLDA 4B43A 5IRCD 2J5XA 221PA 1P75A 3EAQA 3ADKA 1F60A 2F3RA 1JPJA 2B7BA 4V0NA 1RJ9B 1P9RA 4E09A 2ZAMA 5JMTA 4B35A 4B34A 2ZPTX 4PAOA 3GLIA 2D3WA 1QVAA 1TNDA 4IDOA 2WWYA 1RE0A 4KODA 5J40A 4DLRA 1SGWA 4L8GA 4P32A 2QRNA 1E6CA 4RJLA 4AK9A 2C9CA 3E1SA 2RGEA 4ITRC 2FFBA 1L4UA 3AKEA 2HT6A 1YU9A 4B75A 1LFDB 2GBLC 2XAUA 2ZI9A 3EXAA 3FDIA 3GLHA 3M1IA 4MITA 2WKRA 2CEAA 2ZI5A 2C96A 5KUTA 4O2RA 5BWMA 1LV7A 2FPKA 4YMUA 4OK3A 1TQ4A 4BZQA 3ASYA 1YZUA 1KGDA 2ZVQX 3OIUA 5GJBA 2CLSA 2V55B 2ZJ2A 3IO5A 1F5NA 3TH5A 1JBKA 4LV8B 5FBRB 4Z51A 2R6DA 2I4IA 1ZNZA 3K9LA 4LBVA 4XWKA 3H84A 3GJXC 4BASA 4Q18A 5E7JA 2AL7A 5IHPA 4HB0A 5EUQB 1G6OA 2CHQA 2CMKA 3EASA 3EPJA 3BC1A 3CPHA 1GP2A 5FR1A 3QUSA 4DWJA 3PV0A 3W6NA 4DRZA 1EESA 1FTSA 3PUWA 3NHBA 3WBKA 4GP6A 1W2GA 1ZM9A 2GA8A 1OV4A 3GJ7A 2J59A 4WW0A 1LTQA 1BYUA 3U6BA 4LUCA 4IXNA 5D3MA 1E2EA 2GEVA 5CB8A 4KU4A 2ZE7A 2ZS8A 4M1SA 4TYNA 1T3SA 1MV5A 1XXHA 1DTSA 3IILA 4LJAA 4R98A 1KO1A 4EPXA 4NCJA 4D80A 2V4ZA 4M1KA 3EX7C 1G1MA 4KI0A 4Q4JA 3VHXA 1KIMA 3BE4A 2QM7A 2NO7A 3AM1A 1DG1G 3GEIA 1DOAA 1L7VC 3IEUA 5L3RA 1ZUNB 2IL1A 1G291 2FN4A 2ZUCA 2KE5A 4URUR 5CDFA 2ZSFA 4KSCA 2ORVA 4JYCA 4LYAA 4QHTA 3GLFE 4Y0VA 4LRWA 4N0DA 1FQKA 3RRZA 1SXJD 1DE0A 2OG2A 4P4TA 4GT1A 1Z47A 2EW1A 1OIXA 2GAOA 1ZYUA 1FL9A 3B1WA 5F9FA 3QXSA 4O2LA 4Q7LA 1QF9A 1U0LA 3TQCA 4QM6A 3C15C 1OXTA 4M1TA 5E95A 3VU9B 3A36A 2O8DB 3CRW1 1P2SA 3CNNA 4GOKA 3AF0A 3EC1A 4QL3A 4KV9A 2O0HA 3VHLB 1ZP6A 3N2IA 1GKYA 1N5LA 2W6JD 1OB5A 3V9PA 2C5LA 3RHFA 5KSYA 1CP2A 4URXR 4PPQA 4AKHA 3LXXA 3EZ2A 5ANRB 1E0SA 3MMPA 4BLRA 3ADDA 2BMDA 1NSTA 4RD2A 1Z06A 1HE1C 4LOAA 4XVUA 4O25A 4PC1A 2GETA 2FPMA 4QNMA 4YLGA 2IYZA 4NU0A 3OE7A 4A6PA 2DB3A 1K6MA 1W0KD 3AVQA 1DG3A 4KFSA 2ERXA 1N6OA 2GEUA 2BOVA 2YWEA 3UMFA 3THOA 3TSZA 1VHTA 5HKKD 3LWNA 2BMFA 2QP3A 1LY1A 2G9NA 2OCAA 2KSQA 2D74A 3MAAC 1E98A 2QE7D 1CBUA 2PMKA 2QAGC 4D2IA 2UZ3A 5JRZA 3PEWA 1H65A 3F3YA 4BZXA 5H8WA 4O3MA 4NYMR 1XEXB 2XB4A 4M22A 2WPDD 4DLZA 2WTUA 2DHRA 3PUXA 2QTHA 4LC1A 4G01B 4WZAE 3PUZA 4JZKA 6Q21A 5JRJA 3L0SA 4HAUA 1KZGB 1E9DA 3OAAA 4G1UC 3KXLA 2WPDA 2NZJA 5DYIA 5EJEA 2IBMA 4TT3A 2Z83A 3I8SA 3QOFA 2WWWA 5E4FA 4E03A 2VP4A 1NP6A 4KFTA 5F2EA 5F9HA 1F48A 5KNCA 4PQRA 421PA 5FPYA 2XOKA 1FTNA 1M34E 2CDNA 4IVQA 1XD2A 4GPTA 1D2NA 5KOYA 2GJSA 3CIOA 4RKFA 4GP7A 1XEXA 1FOEB 1D6JA 1U8ZA 4Q47A 4C0SA 5LPNA 2WIBA 1P7CA 2P6UA 1I4LD 3GJ0A 1BIFA 3QXJA 4FXPA 3L8YA 4LHWA 1PJRA 3GLGE 1JXOA 4AYWA 4QBFA 2QNRA 1Z6YA 2AX4A 2YWGA 5J4LA 2ZU6A 5AWFC 1OYYA 1EX6A 2PEYA 4LJ5A 4DDTA 5KTYA 2JLYA 2NO9A 2IXEA 4F4CA 4QJ3A 3CRVA 4MUBA 3GD7A 1LS6A 1S2MA 3PQCA 3WMGA 2YWFA 4G5OA 5J47A 3IIKA 1Q3HA 2ZI7A 4DSOA 2C04A 2ZITA 2Z43A 2FDCA 5FI1B 1Q1ZA 3DL0A 2ZSAA 5C46F 1DS6A 1FMLA 2OSBA 2W6ID 4YONB 4EPYA 2WSSA 4S35A 1CIPA 4QJ4A 3WNBA 2DBYA 2IT1A 4OI1A 2WICA 4H1UA 2QU8A 2EYUA 4DCNA 2QT1A 3TNFA 3R7WA 5JZVA 5IT5A 4FMBB 3VU9A 4B76A 4Q00A 2ZRCA 1RKBA 4M9XA 2B8WA 4HB4A 2ZXUA 4UXJA 2V1UA 3VAAA 1M74A 5FTJA 1J8YF 2IYWA 2VL7A 4Z8XA 4CYMA 1C1YA 2GJ9A 1EG7A 2GZDA 4BFUA 1YR9A 1II0A 3HU2A 5FOSA 5FI0B 4C0BA 3MWJA 2AK3A 1E1RD 1ZCBA 5AUNB 4OI4A 3IQXA 2IA5A 4LI0A 3VKHA 1II8B 2F55A 2BKEA 4JIMA 1DO0A 2J41A 4OL0A 4JMPA 4QRHA 2O8CA 5C4GB 1IN5A 3A6PC 3KQLA 5DSZA 2JJ2A 1GAJA 1BYIA 5DHAA 3D7MA 1CJUC 3SYLA 4JLBA 3I92A 3REFA 4FI3C 3RANA 3T35A 2IW3A 2QAJA 1E2HA 1W4BA 5D3MB 1ZC4A 2VHQA 2ZJBA 5G3YA 5TXGA 1DAIA 1U90A 1B0UA 5FTNA 2Q3FA 1Z0IA 2E9SA 1T4GA 1IY1A 1WXQA 3TR0A 1Z0JA 1G21E 4Q9JA 3B6EA 3C14C 3RS4A 4URVR 4HUQB 4NHOA 2OFWA 3VR6A 1E2QA 4Q7KA 1T8UA 1S1MA 5CYPA 2WV9A 4DCUA 1JNYA 1QBKC 3ICEA 2OCPA 5CM9C 4KYIB 1NJGA 1T0JB 3AGQA 2REXB 1CRQA 1VYUA 2HCBA 1J8MF 1W36B 2O8BB 3OESA 1JR3A 2KJQA 3Q7PA 4UNNA 5CDFE 2ECKA 3C7KA 4L5BA 3TE6A 3ZZ0A 4CVNA 2J7PD 3Q85A 3TAHA 4QXAA 5LB2A 3EPLA 5HZKA 1SVLA 1W44A 1ZNYA 1FUUA 1SHKA 4JVNA 3K0CC 1SHZA 3GLHB 4TLEA 2BM0A 3ZLJA 1CU1A 1Z28A 2ZYWX 2V7QA 4BLSA 1NMYA 2OEPA 4NONA 2ZRHA 3HYRA 1RYFA 1S3GA 3TR5A 4TTRA 1YKSA 4G0NA 821PA 5KDDA 3AKCA 4QM7A 1S0UA 4AIIA 3QXCA 1IXSB 1G3RA 1N0VC 2CK3A 2KWIA 1KI7A 3CWZA 3BORA 5DISB 2FFAA 2WHXA 4BQSA 3LBIA 1N6NA 1ZM7A 3CR8A 2VSFA 4NZYA 3AUXA 4U00A 3ZDQA 4BGDA 4GRAA 1RZ3A 2P65A 5UKDA 1GL6A 1KJWA 1US8A 2JLQA 4B2PA 4ZV4A 3OEHD 1U8YA 3I8XA 4RFVA 2ZRJA 1KO8A 4ON9A 2C9YA 2X8AA 721PA 1GTVA 4LHXA 5ELXA 1V43A 4LHZA 2BBTA 2YZ2A 3ASZA 4B6FA 3GLGB 3LY5A 3SHFA 4DB4A 1DELA 1JJ7A 3BAFA 5JS8A 5FBLB 5AK0A 4DSTA 3AUYA 2FV8A 5FH9A 5DGXA 3ZVMA 4NPHA 2VHJA 2FG5A 4CEIA 4C7OB 1ZCAA 4N0EA 2IUUA 3L0OA 2FFHA 2VLIA 3W3AA 1A2KC 2NZ8A 3KXIA 2DYKA 2RAPA 3PEVA 2G83A 3NEYA 4RFSB 1DVRA 2VP2A 3WHLA 5DHFA 1G6HA 1OHHA 2GHIA 4JS0A 1XD9A 2NPFA 1Z0FA 2QTFA 3QXXA 4HEJA 1KK0A 3GFTA 1UAAA 3VX4A 3QG1A 3TSOA 1UBEA 4C0LA 3H86A 4LJYA 1YZKA 1JEDA 1U8AA 1G20E 4R9UC 2F1HA 4I4LA 1ZNWA 1ZNXA 3KQNA 4C4PA 1XFAA 2P5SA 3THXA 1U0HC 2EFCB 2ZE5A 3H0KA 3W5JA 3SJZA 1JI0A 1G5PA 2WWGA 3FVQA 3U4QB 3KB2A 2WJHA 4CDGA 3GLFB 2Q0HA 1LVGA 4KAXA 1AJEA 2ATVA 2L0XA 2OBNA 2ZE6A 4P31A 3B9PA 3ZVNA 1OXSC 2GJKA 5TV2A 2ZSDA 5FBVB 5DNYB 2ONKA 2OAQ1 2V1XA 3A58B 4LJ4A 1TQDA 4LZZA 3VKWA 5HKKA 5JCZA 3DMDA 1ZM4A 3KXKA 2ZS9A 1G8HA 1VYTA 3IKJA 3AVOA 4LBZA 2IYXA 4TYQA 1R0XA 4HLUA 4JJZA 1FUKA 3THWB 1X3SA 3CO5A 1MABB 1I2DA 1YR8A 4ARZB 4QG7A 2XB2A 4KLZA 3RWMB 3W6PA 1E2FA 1XMIA 1OIWA 1UDXA 2R6AA 3UWKA 3QI2A 4H9GA 2GKSA 1XPRA 1NY5A 2N42A 4IHQA 4NYMQ 1ZIOA 3VFDA 5FPTA 4MYHA 1Z08A 3IGFA 2FEOA 3NHAA 1R2QA 1IN7A 1ZIPA 1J2JA 4QFMA 4LPKA 2EU8A 4TMZA 3K0EA 3OEHA 2Q3HA 2YV5A 5FPSA 1W49A 3L0IB 3RSOA 4JJKA 2YOFA 4PHFA 3BJIC 3U6KA 3F5FA 2A5JA 3T1QA 2OV2A 3WXMA 2I3BA 1XXHE 3K53A 3TBKA 1PLLA 4UKDA 4TL7A 3GP8A 3P32A 3UK6A 3SNHA 3NBZC 3A1UA 4AD8A 1GNPA 2JASA 4LJ9A 2CK3D 5E3HA 4CEJB 3P4XA 1AA9A 1UEIA 2VH5R 4Q1AA 1G17A 5KHOC 1NN1A 2JJ8A 4ZKEA 3KTAB 3A1VA 1SKYB 4XVRA 3A1SA 2ZSBA 4NP6A 3LLUA 2R6GA 1UKZA 4PR0A 1QVRA 1KK3A 1TUEA 1TTTA 1OJLA 4TMVA 2WJGA 2GK6A 2NTYC 4JKYA 4D4JA 3TW8B 3SBEA 1GL9B 3WMEA 2PZEA 4MUAA 1UKVY 3DM9B 3TJZA 3WBJA 1E9SA 3A1TA 1ANKA 3GFPA 1X86B 4C0KA 2PL3A 1KMHB 3BERA 3G0HA 3FMFA 4NKRA 3BXZA 4PZYA 2P2LA 3NVAA 5IK2D 2I1QA 3T06B 2Z4RA 1WDTA 5JJIA 1G18A 3SZRA 3X1ZA 3IQWA 4P0TA 1TEXA 2O0KA 4A92A 1IN4A 1G5TA 2QUZA 2IYQA 3SJBA 5EXXA 2PLFA 4I1UA 3P27A 1VDZA 2OCYC 2J7KA 4KBFA 4G5RA 1ZRHA 1Z2AA 2QEQA 5HR5A 4UNPA 3NH9A 3ND9A 1U9IA 2FWRA 4MYUA 2W2XA 3QF4A 3M0EA 1BOFA 4PZLA 4B47A 4IDQA 2D06A 5BYJA 1R10A 1E79A 2OFOA 2WM9B 2IEZA 2QSZA 3T34A 4I1VA 1E99A 4WVFA 2QTVB 4U5XA 4A8JC 3DVLA 2BJWA 4G5SA 3Q7QA 3RDPA 2J87A 4HDQB 1KO4A 4PX9A 4ZIRB 1UKEA 2F3TA 2YC4C 1JR3E 3DKVA 3AP3A 4TMKA 5G41A 4IFEA 3TGPA 1W0JA 5JWOA 4Z1MA 4HAVA 4BEJA 1D2MA 1DAKA 2IYYA 3L43A 3WMFA 2RMKA 2NO1A 4Q9IA 3QKRB 1WP9A 3HP1A 4GMDA 1RRPA 3CH4B 4GSYA 4UNRA 3M4YA 1E69A 3T12A 4EFMA 1N3BA 1Z0DA 3QBVA 1NVWQ 3K9GA 4JVMA 1EFRD 2EWWA 3RC3A 4BLOA 1P2TA 5EP3A 4DXAA 5SZIA 2B92A 4V0MA 4TYWA 4DJTA 2GJAA 2JDID 1SVIA 3C16C 5AJVB 2V6IA 3MD0A 1Q1BA 4KFRA 3O8BA 4TLCA 3BB3A 5BN3A 1G8FA 4TL8A 2BBWA 1G8YA 3FMIA 1I4DD 4WA7A 2AKYA 5J5CA 1AS0A 1GZSA 2DY1A 5L3SB 3UPUA 2DFNA 2WJYA 4LCBA 1TF5A 4LSGA 2H57A 3F0TA 4CRWB 5KO2A 3EA0A 1GNRA 3X1WA 1Q21A 2F1RA 4JL6A 4TLAA 1OLOA 3OHMA 3T61A 4BLTA 4M2LA 4HUTA 4TQAA 1W7AA 1JJVA 1AQYA 1GKIA 4R2IA 2ZR0A 3B1ZA 2BMJA 1AS3A 4F93B 4GZLA 2G6BA 4LJ7A 2FSIA 3TMKA 2WSSD 1VPLA 1M7BA 1G19A 1W48A 2G0NA 2NOAA 2PCLA 1E32A 4M8NE 2WKPA 2DFLA 1Q20A 2HV8A 3LBNA 1R0WA 4Q48A 2ZRMA 4CZ2A 3FE2A 5FTLA 1Q12A 2QI9C 3T1VA 1UADA 4P4SB 5JBQA 1KKLA 1N0WA 5L3VA 2NMVA 2ZYVX 3CLVA 1UEJA 3DO6A 3OIYA 1R8QA 2IXGA 3WNCA 2EFEB 4EFNA 4AKGA 2QAGB 3PIRA 2P6NA 1EFHA 1X1SA 4Q4HA 3U7GA 4X8MA 5K8TA 3ZYCA 3UATA 5LD2C 2WMNB 2OHFA 3O8DA 4N3NA 1TMKA 3CUEF 2A5YB 1ESMA 1JPNA 3AKYA 4KITB 1HQYE 3MWYW 1MT0A 1XBTA 4NDZA 4PHGA 5A4JA 1EX7A 2QG6A 3IIMA 3QPWA 3Q72A 2O8FA 2FNAA 3RYTC 2BJVA 2VHTA 3PCRB 4KCGA 1UM8A 4MKFA 3NXSA 4JKIA 4D0GA 1A5TA 1GITA 2RH5A 3IPYA 2BDTA 1XTSA 2IUTA 4B71A 4D4KA 4HZUB 4W7SA 1E0KA 1X8JA 3W3ZB 1S9DA 1QHSA 4I1OA 2QQ0A 5KNBA 3EIHA 2NG1A 5FTKA 4HAXA 4HLCA 4C0AC 2GAAA 2PLRA 2ZU0C 4F91B 2J9RA 1RC8A 1DEKA 3FKSD 3EZFA 1IQPA 2W00A 5GADl 3FHOA 3N5CA 3RWOA 2X19A 2FZLA 4P4SA 3QQ5A 4PC7A 3QPVA 3ZVLA 3JVVA 2ZR9A 3X1DA 2AD5A 3NBXX 2ANBA 1LS1A 4ZDIA 2XZLA 3NG1A 4NYJQ 4MRSA 4PC3A 2IK8A 3Q5DA 1VCNA 4TSFA 5DN6A 3SEAA 2W2VA 2OFXA 3C41J 1YVDA 5CM8B 5CYOA 3CNLA 4LV5B 1HEIA 3OEEA 2QPOA 3G5UA 2RGNA 4M1OA 1W2HA 4YC7A 5AJXA 2CNWD 2W58A 1HT1E 4YDHB 2VSXA 1HH4A 4US0R 4JBXA 4JLMA 4DLXA 2HLDA 2B21A 1XNJA 4DT1B 4C0HA 2YKGA 2ZRDA 1E0JA 1WBBA 1KI6B 3SS8A 1GIAA 1KNQA 4IXMA 2P6RA 3DM5A 3LW8A 1R7RA 2W83A 1E2PA 2F43B 3GJ6A 3VR5A 3EWAA 4OQMA 5FOTA 5J4VA 1W4RA 2QPAA 3I32A 2B6HA 2YNMA 5G40A 4PO8A 3QG5A 1OFUX 3IPXA 3HU1A 2H92A 2ZYUX 4ZI3A 3HJNA 1VG0B 1NMXA 2EQBA 2MMGA 4ZPXA 2IXFA 2JLUA 3L2OB 2F7SA 2AWOA 2V54A 4LX0A
chains in the Genus database with same CATH superfamily
3PKIA 1CJKC 1P8JA 1VBFA 2PQ0A 1M2VB 3AEYA 1O9GA 4KQCA 5DXJA 3PS9A 4F71A 4PICA 1I5RA 2PANA 1WXGA 2BFBB 1DINA 3FCXA 1SXJB 3UMRA 1GGNA 2JGDA 2XDYA 3FYHA 4AS2A 5J23A 5CIYA 3O6VA 3H4IA 3EC2A 1LPAB 4ZU1X 3R44A 4I36A 3IOBA 3KQSA 3V8RA 4Z0TA 2VJPA 4II7A 4DWWA 2Q5IA 1F06A 3CW8X 2IUFA 3GVCA 3WRVA 1OYVA 1H2YA 4AJPA 1T91A 3TQFA 5LJIA 1K8ZB 4NV1A 3UHAA 5JSZB 3TRIA 1WCIB 4UJ3A 3PB3A 2G07A 3URKA 5IDVA 2ZJFA 3G0IA 4GMKA 4PQGA 5H83A 5IWCA 1L5HB 2RK4A 3GVIA 4MWDA 5F2OA 1T5IA 1U02A 1VFPA 2Z9BA 5THXA 3SQLA 3UC9A 3L8DA 2OBXA 1SVKA 2PVPA 1ODTC 2EQ5A 1JLRA 1VL0A 3LP8A 2X5KO 1BVUA 5LBUA 4AUKA 2QX8A 3H9EO 4U7DA 2NO0A 1QRUA 4CIVA 3NBFA 1JXMA 3VO8A 3IT1A 2XT0A 4TWZA 4RENA 3ID6C 4RKRA 4NBWA 4IVNA 3DPUA 1ZH6A 4RHUA 3K05A 4OY3A 2R4UA 4MVJP 4X7MA 5AXAA 5B53A 4JX9A 3OQHA 2EFGA 3NWBA 4LE0A 4C30A 3VKUA 5E6UB 1M54A 4G56A 1XEWX 4HWOA 5EP1A 1KMHA 2FUG1 3KJZA 3PD7A 3QFCA 3OCVA 4MAAA 5E4TA 3W0LB 1L9KA 5L7TA 3DLHA 2Q4BA 4ZVLA 1YE5A 3C1TA 3ZQKA 3KJGA 2XNDD 1EHYA 1ENYA 2HM7A 4OMUA 4B81A 4BKPA 4ZGGA 4XDHA 4DY6A 1JMYA 2VF8A 3LX5A 1N2EA 4G25A 2ZKIA 3GARA 4KBGA 2ICAA 2Q27A 1O95D 1WQ1R 1O54A 1XVAA 1YQUA 1VJ5A 2FSVC 2J09A 2JRLA 2VEDA 1HY3A 2YQ5A 3DFKA 3QVGB 3R5JA 4RVOA 5KYUB 3V00A 1ORWA 4U4AA 2J3HA 3GPIA 1G8JA 1U2RA 4ZOLF 4Q12A 2L42A 3GJ5A 4KPUA 4Q1DA 3V7YA 2LKDA 2FRDC 1D5WA 3C8UA 1TADA 5A71A 2Q0XA 3PGXA 5B57C 2E6UX 4GKKB 2DSTA 4BLUA 1EFTA 4MPRA 3MZ0A 2PZBA 2I62A 3W5CA 2DVMA 1OQAA 3DEHA 3OMXA 3B13B 1QP8A 3ZNPA 4EUKA 4TTQA 3WLFA 5A05A 2JGNA 2QT9A 2NP7A 1O9BA 3FNBA 3HU3A 4BVKA 4LYEA 1H5QA 5BV0A 1TEZA 3OMLA 4FS8A 2RHRA 2ZXFA 4XJSA 1UJ6A 1KJ8A 5JSUA 4CMIA 4XQEA 2VHVA 3AOGA 3U7HB 5FRDA 3UB4A 3GCGA 4AJNA 3HGTA 4Z4HA 2FX3A 4EGQA 3A1EA 3ETLA 3QITA 3ZBUA 4P22A 1WMAA 3HYCA 3QEBZ 3UHOA 4XASA 1EBFA 4PIMA 2Y1KA 5IARA 3BCUA 3TZHA 3EQ6A 4GYJA 1C1XB 2AF3C 5ED0A 2P9CA 5IK2A 4BRUA 2P3OA 3NHSA 3KB1A 3HUUA 2OHJA 3CX6A 5TB5A 4CUZA 3A6EA 4ER6A 2NP6A 1J99A 1SKQA 3LKBA 4ZVNA 2PLAA 5LWHA 2PO5A 1NGSA 3W7VA 2FW9A 3PCXA 1DO2A 3T5MA 5F3WB 1AK1A 3LFHA 1Y6QA 2W6MA 4QFBA 4P98A 1VCMA 2Q4TA 2EL7A 3RVNA 1CZUA 2FUG6 4FR2A 5THQA 4FGZA 3TKLA 4Z4IA 5F3RA 5ADWA 1G4HA 2AG8A 4PC2A 5JWRA 2FR0A 4CHGA 1JIUA 1W0JD 3DYIA 3IAFA 1AGRA 3DWIA 2NNLD 3GLFA 1VE5A 3GCWA 4JQSA 3TEJA 2O7SA 1XZ8A 1CR2A 4LHVA 4NRDA 2XXAB 4XQGA 4C14A 1XQ9A 2IYLD 2H6EA 2YY5A 1GSHA 3GH1A 1CRLA 3THYB 3PDCA 2HCJB 4BMXA 1MOZA 2FJUA 4P4LA 1FVHA 4V03A 3SNKA 1A8QA 3OE1A 1PJ8A 1KP9A 1XRSB 4L9WA 1SC4A 4X8HA 3UG7A 1U7UA 1OY1A 1EIWA 3KZKA 1PNOA 3M4ZA 4PTLA 4HOYA 3MSCA 1EG2A 3H3JA 3OU7A 2PG3A 1JJIA 1ZQ9A 4R1UA 1UMKA 2Y05A 4ROSA 1WMBA 5LYJB 5EOVA 1WAMA 4RMHA 1XCPA 3WYAA 1FNCA 1JDJA 2JD1A 1CEYA 1Q57A 4UTVA 5K8IA 1DIHA 3TUZC 4QQKA 5CEFA 2WE7A 2P4EA 2EEZA 5IM5A 4DJAA 5FUQA 2ENWA 5EJFA 1RWPA 3HR8A 4W7IA 5FTMA 1OKKD 5IYZF 4BKMA 1PX0A 1YI8A 2GESA 5HPYB 2FP3A 3DD5A 3E03A 4IOJA 3BD6A 2BTQA 3VR2A 3DAFA 1VLJA 2ZJ4A 3D4LA 3DHWC 3MS7A 2MSEB 2QRVB 3NOOA 1I14A 1MB4A 2GYYA 3AK4A 2ZIWB 2X9LA 4B3CA 2OC4A 3LUJA 2MSCB 3K1AB 1KERA 4MV6A 1JJFA 1N1GA 3ROPA 1RAFA 1YAJA 1GRVA 1RIFA 2CNOA 3B70A 3K9HA 3W3AD 3D64A 8GPBA 3ZHXA 5FJJA 1KKMA 2CUTA 3JQ8B 3KP1A 4MH0R 1AKNA 4YPVA 4Z49A 1T1RA 4ZCRA 4YUYA 1J2YA 3HFGA 1XROA 4RW0A 2H7XA 2VS1A 5AVRA 1M0EA 4DC0A 1W1UA 2ZWAA 1PAUA 3UV6A 5GGYA 2WVHA 1OV6A 2VTKA 2H4HA 4K6CA 3D6HA 4YMIA 4LDRA 4QWMA 5D87A 3YASA 4B3BA 1GTSA 4M6WA 3G59A 3WWCA 4HQNA 4ZAVA 2IS4A 2R2AA 1W75A 2W6JA 2RGCA 1QV9A 2HSZA 3Q5EA 4A0GA 2GNAA 3FFWA 5AKHA 3LZDA 2HRCA 3ITEA 4WPGA 2SNIE 2OZKA 4ZAGA 4YAIA 4OIMA 1H5NA 3SKXA 5IUKC 2OZEA 4JGBA 3W6ZA 4DLBA 2BSQA 4JSTA 3PC8A 1L5MA 1RFLA 2AMFA 1QS0A 4F6CA 1ADGA 4DM3A 4ETIA 4K9NA 3I52A 3H9QA 5DNAA 2VHUA 1N2IA 2J3JA 1VTKA 2GBCA 2O19A 3AM4A 1NF8A 5B30A 1IJFA 2FN7A 4M53A 3KYJB 3I6MA 4YXWA 4NU8X 4YI5A 3BSSA 1Z15A 2LW7A 1QH8B 2FFQA 2VT6A 4V0OA 3V4FA 5BNZA 1FF9A 3N2GB 3IMCA 1AK9A 2F1IA 4KKVA 4BDTA 2QP9X 4PSUA 4LYFA 3MWLA 4Q4AA 1IIRA 3SYRA 4BCCA 1DFHA 2HWYA 3ZCSA 1UP6A 4AYTA 3NWEA 4LF4B 4ZYVA 3L0YA 3Q9NA 2BRUA 1ESNA 1UBLS 1IY2A 1JQAA 1Z8DA 5JEEA 3AIOA 1F7UA 2B3TA 2CL0X 1UODA 3LK6A 3CUYA 4UNSA 5H02A 1JU4A 1GPKA 2PKQP 5AI5A 4LOJA 5CD1A 3ANYB 1RWWA 4PV7A 3PGMA 4EW1A 1DPGA 4XSHA 2P2NA 2CE2X 4MULA 2QVCA 2DT5A 3BFKA 3ILHA 3JQQA 1FVFA 5AK4A 3W1WA 3DMPA 4AMUA 1QZ3A 1VHDA 4RV4A 4BO4A 2X9VA 4COKA 4F96A 4W1RA 3R9XA 5EQJB 4JYZA 5K3OA 4R8LA 3IUNA 1ZL0A 4AKEA 3Q8MA 3BTVA 5JD5A 4AN0A 4E1BA 2I22A 1PZFA 1ISJA 2CXXA 2GXSA 1BHJA 3R3HA 1XVLA 1B8PA 1PKEA 2PSJA 1ADYA 5DPMA 4ESVA 3MOSA 4UPEA 1WMEA 4V3BA 1E4YA 3RIEA 5KOJA 3D6JA 1KSJA 1TUBB 3MBKA 3A04A 4KQXA 1QIDA 3KT0A 3COWA 4LWPA 4CCAA 1L5OA 2PZ8A 4P2GA 2E4AA 3VU3A 4M55A 2IHYA 1D2CA 2VXYA 4DCVA 2YVUA 1MR3F 4LF9B 1WSAA 1BU8A 1JNXX 4GBMA 4AULA 1NR7A 3ETEA 3LXRA 4D8TA 4ZC1A 1XTKA 4YRDA 5ARCA 5IAGA 3UGKA 4M0UA 5F98A 1KK2A 2A7QA 3DLAA 4FM9A 2NVOA 3N07A 2WUVA 2LKCA 2RHBA 4AS1A 1SQFA 4XLTA 4FINA 2IHNA 1N6LA 1XYVA 1T4BA 2W6QA 3E05A 3WYEA 2VCHA 3TI9A 5FQOA 2FW6A 3B2NA 3L05A 1NQUA 5ALXA 5CVTA 4DEXA 1T1IA 1IONA 1MU0A 2ZULA 4JEMA 5FULA 1F38A 1NLFA 5DWVA 3RKUA 4CF4A 3G2PA 2GCIA 4GZMA 5FEMA 1NMQA 2PN1A 2QJTA 5SV2A 3VPDA 4AP9A 3F5MA 1MN6A 2CEKA 1ABFA 5ALMA 1DRJA 3GUCA 3LG2A 1W5EA 3DTVA 1O3YA 2CVQA 3MCAA 3EVNA 4ZO8A 3H5LA 4QA9A 4B44A 5JTTA 1Z4NA 2GXQA 3NIWA 2ZS7A 3JAWA 1QIMA 1AO3A 3LQ2A 5D7BA 3UAVA 3OUUA 3CF2A 5KKNB 3L5KA 4RO0A 5AHOA 2GLXA 1XU9A 3OX1A 2FPIA 3TUJC 2D5CA 3NM6B 3G5AA 3ZCTA 2Y1LA 2WHPB 5I3ZA 3FJ1A 3HEMA 3KAKA 1G3QA 2RGNC 3T7CA 3PSHA 2Q6LA 1UJ4A 1JU3A 1P1IA 3WGGA 2VHZA 4A5OA 3UJCA 1WA5A 3HR7A 2Q3CA 4EW3A 4FWIB 5T64A 1XAJA 1NW5A 2WC1A 1C4KA 3PGVA 1BXRA 4QEZA 4WN9B 1W88A 3V9AA 2J3MA 3Q7SA 5TMPA 1CZLA 1E20A 4HRVA 3RUEA 3O2QB 4RD4A 2A14A 5DIFA 2DFDA 2BFWA 1EUDB 2JF0A 3N58A 1XEWY 2J6HA 2Z1NA 4N65A 1QV6A 1ULZA 3WLMA 1DTEA 4ZQHA 3E18A 1C0LA 2HA5A 4CG1A 3M6MD 1ZJJA 5B7GA 1KORA 1LNZA 2VJKA 3EB9A 4PGFA 4RK0A 1YRYE 3E61A 4ARAA 1FC0A 4D3XA 1HI9A 5AOVA 3F4KA 3LUBA 1R9GA 2AZMA 2E0IA 1C7JA 1IC6A 4MVXA 3ROXA 1X13A 3LY9A 3RS0A 4PG8A 1KI4A 1U8XX 4O63O 1B0ZA 1JR2A 2MR5A 1NNUA 1NULA 2HQ1A 4ZYWA 2MJLA 2H06A 2ILTA 1DIOB 3Q11A 1OI4A 2CXPA 5JG7A 3VNSA 2GCGA 1NVGA 1T8YA 4E30A 5DNEA 2W8BA 4ZYTA 1DP4A 2CFCA 2XRYA 1JH8A 1G3UA 2XVZA 4G5GA 5BW8A 4MA4A 2J3IA 4CI9A 3OTIA 2LNDA 2C0QA 3TB4A 4BFZA 2EG9A 3OPVA 3WJ7A 1YIOA 4D3YA 4E21A 4AZ0B 2JLSA 4Q9AA 2NU7B 1NLZA 1QCCA 3L3BA 1QHFA 1TUIA 4RKYA 3N3AC 1S96A 2NX2A 1Z5NA 3DEZA 3V2HA 3NWOA 4LQDA 5H4GA 1MXHA 5GVSA 1BDJA 4GL2A 3UC5A 3Q4GA 4MQEB 3D6NB 3K8OE 3WIVA 2PBRA 1R8SA 3TCNA 4NBSA 3CH5A 1CEXA 3VR4H 4E1AA 2I2CA 4HK4A 3DNFA 4WZBB 2HT1A 5G53C 1E6MA 2MT9A 5FXMA 1OOEA 1F2UA 1ZHHA 4D3FA 5EJ8A 6ABPA 2OVFA 3CRMA 2FLVA 5FBHA 3OZGA 3ENWA 4TUYB 3V1MA 3WFJA 5TMDA 3I23A 4N7JA 2CE7A 1TCAA 5FBWB 1LF5A 3OE4A 5A4IS 5HMMA 2PU5A 3LL7A 4GX1A 2Z6UA 3AM3A 5JFOA 2I03A 2IPAB 1PE0A 2FGJA 1EUDA 2JKYA 3WYCA 4AAYA 3EEBA 3GEMA 4UCXA 5CVEA 2R44A 4UHFA 3IVRA 1VHJA 1QOPB 5EHXA 2X5XA 4YJFB 4J07A 2GLUA 3OQVA 2R2GA 4GKVA 2HF8A 2HSGA 1XMPA 5JH7F 2H4JA 1Q0RA 1GUYA 2VWHA 4BP3A 1UMDB 4RQTA 3GEPA 1AKUA 4A82A 1SZCA 1CZHA 2FX5A 5K03A 1J07A 2AYXA 2Q9CA 3HEBA 1PBTA 2FPIB 4O1HA 2E3JA 1AQUA 4ZP1A 4OREX 1YQDA 2JFPA 1WCWA 3NHUA 4Q1CA 3UUWA 4F4IA 4ZYZA 1CY4A 3W8DA 3AY6A 4I2VA 1A95A 1LTKA 3NT2A 4FR0A 5FUVA 5LP6C 3W7BA 5IZCA 2N46A 2VYQA 2PA3A 3H9GA 1ZUD1 1QO0D 5BURA 2O4CA 4WFJA 5CAEB 2VDWA 3S1AA 2R66A 3LGSA 4FHGA 4N5LA 5F64A 1TIPA 1OX6A 3NJ8A 5HIAA 1GPDG 1LJUA 5I6DA 5JOQA 3BMOA 3O0DA 4KQIA 1C7EA 2V6BA 1OXBB 1U98A 4I1RA 4BTEA 5CB4F 4PYJA 1KEPA 4L73A 1A4XA 1U2TA 1YCDA 4I6EA 3HO1A 1Z36A 1GDDA 3BT7A 4M21A 1EFDN 1Q0PA 3CQ9A 4DWOA 1E61A 3B1VA 3WQQA 3U60B 4JHXA 4ETMA 4JUBA 1Z3IX 5DOVA 1GXSB 1V37A 1ZAKA 4S1VA 4YCSA 5AI6A 3H18A 2XZOA 4IG9A 4CFSA 1GRRA 1FRVA 3KLMX 2IITA 4MO2A 2JIMA 4YO8A 4CPDA 1M6VA 2I34A 3CV3A 4W63A 2XWPA 4XJVA 1OWLA 5HZGA 4HUJA 1BFDA 2G8NA 2QAIA 3RLIA 3W5HA 1QCZA 2X0DA 1HYHA 1LW6E 4FGKA 3PNBA 1L5RA 4EPWA 2X2FA 2BGTA 1Q91A 4YUZA 5ALOA 2BEJA 3FPLA 5B2FA 2AKAB 2ONZA 4R2KA 4YRCA 3SXUB 3MCWA 2CJPA 2I7XA 1TUBA 1E5QA 5CH3A 5EE3A 4ZO7A 2NPIA 2PGIA 5GY7A 3RREA 5HK9A 3VKFA 4RHCA 3VO9A 2QYTA 1PK9A 2X1HA 4QNRA 1QHHB 4ENUA 1PLJA 5EXSA 1CJVC 4GM1A 1B74A 4YRLA 3FI0A 2PBFA 2VYFA 3KYIB 5CX1A 3E3NA 4MI6A 4PYQA 1G42A 4FEYA 3T4XA 1I0ZA 2JFVA 1ZD8A 1P62B 3WNDA 3EFEA 4PZEA 4RVNA 2AZDA 3KEFA 3R7FA 1NUTA 3I0ZA 3L82B 1DT3A 3N28A 5J4KA 9LDTA 3EFBA 4B31A 2OK8A 2PH1A 2FSHA 3FVVA 2QUHA 1BKDR 3NDIA 1QQ7A 4KPFC 4PM4A 5A06A 3HJUA 4XTRA 4B80A 4TZTA 1Y0BA 4Q4AB 1J8VA 4LE1A 4R84A 1G1AA 2EVWX 1KI3A 3JVIA 4HQFA 2HMYB 2ZTMA 3PITA 5M2QA 1UZNA 3IVGA 2FEXA 2JJ1A 4NMWA 4BUJA 4G1MB 1FNNA 1YVRA 1XHEA 2I4TA 4DYVA 5HJ2A 1E0AA 3ZI0A 2ZQYA 5EZYF 3TEFA 1SB8A 1P4HA 3E5NA 2X13A 3DP7A 5FBQB 2IHKA 1XK7A 5F78A 3IURA 1QYIA 1XLTC 3CLSC 1ODFA 3IUSA 4YJKA 1QS0B 1L4LA 3EUAA 2OYRA 5AW3A 1QFYA 3T94A 3IKMB 1RLTA 4A0RA 5JS6A 1MMFB 2NUTB 2QUAA 2YHUA 1VYVA 3COZA 4UTPA 3I1FA 1JHXA 3JD4A 1TIBA 1I1NA 3X2FA 1JIJA 1PEYA 5DLQC 4G4IA 3UHPA 4D0RA 3QNUA 5AVWA 2QYSA 3ZOZA 2NACA 3HWWA 4ND2A 3NNNA 1RKQA 3WKBA 3F67A 5J59A 1XA0A 5JAMA 3K8QA 2CYBA 1XRNA 1U0EA 4JIGA 5JNTA 2E4ZA 1UL1X 3DMYA 3DKKA 2PX4A 1K7SN 4BFVA 2PZGA 5J2UB 1AK2A 3D02A 2A1IA 3D3JA 3MOGA 4K3UA 2ZJ6A 2GSWA 4OTZA 4GOMD 3QZUA 2QRZA 2FZ4A 5LZ7A 4X8LA 4MLCA 5B4TA 3HC7A 3W5SA 4ZRNA 4Y2HA 2KQUA 2QR3A 3EXFA 3FZQA 1XCBA 4FE7A 1FQOA 2OG1A 4EGJA 9MHTA 3EDQA 1MPTA 3IDAA 3K1AA 4MKIA 1ONNA 1DKOA 1JQBA 3J81A 3K9FC 2REOA 1L3BA 2QUJA 3N8HA 3CW9A 2R00A 1DAFA 3CZ9A 2C98A 3D0OA 1PQUA 3EDMA 4K40A 4NECA 4YJGA 4ZCMA 2ON6A 4BLWA 3CN9A 2BTQB 1PHPA 3F1LA 1CS4C 1KR2A 5GZ1A 1Z16A 1LQ2A 2P90A 2UVDA 1RHJA 4R2LA 1X3LA 2ONYA 1BDMA 2Y9PB 2I99A 1P5FA 5IFKA 1XCGB 4II3A 3IRUA 4OHPA 3OTWA 3UMJA 1Z82A 3DO5A 4RJKA 3DPIA 2EP7A 4BZPA 1KA9H 3WGUA 4A0FA 1U1EA 1XD8A 3GBSA 4WX2B 2GF9A 2NZXA 1W46A 4NTZA 1P5HA 1CQJB 4MVCA 5EZSA 2RIPA 3KELA 1LB1B 3WJ2A 3K9NA 1G8GA 1JDBB 3JX9A 4LQLA 4NMMA 4EEZA 4N7BA 3O2JA 2PSEA 3D5EA 3HXMA 3PWKA 1DKMA 4P35A 4NU5A 5HZHA 3UFBA 4MVWA 3EG9A 4MROA 1TLTA 2CL7X 1JAIA 3DONA 3THYA 3G23A 4G67A 3RYFA 3UUEA 1NAIA 3CW2A 1NNEA 1K7YA 5T8KC 4FFPA 5HDBB 1ZVQA 2XXAA 1RJDA 2AB0A 1CDEA 4QHYA 2DPYA 3E7DA 5A3SA 3CXUA 3IDQA 1FBTA 2ZUDA 3AZPA 4XX0A 3O8RA 3ANMA 3U13A 3FBGA 4JWTA 1XQ1A 1GQQA 1M33A 5IVKA 1H8HA 3P0RA 3AOEA 3WLHA 2ZDHA 4NBTA 2Z58A 2HD4A 1T35A 4ND1A 1NFFA 3KJEA 3X1MA 2ZJZA 1TJNA 3O1JC 3EVZA 5BSWA 1WKVA 3AUFA 3D6FA 1S6YA 1SCUB 4G9BA 4CLOB 2P91A 2HX1A 1DIGA 1Z6TA 2J6CA 2VPYA 3OZXA 2HF2A 4KJZA 1VSBA 2OOKA 4W4TA 2F1OA 1XO1A 4F86A 1Q50A 1A7KA 3MINB 5C7YA 1M0WA 4CIYA 3KOZA 2HY7A 5JI2E 5YASA 1MIHA 4A6XA 4Y1EA 2K87A 1W5BA 3H3FA 1OROA 2OZPA 3N70A 3QVSA 5TEWA 4QOEA 1R6DA 3AV3A 1HURA 2OB1A 2ZZNA 5C1OA 1F1JA 2JVIA 2MSKA 1Z4QA 1UBSB 1ZGHA 4G4GA 3JQ7A 1F2TA 5INTA 3DE0X 5CLIA 4IWYA 5DW3A 1G16A 1Y4DE 1SWWA 4QTZA 3ZIDA 1WTCA 5JANA 1F6WA 1XDBA 1GN9A 2IYRA 5BQ5A 2YBDA 4C3OB 3AWDA 3EISA 5FDFA 2ECFA 1QNFA 2B4TO 2OCLA 3T1OA 4CIXA 2H07A 4WLFA 2R8OA 3LL4A 4QU5A 2V3WA 1FFEA 4JWKA 4YCBA 5F4BA 1SQ6A 1GR1A 3N0WA 3H5AA 4IKEA 4V0LA 3SXPA 1I2CA 1ZOOA 4M7PA 4R71A 1G5IA 2C8VA 2P0YA 1G9XA 4FFRA 4QDJA 4QODA 3WQRA 1PJ4A 1TW2A 2G72A 5M04A 2Y4OA 3SZGA 1E2MA 3TOVA 1YJQA 4IYJA 1YVUA 5FAKA 3KKPA 5HJ7A 1F4VA 3PHBE 4IIFA 4YUWA 4GKBA 1CC1S 1OAOC 1V11A 2CLDX 4P5EA 3PQ4A 1UANA 2IV7A 3JWGA 2ZVJA 1BDIA 3DBHB 1WV1A 5IYZB 2Z5GA 1VXRA 3ZQ4A 4K9LA 1KI9A 1MDBA 2OV6A 3LYAA 4FDLA 4IHJA 1KS2A 1MJGA 2B98A 4AJIA 2HWXA 3CZQA 5ITZA 4D9JA 4RLQA 4N76A 1COWD 1R9JA 1V8ZA 3PNPA 4QQNA 3LVRE 3IODA 3AIMA 1RWXA 3KS9A 3MS2A 1E6LA 2IH2A 1UP4A 1UPCA 5LLTA 1DLJA 1IB0A 2I8CA 1AUOA 1LLFA 2C5GA 3M81A 4TS9A 4V38A 3U3KA 5IJ0B 2AG1A 1Z73A 2H54A 5C37A 3IEMA 4XWTA 4Q3AA 1VZ3A 3IJRA 3WSWA 4LDAA 2QORA 1H85A 3ZG6A 4DSAA 4M1YA 1JHOA 4D9CA 2E4VA 4YRNA 1JH9A 2IU3A 4TTJA 1C30A 3C43A 2J6BA 1SU4A 3RU2A 4CLRB 5JHGB 3GHHA 3ZN2A 1TA0A 5KYWB 2R65A 5CPBA 1LRKA 4WUVA 2V45A 4JEHA 4ZVKA 2B5VA 3MG9A 3FN4A 1E92A 1VL8A 4UHCA 3BWXA 2VSQA 1XGKA 2IODA 3AI1A 3IKVA 2QZ4A 1PSWA 2C5AA 1P5RA 3LIPA 4ZODA 5E8RA 3AHFA 4IDHA 2ZIEA 2A6PA 2XUKA 3MMZA 2Z8YA 1Q0LA 2FPOA 2DQZA 2G67A 3S5JA 5EIWA 2PUFA 3K96A 1DAGA 4DLSA 5JSZA 3AR2A 2XUZA 4KNVA 4MWEA 4A4DA 1K7FB 3G2QA 1IOZA 3JWJA 1CUJA 4LVUA 3BB1A 3M1YA 1JQKA 3C3XA 4I9NA 1RHMA 5KSPA 3WK7A 5EJ7A 1M2OB 1WUHS 2E7ZA 1U8TA 4OFZA 1N8NA 1D8AA 3DW3X 3JPYA 3DTYA 1GSIA 2B7LA 2CLMB 2CSUA 3QXHA 1JKJB 1U31A 2CV1A 5ILQA 3UJ6A 2BFBA 3V4VB 4D92A 4PQFA 4BBAA 5TT0A 5CBPA 1D4OA 5IH7A 1NBME 3MM4A 2ALJA 3HPRA 4X1IB 1EWRA 3BGVA 2WIAA 2EIXA 3D0RA 1PR2A 5C7IO 1KTVA 4Z0NA 4KR7A 5CIQA 1U8CB 4ITUA 4A8JA 1X7WA 5JCPA 3PXCX 2NU8A 3A6GA 3PR1A 1F3OA 4AFNA 4RQAA 3JWHA 1IDOA 1FW8A 2ZE8A 3EBLA 4ZJYA 2VYND 4OATA 5EN4A 2ARKA 1TVMA 3TXAA 1PFKA 3WSVA 4CQJA 3ADBA 2HWUA 3G49A 4J0JA 4BEWA 2H4WA 4K28A 1A8IA 3WWPA 1U9IC 4CM4B 2GZAA 4RY2A 4B3IA 1L4GA 1T9GR 1KI6A 3BE8A 3MEQA 1JXAA 3MCZA 3GGGA 3R09A 3NHYA 4L4XA 5BSEA 3MWFA 2HLHA 1PR6A 4YEDA 4TRJA 4KVFA 4EHKA 4F5WA 2QZPA 3D5TA 4FGWA 4R6WA 4RLFA 4TYPA 2FU5C 4IPTA 4NABA 5I9LA 4XWWA 4J1TA 3NANA 4AYXA 1JA1A 2V7PA 2FDRA 1W85A 4RKEA 5JMOA 3RFTA 4H27A 1PGNA 5AJWA 2R6HA 4HB2A 1ISIA 2BEVB 3QFRA 3ZD6A 1FXWF 3KJXA 1WOYA 3DBLA 2GPWA 3DUFB 5IT0A 5IKXA 3IKTA 4EB6A 3FHLA 3ZZTA 5KJ6A 2DBZA 1KDTA 3Q88A 2AN5A 4BTVA 1MAHA 1XRMA 3KAJA 3K1ZA 3TOXA 1ECCA 1X80A 5D51S 3HDYA 2F3UA 3KVVA 3ED5A 3HZHA 1XKQA 4KFCA 1XTVA 2HPZA 3O8LA 4N6OA 3KSMA 4B6JA 5U1PA 1KAGA 1HA3A 4ARCA 3R3VA 2ID8A 2ZPAA 4TGLA 1ICIA 3Q40A 4EABA 3NBYC 4FLEA 1SZJG 1FSPA 2A0FA 2AFIB 3CUWA 3O82A 3CF6R 2AD1A 5ILOA 5JZOA 4XIGS 3C5WP 3KV1A 1W34A 1K97A 4HYEA 1XZNA 4MWSA 5AKKA 1G21A 5EWLA 1ZEJA 3F73A 1HRKA 3CRNA 3O2NA 1PL6A 3B36A 3H1PA 1AT1A 1KAQA 3JD1A 3E8SA 1U7WA 4MB2A 5KHAA 2W4MA 3GLTA 3RIHA 2FWJA 3GNSA 2PKYX 1CVRA 2VKTA 3RO7A 2PWZA 2FJPA 3DF9A 4EYSA 1KHTA 1P33A 3HZZA 1QM5A 3AJ9A 4QYIA 3GJ8A 1P31A 1YD7A 4QUBA 3STVA 4Q3BA 4UXHA 1BU5A 2R5NA 4AJEA 2P7HA 4HGNA 1YV9A 4ZO4A 3R8FA 1VG9B 2NYVA 3K8ZA 2VQ6A 3LLVA 3J80A 3CVYA 3D2CA 3UYKA 1GL7A 1CQIA 4M87A 3HP7A 4TYYA 1IHXA 3PR2B 4W5QA 4BQOA 4HYYA 3UAYA 1RMYA 2VF5X 4F6RA 1Z0KA 1XZJA 4NH0A 1TJ5A 3LW7A 1U65A 3IRVA 3RF6A 4Y67A 1HKUA 1LF0A 4CDNA 1Z6GA 4EJSB 2KB0A 4KDRA 1BX0A 1IU9A 3BDVA 5D2CA 1E7MA 1UBRS 4OXQA 5KINB 1RYDA 1I1OA 2EKPA 2WD9A 5FD8A 4JOSA 4X91A 5CA1A 3B5EA 1EDBA 4RD3A 5JY6A 3HGMA 4YPFA 4CGZA 2A5GA 1OREA 5C34B 1I94B 2WTMA 1V1JA 1EVEA 1TZJA 3NPAA 2WAXA 3W9UA 2JLRA 2C3UA 3I2KA 1S8OA 3SU8A 1VP3A 5AIAA 1BS1A 2RK3A 3UMSA 2C59A 1HLDA 1GPYA 3T7TA 1PJ2A 5EZ5A 2G9VA 3SJCA 4DV0B 4BC0A 5A9SA 2W43A 2AXEA 3IQIX 5IKOA 1SVMA 3ZWPA 2FXVA 3AGPA 3WFIA 1BCSA 1SM4A 2RG7A 1NU6A 2R79A 4KEAA 3RNLA 4HAZA 3WGYA 1CWUA 4MEAA 2P79A 3QMWA 1N3IA 3T5BA 1VE7A 2X7XA 1U0RA 3OZFA 5BVGA 2HDOA 4J49A 3FNGA 1SUCA 1FMJA 2HBYA 3ZVRA 2G1AA 3S8YA 3M49A 4IXTA 2OXTA 4FNMA 2N75A 5IU6A 3OAAD 4EMUA 3JQCA 1E2LA 3U0BA 5H1YA 2D7DA 1ZPDA 2G0TA 3USZA 1J2EA 4L9AA 1J2TA 3AJDA 4G37A 5FR2A 2H4XA 3R9IA 2WKQA 5EQFA 3TBFA 4BCDA 1YQTA 4IV8A 2QRHA 1E3WA 3LWZA 1OF1A 5LR6A 1Z17A 5DRTA 2A9KA 3Q1LA 4MGEA 5E3IA 2FK8A 5C2JB 1UAGA 5KYTA 1VLVA 3NVKI 5CLQA 1QK5A 3SHVA 4GOND 3PNMA 4X6YA 1GKLA 1ZD9A 4TV9B 4C1NA 3PVZA 4EPVA 1QIGA 3OT1B 4INAA 3ZHYA 4P3OA 1WU7A 4DEYA 2CCKA 2FPLA 4INJA 3NCHA 4BEBA 2UZIR 4BKUA 3JWEA 4ZIRA 3GWZA 2GFIA 4HH3C 4QDXA 4MS1B 3KKOA 3G85A 1PS9A 3P8ZA 4X41A 5CLHA 5F4ZA 5LWQA 4XGKA 1GL3A 3JR3A 1EP2B 3MJHA 3LDUA 4J4TA 2ZWMA 1RSZA 2IEBA 3A2NA 4PNEA 1R4NA 3CZPA 1MB3A 3E9QA 1YI0A 3S99A 1CXZA 3B1XA 2C97A 1YDFA 2H31A 1R37A 3DVQX 4MKGA 4BLPA 1NZDA 2ZWPA 1TK3A 4H3HB 4NFLA 4UM9D 2X76A 4M0PA 1EXVA 1DI0A 3W2TA 1KO5A 2BUCA 4PHCA 4BFLA 3D8BA 2IJGX 3ENNA 3FHTA 4E2FA 1VL1A 3HGQA 4LV6A 4XXHA 4U7FA 1ORVA 5DE3A 3RRYA 3VOAA 2R6CA 3Q9SA 4H0NA 3AHEA 4G5YA 1ZC3A 3U5ZB 3AR3A 3VPXA 3DFFA 4P86A 2C2ZA 1TL7C 4IFIA 1E96A 2BIFA 2VJLA 3CVJA 4JA2A 1Y8ZA 1CYEA 1WB6A 1T4MA 1VG8A 2VOJA 4RLSA 2JGMA 3QPDA 4BEVA 2IBTA 4B2IA 4PHHA 6PFKA 4QC2A 3DZCA 1P2DA 4MVYA 2FETA 2FE1A 3UWOA 3BKXA 4XD7A 3BA6A 4DREA 3ABRB 4EGCB 3DC7A 3IVAA 2FI1A 7REQB 3IPAA 4GLJA 2XOKD 1IN6A 4N0PA 2CT8A 4A2QA 1BVHA 1JWBB 3RVBA 5BWLA 1UK9A 3E8XA 3OLXA 5KC9A 2HHLA 3H5OA 3D6AA 4IDNA 4L8WB 2JJYA 3R5TA 1J1IA 4K7JA 1P2GA 4NCIA 3U9LA 3IMGA 4JLAA 4TMFA 5C51B 2ZM6B 2WI8A 1HO3A 4YP7A 1UC8A 4HBGA 2OPBA 3E9MA 5LNK1 2Z6QA 1HTWA 2AMVA 3R5XA 4XWAA 4MCJA 1GGVA 1JBEA 2VBCA 4UVIA 3BD9A 3A0RB 1AGPA 1GUZA 1KEWA 2WWIA 4KX5A 5GQSA 3DV2A 3BE5A 5BRJA 1L7EA 3MGGA 1A4UA 3CU5A 3VDNB 2CJWA 3EDRA 3VVBA 4E5PA 2YHSA 5A3RA 4GPAA 3F7NA 4UMEA 3S2SA 5JR3A 1NI3A 4AUEA 4L2IA 3GPLA 1R0SA 1KJZA 2JCSA 5B1EA 3I37X 2CYAA 3VOTA 1D2HA 3LKZA 1P2VA 2EP5A 3A10A 4HGPA 2P11A 4RL4A 4DLVA 2V3VA 4FONA 4Q21A 1NTOA 4LXXA 1AKWA 2HFKA 4MR9B 4PSVA 1E7SA 2CCGA 4M46A 3MRVA 4PXSA 1NM5A 1T6ZA 4IM7A 5F2KA 3WDLA 5I7SA 1AKQA 1OC2A 1YJAA 3ETJA 4HLNA 3TMYA 3THWA 3UWMA 2I1LA 3BICA 3MQFA 1BE1A 2C8KA 4TWJA 2PYDA 3KB8A 3UG6A 1NLYA 2ADFA 1I9CA 3RARA 3GEHA 4UMFA 2CXQA 3I42A 5ALSA 3C3AA 2HQOA 1KBZA 3QKUA 3QJ5A 3ONEA 3ZDZB 4LZNA 4RTMA 2W2OA 3ANLA 1QLHA 3L0BA 4IIJA 4F38A 1BCRA 4JB2A 5CU7A 3U7JA 4FX5A 1U3FA 4HDMB 2VBFA 3RS2A 4F12A 1TDJA 3HKCB 4ZJZA 2Q9AA 2Y1WA 4LXQA 3OZWA 3C8DA 4CEHA 3MSXA 4R81A 2M2IA 4BMPB 4X1YB 2VRWA 4PLTA 3GP3A 2PUCA 1K92A 4IKPA 2DM6A 4G89A 2PMWB 1G3MA 3BS4A 4O4JB 1JVNA 5HF8A 3UB2A 5BYAA 3CVUA 2YW2A 2B20A 3EEIA 3JYLA 1NSFA 2CVHA 3I09A 4MMYB 1IXZA 1Z2PX 2C95A 1U94A 1JEQB 2MHCA 1QO7A 2RAUA 3RRNA 5A5GA 4ND3A 121PA 3O3MB 2Y8EA 2ZRBA 5I7EA 5CVDA 2B61A 2H9IA 1OGYA 3DJFA 4LK2A 1ECGA 3X1JA 4EHIA 5G1OA 4HP8A 1UMBB 2UKDA 2VK8A 1E5LA 5JBIA 4IJVA 2P35A 3JARB 5F51A 7MDHA 2ETVA 1AMUA 2XMDA 5JADA 2DFKB 4A15A 2HNKA 5ECYA 4JI6B 3HSSA 2O5EA 1RHQA 4OHKA 3CB2A 3E4CA 4NE9A 4RLHA 1G2IA 5K09A 1EA7A 4RVFA 5L4LA 3AF2A 3Q8WA 4IOKA 4JQYA 1I5OA 3C3KA 1VPDA 3KYDB 2Z5FA 3VNVA 3STXA 5K4GA 2R7AA 3HCDA 3VMFA 4ZZ1A 1T5HX 3BM5A 2J7PA 2WU8A 4KREA 2BAGA 1J0XO 1DZ3A 2GZHA 1AQIA 4ZALA 5JECA 3C7AA 5ADHA 3D3WB 4KPYA 3I9NA 3UB3A 1MORA 4LHSA 2R97A 2RCYA 3DVAA 1N6IA 1L8QA 3ITDA 2PGDA 2GPJA 2H1VA 4R31A 3GAFA 2IW1A