4GBMA

Sulfotransferase domain from the curacin biosynthetic pathway
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SRLPGIIFILSSPRSGSTLLRVMLAGHSSLFSPPELHLLPFNTMKERQEQLNLSYLGEGLQKTFMEVKNLDATASQALIKDLESQNLSIQQVYGMLQENIAPRLLVDKSPTYAMEPTILERGEALFANSKYIYLVRHPYSVIESFVRMRMQKLVGLGEENPYRVAEQVWAKSNQNILNFLSQLEPERQHQIRYEDLVKKPQQVLSQLCDFLNVPFEPELLQPYQGDRMTGGVHAASLSISDPNFLKHNTIDESLADKWKTIQLPYPLKSETQRIASQLSYELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurM Sulfotransferase
publication title Structural basis of functional group activation by sulfotransferases in complex metabolic pathways.
pubmed doi rcsb
source organism Moorea producta
molecule tags Transferase
total genus 101
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gbmA00
5EE9A 1W5TA 1EFUA 2Z4SA 2GA8A 2NPIA 3I3SR 3TK1A 2JJ1D 2ZI3A 4BZXA 4D4KA 1MR3F 4KLNA 4LJ4A 2RCNA 2D2FA 1T0HB 4W5JA 2VH5R 1PVOA 5DYGA 3AEZA 1LV7A 4JVNA 3BBPA 4Z54A 4IJMA 3TRFA 1F3OA 1UBEA 4C0JA 1A2BA 3P1JA 2ZSEA 2N1BA 1B23P 4W9MC 4KFUA 1KZGB 1RRPA 2OILA 2Z6VA 4PAQA 4ZIRA 1MABB 2E87A 1GNQA 2RHMA 2RGCA 4PC6A 2O8DB 4YC7A 4NU0A 5BN3A 3TVTA 4LBYA 3BERA 2XOKD 4DDUA 5J40A 3OE7D 2XGJA 3CRVA 1AKEA 1P4SA 1NN5A 1NNEA 3KL4A 2G1JA 3ZVRA 1HQYE 2WWYA 2H5EA 4ILEA 3QVVA 4J0QA 2GVZC 3T34A 4DRZA 3NEYA 4V02A 1PUJA 1RW4A 1FFHA 1ZNZA 2QEQA 4JLOA 2AXPA 2HXYA 2GRJA 1Z0DA 3BC1A 4OQXA 4QHYA 2FZ4A 1V43A 1Q57A 1G7RA 1CR1A 2FZLA 3QPWA 3ZJYA 4ASUA 3MGCA 3C16C 3BFVA 4HUQB 1BIFA 2JAQA 5J5CA 3U3OA 1GRQA 2O0KA 4RZUA 3IHLA 4PZYA 2AR7A 3D8BA 1SXJC 2IXFA 4U00A 2B21A 1ZNYA 1EK0A 2ZR0A 1OIXA 4LJYA 4C0LA 4BEJA 4I99A 3PQCA 4TMKA 1GDDA 3CM0A 3ASZA 1HT2E 4IVRA 2QUZA 1G64A 1XJCA 1DAEA 1ZC3A 4GOKA 3MAAC 2ZRGA 4GDFA 1QHHA 3LLMA 4OK3A 4DDVA 3B6EA 4XOIA 3K53A 3AF4A 3S1AB 3T15A 2VEDA 1DADA 2ZSBA 5JSZA 3T5GA 4ITRC 1N0WA 1NIJA 1OYWA 4KV9A 2RGXA 4TMVA 4OI0A 1NIPA 2ZU6A 4HDOB 2QTVB 5AUOB 4OK5A 5KO2A 3LWNA 3N5CA 4O2RA 1X1RA 1NF3A 3GJ6A 3A36A 2LWIA 4URWR 5EXSA 2ODNA 1CRQA 4I1UA 2EU8A 3L43A 5AJVB 2WIAA 4XWOA 3H1TA 5FPYA 1C1YA 3DMDA 3D6TB 4PPFA 3CX8A 4JYBA 5TY0A 4JVSB 4ASUD 2DBYA 2DCUA 2CXXA 4IOKA 3KQLA 1KMHB 3HR7A 1GIAA 4Q66C 3VR6A 2XJ4A 2ZI6A 4Q21A 1XBTA 4LV8B 3ZS9A 1W49A 2J87A 4NMMA 1XF9A 2GXSA 1JPJA 2VLIA 3C5CA 3P26A 3QENA 1GKIA 3AKDA 1FPMA 4CEIB 3WHKA 5IK2A 4MH0R 1KKMA 2ORWA 3Q9LA 4RCYA 1G7SA 4DLXA 2JLQA 4B3CA 4JL6A 2WTUA 5CIWA 5GADl 4IXMA 4PAMA 3GLGB 1TF5A 4FMDF 4BGDA 1J70A 1OFUX 4MRSA 3GLIA 2MSDB 2NGRA 2G77B 1M7BA 2R44A 2VF8A 1E2FA 3LX8A 3K09A 3REGA 3U6KA 5CYOA 3ICEA 5CB8A 1ANKA 5KSYA 3TQFA 2IYLD 1U8ZA 4ZDJA 1ZCAA 2HJGA 1ZU5A 5E7JA 3OIWA 3LNCA 1ZD8A 3SOPA 3B2EA 2V7QA 2Z83A 2BC9A 4PC2A 1RRCA 1QVRA 1OXSC 2GJ8A 4V0OA 1U2RA 3N70A 2ZJOA 5EP1A 3IPYA 2ZE6A 4JMPA 2F3TA 1OH5A 4A2QA 4OYHA 2Q3MA 4LOAA 1AGRA 3UG7A 1Z6GA 3IEVA 1G8FA 3B1ZA 2WWWA 3Q5EA 5C2JB 3CB4A 2FSGA 1Q1EA 4JLNA 1W5SA 2HYDA 4E09A 1RRFA 1NN1A 4IOLA 4KCGA 1UF9A 2J0SA 2IS6A 3WRXC 3FB4A 3IBGA 2RMKA 1BOFA 2OFWA 2IYYA 1KI3A 1XCPA 3KFVA 3NKVA 3DMNA 2PCJA 3CR7A 3MWYW 1P2TA 3EPKA 2DFLA 1Z0JA 1EFRA 2VHUA 1FQJA 3LXRA 5TMPA 1CP2A 4OHWA 4K8OA 2PEZA 2VP0A 1TPZA 5G3YA 1RE0A 2QM8A 4RJLA 1L4UA 5GJBA 4C7OB 1M74A 5FOVA 4P31A 4TYWA 3I92A 4OK6A 3C14C 4PSKA 3AH8A 4ERNA 3SQWA 1FNNA 4TL9A 1G17A 4D81A 3F8TA 4W5HA 2V7QD 4LJ9A 2V9PA 4JJZA 4LSGA 2PX0A 1P9NA 1KSHA 4AYXA 5LPNA 1KIMA 4WW0A 4B3XA 1N0VC 1NVUQ 2RHDA 2ZYUX 4LHYA 3FOZA 3UWOA 4IOMA 4A1FA 1LVGA 3OHMA 3R9XA 1E2IA 3PEUA 1UM8A 3LAWA 1G20E 2GTPA 3LDAA 4YMTA 1SKYE 2YOGA 2YYZA 3X1YA 1YRBA 4WAUA 2A5GA 4QG7A 3CNOA 2OFXA 3W6OA 4NKRA 2ERXA 3L8YA 1Z28A 2YHSA 2O8DA 3ZVNA 1IXZA 1SGWA 4Q9JA 4N3NA 3TSOA 4DEXA 2GEVA 2FG5A 4V03A 1AIPA 1ZNXA 3EPJA 4PPQA 1MRNA 5EP3A 1J2JA 1XCMA 2IYXA 4TTQA 5G53C 2CHVA 5FPSA 1R10A 2VTKA 3I72A 2IYSA 5HZKA 1TAGA 2H17A 1NSFA 2PBRA 4DEYA 4PTLA 4MDEA 4LUCA 4BFTA 3KKPA 4C3ZA 4A8JB 1DPFA 2IUUA 2WPDA 3NXSA 4KBFA 3A4MA 2DFNA 1LS1A 4AURA 4HUQA 2R6GA 4LDJA 1S1CA 2D06A 3ZD6A 1HURA 2AD1A 5JCPA 3JZAA 1DAGA 1KOFA 2BOVA 3QXCA 1NG9A 3TBKA 5TXGA 4FMCB 3QKTA 3IILA 2A78A 2VO1A 5JRZA 3J81k 1WBBA 1NKSA 1E2JA 1OB2A 2O8FA 3B1YA 3KJEA 4CIDA 3H4MA 1YE8A 121PA 1Q44A 2IF2A 1RZ3A 2ZRLA 3FHOA 3IO5A 2A9KA 3GEEA 2YVUA 1UADA 1IY1A 1LF5A 1ZINA 3AVPA 2ONJA 1P3JA 1TADA 1EESA 2FFBA 3U60B 2R6CA 3V4RA 3DKPA 3R8CA 4EQ6B 4AKGA 4QGHA 1SHZA 1NVVR 2ZAMA 1NI3A 2ZJBA 3RWOA 2ZRDA 2ZRNA 3U3MA 3W6PA 1BS1A 4QRHA 4Q4AB 4GL2A 3NIBA 3W8RA 2PH1A 1AN0A 4Q7KA 2ZJYA 2OLKA 1T3HA 4A0RA 1ZUHA 5KOYA 1U9IC 3RS3A 1KHTA 4LC1A 4BFUA 4M0LA 2IWHA 2GEDA 1U0JA 2PEYA 3PVSA 5LD2B 4MRPA 2WPDD 4V0KA 3UKDA 2G9NA 4DSUA 1E94E 2PJRA 1ONBA 2IEYA 1Z47A 4LYHA 2GAOA 2EQBA 2BV3A 2CLCX 3GLHA 4JLMA 4JKYA 2QAGB 1ZM9A 2WJVA 2GK6A 1G3RA 1XEWX 2IUTA 4JJKA 4D2IA 2W2VA 2FSHA 3PEYA 2NZ8A 3VHLB 3GD7A 1RC8A 4PQFA 4YQFA 2DWOA 3ZDQA 1SVWA 2RGGA 2BM1A 3M4YA 3K0AA 4LYAA 4D80A 1CJVC 1SQ5A 1NVVQ 2CVHA 2FGKA 3K0FA 5SZHB 3I5XA 1K6MA 4RCZA 1Z6YA 1XNJA 1KK0A 4IKEA 3WY9A 2KB0A 2OBNA 3EAQA 2IXGA 5AUNB 1SVSA 4Q47A 3GMTA 3I61A 2GETA 1HH4A 4G5GA 4UXJA 4EKDA 1S9HA 2R6DA 4EUNA 5C46F 3QXSA 2EFEB 5AJYA 2OCAA 2RGNC 5EP2A 4B76A 4WIAA 2OLJA 1XTQA 1M8PA 3FFAA 5JWOA 3A4NA 3WYFA 2H92A 1XTSA 4O2LA 4B34A 5FBLB 2ORIA 3FGNA 1E9DA 4XD7A 3EPLA 4HAUA 3U44B 1NBMA 1Q21A 1YHNA 2GXQA 1CU1A 4FIDA 4PANA 2IT1A 2JLUA 2XSZD 1N6RA 3GLHE 4OQMA 1E9FA 2FGJA 3R20A 4UNSA 4LY6A 4YMSA 1E0JA 1FQKA 2IWRA 4B3FX 2BEKA 3BH6A 2JCSA 4TMZA 4PFSA 3IKJA 4KAXA 4C30A 4QL3A 1NRJB 4BUJA 5BN4A 5GVSA 4UKDA 1FL9A 1KK3A 3NHBA 1IJFA 4C0HA 3Q7QA 3BFXA 1VYVA 4FWIB 4HZUB 3GLFB 3W5IA 1R8QA 2YWGA 5HR5A 3WRYC 3LRPA 3JZMA 1NLZA 4LCBA 4XVQA 4L15A 4TMXA 5AR1A 2BCGY 1Z6AA 1YRAA 1CF4A 3NDBB 1OXTA 5LDDC 2QORA 1S0UA 1SXJA 2ZJ2A 3IGFA 4PPGA 4F4JA 3KQUA 4A6XA 1WBDA 3B1WA 1VG0B 3SE0A 3LQRA 2CNWA 1DG1G 3QI2A 4C0QC 5FUWA 5DHAA 2O52A 2P3SA 1TNDA 4QJ3A 5EE1A 3BH7A 4URYR 5FTKA 4LBVA 4RY2A 2I1VB 3KXIA 1HQCA 3B60A 4JT4A 1NBME 5JMTA 4M1YA 2A5JA 3I73A 4XD7D 3A1TA 5HPYB 1NBMD 5FI0B 2JJ2A 3PUWA 4PHFA 1VCIA 2A5YB 3WNDA 2XJ9A 5H70A 4DLWA 2XTZA 2D4HA 3FKSA 3W3AA 1TF2A 1YZQA 2DWPA 1P72A 4OHVA 1KYIA 5CLQA 5FBQB 4PXAA 2GILA 1P7CA 3ADKA 4LYFA 1NLYA 4C0SA 5KDLA 3QNUA 1NN3A 2P65A 2P6UA 1YR7A 1NLFA 3LQQA 3K0EA 4KFSA 1JJ7A 4PC3A 1DG3A 4A0FA 1TMKA 3FE2A 4CGZA 2W2XA 4IRUB 1NG1A 3ZS8A 1W44A 2BMEA 1KGDA 4G01B 2Q3HA 1G3MA 1SXJE 2IA5A 5L3RA 1N6KA 4UNQA 2ZTSA 2F1IA 3DVLA 1SXJD 3L82B 1SHKA 4B43A 1IN4A 2YV5A 3FHTA 2CNWD 4KFRA 4L4UA 2FEOA 4BE7B 3VR1A 1E9BA 5GJWC 3EZ9A 3RLFA 5CK5A 1C9KA 2ZRIA 1OPXA 1US8B 2YOFA 1MO6A 1P2SA 1N5JA 2C04A 1P6XA 4FW9A 3VHXA 4EIWA 3CO5A 4L16A 2GHIA 4PO1A 3AVVA 5FTMA 5JJKA 1N6PA 5EXXA 2VF7A 2P2LA 3EWAA 1U94A 4HAWA 3PEWA 1Q3HA 5SZIA 2O8CA 2JJ2D 4LGMA 5M04A 4DCUA 4MITA 1IONA 4LRWA 1R0WA 3Q7PA 3CWZA 4O25A 1VIYA 3FKSD 4Q7LA 1W1WA 2EFGA 1TTTA 4XVUA 2CL0X 2AWOA 4RZ3A 3F3YA 3EG5A 2AFHE 1PLLA 1YZUA 1N6NA 4DUGA 2A5FA 1XEWY 2NO9A 1AQUA 1VCOA 5F9FA 1JXOA 1KY2A 1EG7A 2CDNA 421PA 4ACBA 2OBLA 1KKLA 3AUXA 1E2DA 3U4QB 1N3BA 1S2MA 3IDQA 1G3IA 2H8KA 2QP3A 1GG2A 3T1OA 2CJWA 1ZAKA 1XXHA 3ASYA 2VHJA 3CF2A 3P4YA 3DZDA 4HLCA 1XD8A 1A5TA 1F48A 4PHHA 1LB1B 3W9YA 2WOJA 5JCZA 3Q3JB 3SHWA 4B3GA 1KDOA 2WZQA 4ZI2A 2QMHA 2ZUBA 4OHYA 1MO5A 1H8HA 4ARZB 3U7FB 3ZYCA 3LW8A 5TDHA 3BOSA 1YKSA 1CTQA 3VFDA 3FMFA 3N2EA 1FTSA 4AY2A 2AXNA 4ESHA 2P67A 2JLRA 3VNVA 4G5QA 2WMOB 1KO4A 1K5GA 4ZKDA 5GVRA 3K9HA 1OXXK 4EPWA 5JEEA 4MKFA 3NBYC 2EFDB 2QE7D 2WAYA 2ZVPX 4RKEA 1IAQA 4C0BA 3ICQB 2ZANA 1HE8B 3K70C 3NTUA 4DLYA 3RS2A 4KXFB 4DUGD 1XZPA 4DCSA 4HAYA 4BFYA 1E69A 3FMOB 2C78A 1ZP6A 3LFUA 2KBFA 1UPTA 3PUVA 3EZ7A 2DHRA 3WMFA 2NO0A 1WB9A 5B2ZA 4RKFA 4IDNA 2QRZA 2ZREA 4AG6A 1XXHE 1N5LA 1JXMA 3HR8A 1VG9B 1OFTA 3LLUA 2OHFA 2XTMA 2ZSDA 5DNYB 1F2UB 1EX6A 1NVXQ 3GJ4A 3MJHA 4DLSA 3QF4A 1OHHA 1XJ0A 4LJ7A 4XTCS 2CL6X 4NCIA 3CRRA 1Q3TA 3THYB 2V6JA 1BMFA 2FA9A 4Q19A 4MYCA 1H8HD 2IL1A 4TT3A 2RB4A 3A1UA 1EGAA 3P32A 1QBKC 2GJKA 3THXA 3GJ7A 2FV8A 3EC1A 2Q0HA 4URVR 4A15A 3RNLA 3WHLA 4QOSA 3IIJA 4ZDIA 2QP9X 1ZM7A 3EC2A 5FOSA 1FP7A 2VP2A 4TYQA 3BD9A 4A4DA 1AM4D 3NC0C 4BLTA 3ZVMA 2ZRCA 3HDTA 3GLFA 1SKQA 4EFLA 2IEZA 2OEPA 1ZD1A 3WNCA 2GKSA 3HU1A 3KTAA 4G3XA 1OFIA 2JJ8A 4G5SA 4KFTA 4GMXA 4LJAA 2GZDA 3O8CA 2F9MA 3BIFA 4TQAA 2IYWA 2XOKA 4DB2A 3EW9A 1G8HA 5L3QA 3OE7A 4LWZA 1G5PA 2AN9A 5JS8A 1VMAA 4GPTA 1L8QA 1AQYA 3CUEF 4LK2A 1R4AA 5EJEA 2DB3A 1ZM2A 2P5SA 1G8GA 1KO1A 1P60A 3GFPA 4FI3C 4PO9A 4JKIA 1OHHD 2YC4C 2C77A 2HV8A 1G16A 1RJ9A 3K1JA 3K9GA 2AKAB 1BMFD 1T3SA 5F2EA 2NIPA 1WP9A 2DY1A 4AG5A 4TT3D 3K0CC 4AKIA 3NG1A 3ECCA 2ZQ5A 3WYAA 3SYLA 2ZRFA 2W83A 4NYMR 1NN0A 3IO3A 3BS4A 3AVWA 2QTFA 1EFTA 5JWRA 4M8NE 3AP3A 4A82A 2BJWA 3AGPA 2CHGA 4DKXA 1OH8A 3WXMA 5JS7A 1U9IA 3GLFE 4N0EA 2J1LA 2OCBA 2ODEA 3KQHA 1XP8A 4AYWA 3OIYA 3AV0B 5CYPA 1CR0A 3U3KA 3TGPA 3DM9B 2ZYTX 3R8FA 3QXXA 3U2QA 2BMDA 4F7WA 1YZNA 4Q9KA 2GCNA 2IK8A 2ONKA 4HB0A 2R9VA 3FFBA 3SN6A 3UMFA 4BLOA 2D7DA 2NPFA 1XZQA 5DO9A 2XZOA 5K8TA 3EZ2A 4Q48A 1WRBA 4KSBA 3JVUA 2VL7A 3VR3A 4B2IA 3K70B 4R2HA 1WXQA 1Z0IA 4Q1CA 1R5NA 2NOAA 2CLDX 1Q1BA 2YWHA 4XSGA 5K8UA 4BLSA 2O8EB 2V6IA 3GFOA 4D4LA 4NYMQ 2WWHA 4OJQA 4TYYA 2NMVA 2GNOA 4ZI3A 1ZCBA 3W5JA 2VA8A 3LO5A 3DOEA 4FMCF 3FVQA 2O0JA 4Y0VA 3Q8XB 1Z08A 2P5TB 4GRAA 2RGNA 4GFDA 4LBWA 2O8BB 1PUIA 4IDOA 4JLPA 2ZYWX 1Z06A 4NBSA 4Z8XA 3TR5A 3TSWA 4YMUA 4RFSB 4FN5A 4K46A 1W0JA 5AJZA 5TB5A 1ZMXA 5EZ6B 5C1BA 3KKOA 3UG6A 5L3VA 3K9LA 3KXLA 1JR6A 4HLUC 2QI9C 2C99A 2CBZA 4F93B 1XEFA 1YR9A 1Z0KA 2ZPTX 3SR0A 2LCFA 4M53A 3QQ5A 4XTRA 3RSOA 5FOXA 2KE5A 4A6PA 4YMWA 4RD3A 4TLBA 3NEJA 1ZM4A 1KI1A 4EDHA 1Z07A 5BYJA 1XCGB 4KSCA 4OHZA 3CRQA 1UBFA 1ZVQA 3VU9A 4ARZA 5KNBA 2VSOA 2VHTA 4JSYA 1KI2A 4E07A 4A0GA 2G3YA 3SNHA 4BFXA 2XZLA 1W48A 5AJXA 5EUQB 4QNMA 4EJSB 2V8OA 4PQRA 4QNRA 1K8RA 4GZLA 2WBLC 2J0UB 1VYUA 1G5RA 1W4RA 3RSLA 4NHOA 3OEHA 1GVNB 2HYIC 3KKQA 1II0A 5JECA 2WICA 5E95A 2IC5A 4MRRA 4MGIR 3A8TA 4QGFA 3SHFA 3CX7A 1ZBDA 2JLVA 2D74A 4XIGS 1AA9A 1M6NA 1P9RA 3AVUA 1AS3A 1W0JD 4F92B 4A8JC 4IDQA 4JBYA 2LKDA 1E32A 4DSOA 4EAQA 5JJLA 4GZMA 1JALA 1R0ZA 1S9DA 5JI2E 4DHEA 1SULA 4EFNA 2Z5FA 1OSNA 1E2NA 2X8AA 3LBIA 4TL6A 1W4BA 5TARA 1KMQA 3M0EA 3EIEA 4G5OA 2ZS7A 1E2EA 3BORA 2QMEA 1DAMA 4H9GA 4TZ0A 1J99A 4PSAA 1NMZA 1JPNA 1QHSA 2PT5A 2YWFA 4Z51A 4DLZA 1ZYUA 2O5VA 1XDBA 3KUDA 5CK4A 1IHUA 3EIHA 3SEAA 2JATA 1GM5A 3AQ4A 3QKUA 2JA1A 3ND9A 2PT7A 3TE6A 1D2EA 1KI4A 2QBYB 1YJ5A 3OEHD 3AVQA 5EE0A 3ZH9B 1UKYA 2IX3A 2RGAA 5J47A 3CPEA 2F55A 3BGWA 5IRCD 2B7BA 4B33A 4TMTA 1KO8A 3CH5A 4PPNA 5G41A 4PX9A 2OCPA 1BH2A 5L3SA 1XFAA 4CEHA 1U8YA 2BBOA 3QPUA 3SU8A 3THOA 2FFAA 5DYIA 2ECKA 4WZ6A 5LD2C 4ZO4A 5JI3E 2UZ3A 2KWIA 1UKZA 2WWFA 1FUKA 2D62A 3A6PC 2ZRBA 4EPTA 1VCMA 3WBJA 4LI0A 4X8MA 1Q12A 2QAGC 1TL7C 5FUVA 1QHXA 4NONA 2GZHA 2W6ID 4JZKA 1XTIA 4RZ2A 5IDVA 4MYTA 1HYQA 4FMBB 2QA5A 3W6NA 2OFOA 5KUTA 4QFMA 1UBCA 1W2GA 3B82A 5C4GB 4DWJA 1SVKA 4A92A 5FTLA 6Q21A 4TL8A 2NQ2C 1I2MA 2FSFA 2QU8A 3PUZA 4S2EA 1WMSA 2WAXA 5J4HA 2PLFA 4BZPA 4W5WA 4I1OA 1FW6A 3DKVA 4AYTA 1ESMA 2ZI5A 4MKHA 4U5XA 2G6BA 1H8ED 2KJQA 1M2OB 1G3QA 1MABA 2G83A 1Z0AA 1E2KA 4B6EA 1S3SA 1XU4A 2GCOB 2NO6A 2BJVA 3QKRB 4Q1EA 2XXAB 4BLQA 4IHQA 1T5IA 1IN6A 2C5LA 2DPXA 4KJZA 3CKLA 4XSHA 4CVNA 1N6OA 1KI6B 4KVAA 2CLSA 2FMXA 2MMGA 3QG5A 4QJ5A 4M21A 1Z0FA 1NVWQ 1AS2A 5JZVA 1G7TA 2OG2A 4O0MA 1A7JA 2YINC 1ZM3A 1D9ZA 3AP2A 4X8OA 3PUYA 3NBZC 3Q85A 4DLTA 1HE1C 1VTKA 3CIOA 2ZJ5A 2TMKA 2C9CA 3EA5A 1IJEA 3X1XA 4GNKA 1VDZA 4JT2A 3OZXA 1NSTA 3OAAA 1D6JA 3RC3A 4L8GA 2XB2A 1CJTC 5CJPA 1CULC 1DVRA 2WKRA 4V0MA 1I2DA 2UKDA 3SC3A 4C0KA 5KYKA 2GESA 1VECA 3B78A 4XJXA 5FUYA 3K8YA 1P62B 3D3QA 2F7SA 3CRW1 4LZZA 1I4DD 2F1RA 2XX3A 3L0OA 1GL7A 1TU4A 1W46A 2BWJA 2EFCB 4Q9IA 5HZHA 1KK1A 3KQNA 3TUIC 3S1AA 1VHLA 4CDGA 1N6HA 2GBLC 1KDTA 1II8B 1GAJA 1SVMA 2P6RA 1E99A 2FE4A 4Q1FA 3GQBA 1EXMA 4ESVA 4WXPA 4JLDA 3L0SA 2ZRHA 3HU3A 2ZRJA 3LW7A 4JLBA 1S3GA 3TH5A 1E1RA 2NO1A 1I4LD 3K70D 2JLZA 1EFCA 1G8YA 2BIFA 3BJIC 3CNLA 2V4ZA 2YWEA 3A1VA 4HAVA 3RYTC 3RWMB 3QUSA 1R5OA 3HJNA 3OAAD 2ZRMA 3V9PA 1PV4A 2J0UA 3M6AA 5J4VA 2IHBA 4BFVA 1KMHA 4V0ME 2XSZA 2D7CA 4E03A 4D4JA 2E1RA 3MG9A 3MSXA 4MUBA 5FTJA 1R2QA 4WOPA 1AZSC 4URZR 3QXHA 2AHOA 5E3HA 4CEIA 3WP0A 5E4FA 3TAUA 3QEOA 3QBVA 2YC2C 1IN8A 1N5IA 4I1VA 4Q4JB 2XZPA 3FDIA 4PC7A 2P0EA 2CE2X 5FOTA 3GLGA 4UJ3A 2WJIA 2KI5A 3ZIAA 4QJ4A 3DZ8A 1Q0UA 4NCJA 4X8LA 4B32A 4HYYA 3U3RA 2EW1A 2EWWA 5J4YA 4QHTA 3PJRA 1E1RD 5LB2A 1DARA 2WVJA 3I32A 1OH6A 3SS8A 2CVFA 3PFIA 3R9WA 4LHXA 1KSGA 4ZPXA 2JDIA 5J4LA 4TYPA 2BBTA 2GDJA 2QPTA 3BK7A 3QG1A 2VYFA 4KLZA 4L9WA 4OKSA 4IEIA 4LPSA 4CZ2A 3SYNA 4G1UC 4FMDB 3B1XA 3ADCA 2HCBA 1DO0A 1UFQA 3VAAA 4IDPA 4HSEA 5HCIA 5EQTA 4DCNA 2Z0MA 3KFXA 1TUIA 4FCVA 2X77A 3DL0A 1O3YA 5P21A 4US2R 2GXUA 4WBSA 3WYGA 5BN5A 1G291 3SI7A 3RC8A 1YZTA 1X6VA 1UJ2A 3GLGE 4C2TA 2VP4A 4JSTA 4R9UC 2I4IA 3ZGXA 4CYMA 5HE9A 3HYTA 2QSZA 1P2UA 3ZIAD 1KTVA 4M4SA 4MA4A 5BXQC 3GP8A 4BEBA 5JLJA 5FPHA 3ND8A 4D26A 2QY9A 2QM7A 4C7OA 2QZ4A 4HEJA 2AK2A 1ZIOA 3VR2A 4QBHA 1DAHA 4F91B 4URXR 3RRZA 2QMOA 3Q5DA 1T9HA 1E0AA 1KO5A 2JDID 4HDQB 4HLUA 4KI0A 5DSZA 1NL3A 1XMSA 1OXUA 4O3MA 1Z83A 2BVNA 2WIBA 2FPLA 4FINA 4NDZA 2ZVQX 2RH5A 1QG4A 2XEXA 2Q6TA 2ODWA 4IW3B 1YU9A 5CDFA 4R71A 1W36C 3QKSB 4B6FA 2GEUA 3I62A 1DELA 1M7HA 3AB3A 1RRGA 2JIZD 2DR3A 4QHSA 1FNMA 3LX5A 4Q1BA 2UVQA 4B48A 2IYZA 1Z5ZA 2CL7X 2IHYA 2ZE8A 3C8UA 4A2PA 4DBLC 3PR1A 1KI7A 4X8HA 1II9A 3EA0A 3AF2A 3P4XA 1KAGA 4P4SB 4GP6A 1E9RA 1XPUA 2H18A 3TUZC 3CPHA 1CLUA 3B7GA 1QVAA 4GI7A 2C2HA 5H8WA 2RKOA 3IQXA 5J4KA 1U0HC 4M1TA 3AF3A 4N0DA 5EXPA 2VIIA 3IHWA 1T0JB 3L2OB 4M22A 3CZPA 4R2IA 5UKDA 1A82A 2IF0A 3BXZA 2OV2A 3Q72A 4A8JA 1G3UA 2BKUA 1J7KA 2XNDA 2IUSA 2IYVA 1JJVA 4XWAA 5FH9A 1OFHA 1KAOA 5H68A 4B35A 1P2VA 2IYUA 1BO6A 2Q9CA 5A5GA 3GJXC 1J8MF 2QSYA 1PLKA 4LX0A 4KHZA 4WZBE 4M1SA 5CDFE 4AKHA 1G6HA 3RS0A 3CONA 3ZVLA 3CZQA 5LB4A 1E0SA 2FH5B 3ZZ0A 2QE7A 1SZPA 4FXPA 1ZU4A 1JECA 1E4YA 2WKQA 4UNNA 4V0LA 5JHHB 2ZIAA 4HUTA 3U7GA 3FTQA 5EXTA 2OO7A 2FNAA 4V0NA 5KTYA 1CRPA 2ZJ8A 1VKJA 1II8A 1JQLB 2RGBA 621PA 3I8SA 4Q1AA 2ZJAA 5C18A 4G5RA 2BKEA 2PJZA 1HY3A 1FMJA 4RZXA 1T5LA 2AK3A 4I81A 1DS6A 4FWTA 4TZ6A 4EQ6A 3FMIA 3BE4A 3QXJA 4F4IA 4B47A 1E2PA 4GT1A 3UK6A 4Q9LA 4Q4AA 5KDDA 1QDEA 2GJ9A 1BYUA 3MFYA 2WJGA 4JYCA 4BPBA 2W2TA 2AX4A 4DIEA 1E3MA 4G0NA 2ATXA 3U7EB 3T1QA 1Z2AA 1L7VC 1W0KA 2ANBA 3GJ3A 4RD4A 1QHHB 2F43B 4MGYR 1XEXB 2ZU0C 2XNDD 1GKUB 4D82A 3REFA 3CX6A 3HP1A 3L0IB 3LVRE 2C95A 4II7A 4L5BA 1ZRHA 4LV5B 3W34A 5JSZB 1TX4B 1X86B 3RRMA 3H0KA 3KB2A 2B6HA 1P75A 3K9NA 3FHCB 2FOLA 1G6OA 1R8SA 2QAGA 2E9SA 4LJ5A 4MGZR 2WSSD 4Q1DA 2Q9BA 1RFLA 1XD2B 5HTKA 4MYUA 3RANA 2QT0A 4ABYA 5FBVB 4P3YA 1HV8A 3R9IA 1TEVA 2OUKA 1EWQA 5AJWA 4F4CA 4KBGA 2O0HA 4W7SA 1JAIA 5EE5B 3VMFA 1A4RA 5IT5A 1DBSA 5DH9A 3SJBA 3AVOA 3KX2A 1WQ1R 2LKCA 3ONWA 1W36B 1CEEA 3RS5A 5KU1A 1P73A 4P4UA 5B30A 1KSJA 2WOOA 1M7GA 3A4LA 4ACAA 5FL7A 2C98A 4FCWA 1N5KA 4QXAA 3O8BA 2Q21A 4F38A 1ESNA 3MUFA 3NVAA 2HJVA 1W0KD 2F6RA 4KU4A 5KSOA 1GITA 2OESA 1EFHA 3U44A 2HUPA 4QGAA 2J59A 2ZM5A 3G0HA 4MKIA 1WE2A 4ZDWA 4ZKEA 4TTRA 2ZETA 3EIQA 3AKEA 3T5DA 4HLQB 3GLIB 1JNYA 1QHGA 4DLVA 2OSBA 1U8AA 2QG6A 3WNBA 1X1SA 1W4CA 1JEEA 1K5DA 3P20A 3AM1A 1VIAA 4HAXA 4HZUA 5CLLA 2IS2A 2GZAA 3MLEA 3B8HA 1CXZA 1OKKA 5AUQA 3IIMA 1XB2A 2NTYC 3KB1A 2KBEA 3AP1A 2XAUA 3VX3A 1E98A 2R2AA 4EJSC 1Z3IX 5EE3A 3VTKA 2CCKA 1WCV1 4QBFA 4LV6A 1UKVY 1XTKA 2R8RA 3PIRA 2QQ0A 2CE7A 2ZE5A 1E9AA 3MCAA 1E2MA 4PZZA 3SJCA 3WMGA 4EPRA 2REOA 2VHQA 1XPOA 2VSFA 2QNRA 3T35A 1LS6A 5FL7D 1JQJC 1AK2A 1M1YE 5D3MA 3C4JA 4M9SA 4ZCIA 2GBLA 2R6AA 3O8DA 4YDSA 5BWMA 2IW3A 2ERYA 1OIVA 1G7CA 2OAP1 2ZXUA 3E1SA 4H1UA 4URUR 4PHGA 2Z43A 2MSEB 1H65A 1PZNA 1VCNA 2QROA 4WXRA 3PCRB 5DI3B 1CR2A 5FUXA 2A30A 1F5NA 2WWXA 2C03A 2XB4A 3C15C 1GL6A 5FBRB 5AUPB 3LY5A 3QKSA 3W90A 4BRWA 4NCHA 3MJRA 2WKPA 4Q7JB 4FD2A 3TAHA 3ADBA 1AJEA 1DE0A 4NCKA 3CPJB 1CBUA 5SZJA 2V3CC 1JR3A 4BASA 1A2KC 3EZFA 2ZYVX 1OKKD 2ZI9A 4LPKA 2W0MA 2ANCA 4AIIA 2IYTA 3MWKA 1OV4A 5KDOA 4P4SA 1YR6A 2QENA 1IOZA 5A4JA 2FWRA 4KYUA 3CW2A 4QM6A 2FEMA 2J7PA 1QZXA 4M1OA 3TW8B 1LNZA 3RRNA 4CT4B 4DDWA 4ZDKA 3KZ1E 4TMWA 4NYJR 3ZZTA 3NH6A 4HB3A 1US8A 4LHWA 3R7WB 3T1TA 5H1YA 4EFMA 2HEIA 4JVMA 1XMVA 3E2IA 2GF9A 2ASEA 3G5UA 1GSIA 5ANRB 2QTHA 221PA 4Q01A 4IDHA 3WMEA 1G4UR 3C5HA 4DC9A 5EUMA 4DB4A 1AS0A 3KXKA 2YJTD 5KSPA 3TR0A 4PQYA 4OI4A 2ZUCA 4A36A 2PL3A 2ATVA 4DCVA 3IBYA 4RVCA 3VKHA 4JIMA 3IIKA 2F3RA 3CF0A 1NP6A 1OYYA 1PLJA 4IVQA 1CIPA 2AD5A 4B2LA 4Y0AA 3GJ5A 1JR3E 5FTNA 4D6PA 3OF5A 3AVYA 3EARA 1JR3D 1OE0A 1GKYA 3TIFA 1IY0A 2QPAA 2X2EA 1OW3B 5HKKA 3U4QA 2V1UA 5FOUA 4QC2A 2W0SA 2ZUDA 3JVVA 3FWYA 2FJUA 3SYKA 1N0UA 2R62A 3CR8A 3TVDA 4NPHA 2J7PD 4NYJQ 3E5HA 4CF7A 4WZAE 4YMVA 2JGNA 1Z22A 3PENA 3IQWA 1HTWA 4M2LA 2PZFA 3VQTA 2O8FB 4Q5IA 4M1KA 4TLEA 3EASA 4QKQA 1LY1A 2F43A 2J41A 1IXRC 1XEXA 2GWHA 4NZYA 4R7ZA 4DVGA 4U7DA 1OF1A 2BM0A 2FN4A 2CEAA 4MKGA 4NTZA 3TNFA 2G1KA 2V55B 1DAIA 4QBIA 4Q00A 2WM9B 1Y3AA 2VP6A 4M1WA 3RS4A 3LD9A 3KDSE 4B44A 2HT6A 2XITA 3VX4A 1XD2A 1X8LA 1T4GA 2YNMA 3TUJC 2UZIR 3HU2A 2D2EA 2BDTA 4D0LB 4TWZA 3SBEA 5IHPA 2ZR9A 4XVRA 2SHKA 3UPUA 5ELXA 5F98A 2GJAA 3ADDA 4RD2A 3AGQA 5GJVC 2I1QA 2QMUA 4KVGA 4BECA 4D4MA 1MV5A 2A3RA 5HKKD 5DGXA 1E9CA 2BHRA 2L0XA 3KJIA 4IXNA 3O47A 3WP1B 2HLDA 3ETLA 5JFGA 1F2UA 3GLHB 1WA5A 4KITB 3SZRA 1W47A 2C9YA 3A1SA 5HCNA 3P27A 2ZRPA 1LTQA 3W3ZB 4TYNA 3NH9A 3THYA 1TQ6A 2W6IA 1TU3A 4IVPA 2J0QA 2ZRAA 4OI2A 3O8RA 3FYHA 3EZ6A 2BBSA 2WMNB 1KJWA 1KZ7B 1J8YF 5GJCA 721PA 2GK7A 5FBWB 1LF0A 3K0AB 2FU5C 3K0FB 3QOFA 4LJ6A 3QJYA 2YKGA 4MQBA 1ZJ6A 2WWGA 4AWXA 5CITA 4P0TA 3LBHA 1CS4C 3KKMA 2WV9A 4JLVA 2PCLA 1H8EA 4IFEA 4E5UA 3C41J 1G4AE 4C4PA 2F9LA 1JAHA 4CEJB 2MSCB 1T91A 1X3SA 1KNQA 1U0LA 4ON9A 4KO8A 3QE0A 3RVBA 1KK2A 2PMDA 4GSYA 2ZS9A 3THWB 1W36D 1A1VA 2C8VA 2IXEA 1G8PA 2HLDD 4JLJA 2JASA 3U3JA 1CJKC 1D8TA 3OFNA 1YZLA 1WDTA 1TF7A 3DO6A 3LXXA 1HA3A 3K0SA 3ZD7A 5IK2D 1AGPA 4JVLA 2J0VA 4NH0A 4D0GA 3QIAA 3EX7C 2OE2A 1MO3A 4MRNA 4B2PA 5DI3A 1E2GA 3UIEA 3HPQA 1JBKA 1J90A 1OXVA 3GLIE 1SXJB 3RDPA 2J7KA 1GNRA 2PMKA 3HPRA 4BLPA 4RFVA 1GP2A 4TLAA 2A7QA 3H86A 3L0PA 4Z1MA 5JJIA 1IY2A 1TQDA 1XJQA 1V5WA 2GCPA 2J5XA 2GXAA 1TQ2A 4JLKA 2GF0A 4KODA 1KY3A 5DHFA 1ZD9A 4MRVA 1ZUIA 1D2MA 1D5CA 3F0TA 4UXHA 2JLYA 4UXIA 1L2TA 2HF8A 2HF9A 1RYFA 1TUEA 3F5FA 2OZEA 1SVIA 1UBGA 2IS4A 2DFKB 3UANA 4NCNA 1XMJA 5KHOC 2GVDC 1MRSA 3I5YA 1T8TA 1ZC4A 2QP4A 4B75A 3GFTA 3PUXA 2IYRA 3KUCA 2REBA 3B9QA 2FPMA 1RIFA 2QQEA 1OT3A 2C9OA 5DI9A 1S1MA 4YLGA 3R7WA 1P5ZB 3OFND 4GMDA 3VNUA 1Z6TA 1GTVA 3BB4A 3AKCA 1HT1E 3QSYA 4IEEA 4WA7A 3KQKA 3AVXA 4Q03A 2JLXA 3EPHA 3UMSA 4M9ZA 2J46A 4BLRA 5FOWA 2O8EA 1ELOA 1X8JA 1XTRA 2B8TA 5JHGB 2H1LA 4U02A 4ZCLA 4OQNA 3OEEA 4JLAA 1GWNA 4LBZA 2F1JA 1EFRD 2EFHB 2NG1A 2QGZA 5TVKA 2O8BA 5CM9C 2PLRA 4Z1MD 5BQ5A 4NE2A 1NMXA 1VG8A 1VYTA 5A0FA 4RFSA 2EVWX 2FDCA 1GOTA 1GL9B 2IBMA 3D31A 3NC1C 1E0KA 4DLUA 4MYHA 1U90A 1KI9A 3I1FA 4OL0A 1UDWA 5DN6A 1AKYA 4QM7A 1T6NA 5FI1B 1W7AA 1GILA 2YZ2A 3TJZA 2O8CB 5KPDA 3TQCA 2N46A 2OAQ1 3OESA 4HATA 4US1R 1RVDA 4DXAA 3QY0A 1ZIPA 2REXB 1Z8FA 3T1VA 2Q3FA 1E9EA 2QPOA 3W8NA 1PJRA 5BYKA 3VKWA 5KSZA 4L9SA 2BBWA 1DAFA 4EPXA 3GEHA 2B7CA 3X1DA 4EPVA 1QRAA 4EJSA 1YVDA 1RPZA 3GEIA 2NO7A 2EYQA 4M9XA 2H7VA 4GBMA 4AD8A 1KO7A 1N2CE 2MMCA 2CJWB 4EPYA 4BFWA 3AVTA 1XXHB 3OEED 1G1MA 3DEFA 1MT0A 1Q20A 1ZNWA 4PZLA 4OBEA 2B92A 3U7HB 1KDPA 1E96A 3CNNA 1XWIA 3H2YA 2IYQA 2RGDA 3RRYA 1MOZA 2VQSA 4JL5A 1GUAA 5JWHA 3ZQ6A 3K0CA 1E2LA 5FR2A 1LFDB 2EWVA 1E1QA 2HXSA 2G0TA 3E70C 3FKQA 5DN6D 5LBIA 2F1HA 2FPKA 4US0R 4XWKA 1QG2A 3X2SA 1IM2A 3PITA 3CWQA 2QAJA 4I4LA 2CCJA 1Z29A 2VRWA 4GP7A 3QEJA 3SDZA 3VR4A 1Q22A 1ZW6A 1ZUNB 3B85A 3BWDD 1JEDA 1Q1QA 2CCGA 4YXWA 1Y63A 4DSNA 3MD0A 2ORVA 2PX3A 2BEJA 2Z4RA 4P4TA 4P33A 5G40A 3M1IA 2V54A 2ZI4A 4B3BA 4CRWB 4UNPA 4TQUS 2ODBA 1YZGA 4ZV4A 4DT1B 1E2QA 4M9QA 4IOJA 1NKTA 4DLRA 1SVOA 1MKYA 1TQ4A 3L8ZA 4N1AA 2WSMA 2ZR7A 3AKYA 5CB6A 3U61B 3DPUA 4C0AC 2QGNA 1GRRA 2CMKA 3CH4B 2QBYA 4TL7A 4I1SA 3BRWD 1S96A 1IN5A 1KNXA 1DOAA 1M34E 3GPLA 4JL8A 2IS1A 2JIZA 3QF4B 4KYIB 1SVLA 2GJSA 3FPAA 4LHZA 3X1WA 4ZCMA 4C2UA 2H57A 1B0UA 3OIUA 4HB2A 5FPTA 1YR8A 1FZQA 1WF3A 4CEJA 1G21E 2G88A 3CF6R 4PAOA 1JB1A 5IF9A 1E1QD 2JLSA 3TMKA 2CK3A 3THXB 3UATA 3V4FA 5FR1A 2R65A 2HDNB 1G41A 4A9AA 3THWA 1QHYA 2Q9AA 5CM8B 2A5DA 2VP5A 2ZS8A 2XNSA 2G0NA 4MUAA 4YXWD 1NJGA 1QF9A 1U81A 2DWQA 4PHTA 1DAKA 2N42A 3NBFA 4BQSA 2ZEJA 1HEIA 4H1VA 4Q4HB 4TLDA 3KTAB 2X2FA 1CJUC 3DHWC 1TEXA 3AF1A 1T3LA 3DDCA 2WJJA 1KJYA 3MMPA 1DEKA 3A58B 3ZZUA 1E9SA 3T06B 3T12A 4QBGB 5L3QB 1L4YA 3LVQE 1F2TB 1OLOA 1F60A 1X8KA 2QL6A 1FX0B 2H16A 1Z63A 5BW8A 1FMLA 1MO4A 1R7RA 1IBRA 3RS7A 2R6FA 4HAZA 2HT1A 3NDPA 1NY6A 4LHVA 3TLXA 5D3QA 4K81B 1RJ9B 5DISB 4XH9B 4NP6A 3UXMA 2GCOA 2OCYC 3QKRA 2A2ZA 1OB5A 2XXAA 1G19A 5D3MB 3VR5A 1S4QA 1YQTA 1NY5A 1RKBA 2CK3D 4OQLA 4YDHB 5B64A 3N2IA 4DSTA 1KI6A 1RYHA 2PZEA 3I4LA 3LH5A 2FF7A 2BCJQ 3U6BA 1XTJA 2ZSFA 4P32A 2W00A 4M1MA 1VHTA 1E2HA 2VBCA 5HE8A 3ZLJA 5L8VA 2I3BA 3K09C 3NWJA 1XRJA 3QF7A 3A1WA 4NL4H 3IEUA 1BYIA 3V00A 4ZIRB 2ZSAA 2OXCA 2CHQA 1S8FA 1XD9A 4JBWA 3BB3A 5B57C 4UQOA 1CJMA 1N6LA 1OIWA 1E4VA 5CJ2A 1DTSA 2YOHA 4AC9A 2WSSA 4OJKA 4CT5A 1IQPA 1EX7A 3CBQA 2J3EA 3KKNA 1Z2CA 521PA 4A0HA 4AK9A 2HCJB 1E79A 2D3WA 1BKDR 3PXGA 4BFSA 1XPRA 4PO8A 2FSIA 2ZROA 1ODFA 4D25A 3LBNA 3SQXA 2QRNA 4TTPA 2PZGA 3HYRA 1FOEB 3SBDA 5C4MA 5AWFC 4HDCA 2DFTA 4Q9HA 3GJ0A 1N25A 3ZQJA 4BRUA 3BFKA 4OHXA 4RSGA 2ZITA 4BWYA 1ETUA 3IUYA 1CR4A 1NJFA 3B9PA 3DOFA 4TLCA 5F9HA 4B74A 2OXRA 2NZJA 3VKGA 3OIVA 5DLQC 3RHFA 3LV8A 3IPXA 3GCGA 4R98A 3A37A 2EYUA 4QGGA 4NYIR 4PSVA 2P6NA 5E7IA 4S35A 2JEOA 3RAPR 4YONB 2V1XA 1CKEA 1GFIA 1D9XA 3TW4A 3G82C 4RD0A 4D0NA 1C4OA 1N6IA 1XX6A 2ZJZA 3UWKA 3AUYA 5KPJA 3QBTA 4Q7MB 3WBKA 2RGEA 2K5UA 1E6CA 1GZSA 3D7MA 4LYJA 1AZTA 2X1VA 5AK0A 5EZ5A 4TSFA 5FPKA 3SJAA 2VPPA 2J9RA 5SZKB 1KSFX 4DCTA 2Y8EA 1DO2A 4Q02A 3H84A 1E79D 3VU9B 4CW7A 4Q4JA 4HZIA 4B71A 1U98A 1IN7A 5DIFA 4RD1A 4Q4LA 2ZAOA 1FUUA 2W6JA 4WVFA 4GOXA 3DM5A 2FFHA 1MH1A 3SJZA 4E22A 1UAAA 2BMJA 4JBXA 3I8XA 1O87A 4HLDA 4DZZA 3BB1A 4UJ5A 4NYIQ 1W2HA 3AF0A 5K8IA 1GRNA 3TKLA 1W4AA 1UEIA 5JBQA 4DT1A 1UKEA 1QHNA 3MWLA 3T61A 4UNRA 2OBMA 3RABA 4IFBA 5JRJA 4RD6A 4C9BA 4MGKR 2ZI7A 3PEVA 1OJLA 1Q1ZA 4TN1A 2QN6A 3HWSA 1R5BA 3CRMA 2ZRKA 1QHIA 1R6BX 5FL3A 2WJYA 1VG1A 1UEJA 1GNPA 4HI0E 3GJ8A 8OHMA 4DJTA 4TSFD 2J45A 2VSXA 2XTNA 1KI8A 1COWA 4MDFA 5FFMA 4OQFA 3U5ZB 3NHAA 2BMFA 3MWJA 821PA 1I4TD 1NMYA 4TQ9A 1YZKA 2DYKA 3B1VA 3QVUA 4OI1A 5F3WB 1D2NA 1KDRA 3QPVA 4FCTA 2AWNA 1G18A 1U99A 4POAA 3X1ZA 1LW7A 4AKEA 2FFQA 3EXAA 4PC1A 2B8WA 1FP6A 2JJ1A 4PR0A 1F6BA 2QT1A 5B58C 1R0XA 2VP9A 2C96A 2W6JD 4LJ8A 1T8UA 3B13B 3C7KA 4BZQA 2WHXA 4A2WA 4AI6A 2GAAA 2WJHA 3B5JA 3BH0A 1R0YA 1Z6XA 1HUQA 4Q18A 2OT3B 3CLVA 5DE3A 1G9XA 1JI0A 4Q4HA 4JS0A 5E7MA 5KNDA 2AL7A 4LC0A 1SKYB 5CIQA 1P9WA 4B3DA 2AKYA 1EWRA 3MRSA 2OM2A 3PG5A 3PV0A 1XMIA 2AFIE 5L3SB 3TSZA 4CEHB 3NBXX 3KJGA 1FTNA 2RAPA 3LA6A 2W58A 1F2TA 4B73A 3FMPB 1FX0A 2X19A 4DDTA 4Z8YA 3SFZA 5KNCA 2JLWA 2KSQA 3KJHA 5K8LA 3BAFA 2FX3A 4HB4A 1IXSB 2VHCA 4DIDA 1COWD 5JEDA 2ZE7A 1G5TA 4GOJA 5EP4A 3UMRA 5G3ZA 2WWIA 1KJZA 5TV2A 4BFZA 1P61B 3SFVA 1OH7A 3EWSA 1VPLA 1UDXA
chains in the Genus database with same CATH superfamily
2VQDA 1W5TA 2FSPA 3IKVA 3LY7A 3DE6X 3AILA 2NVWA 3O2NA 4HXGA 4PRZA 5F3RA 3K05A 1B6RA 5H82A 5BQPA 3TK1A 4PYNA 1D4ZA 2CSXA 4KLNA 2ATCA 2P9YA 4WT7A 1NJ5A 4CLRA 1T0HB 3LC7O 4BCDA 2OBXA 1PVOA 3N2GB 5DYGA 1Q0ZA 4J29A 5JASA 1YZVA 1RQRA 5BWNA 1UBEA 1WY5A 4BP3A 4UCFA 2VQ6A 4YI3A 4A5OA 2N1BA 1JWBB 1QP8A 4KFUA 1EH5A 1FCJA 4PAQA 1FXWA 5ALNA 1QR6A 1ZLYA 1AO3A 2RGCA 1MV8A 1Y98A 4B82A 4YACA 2W8ZA 5HOEA 4QICA 1Q7GA 2IV7A 4CQLB 4LBYA 2XOKD 2G76A 2R68A 3RT9A 1H23A 1AKEA 3D7RA 4BGUA 1Y8ZA 3BK2A 4FR2A 1AZLA 1NNEA 4H17A 3CW8X 3QZUA 2HPZA 2VJCA 3KL4A 3WO0A 1C0IA 1HQYE 2ZTHA 2RBGA 4ILEA 5EKTA 3QVVA 1LPOA 2EGUA 2HMAA 1ZNZA 2JVKA 2R6ZA 2YXPX 3C8ZA 4FSDA 4IDEA 4KP7A 4R1LA 2VUTA 2QEQA 3HCRA 1GA6A 4JLOA 4N8DA 1ENZA 1G6KA 3MTIA 1FLNA 3G59A 4PCAA 5E1MA 3BC1A 2CF6A 3MQ4A 2E6UX 4MIOA 2KLHA 4QHYA 4B9EA 4X5OA 2WAMA 4JBHA 4V38A 3ZJYA 1NOJA 2Z1DA 5HJ2A 1ZGZA 1R3UA 2Y0CA 3BFVA 3DNMA 5F5XA 2J4CA 1BIFA 5CNKA 1L4BA 5J5CA 3UUGA 1GRQA 2IQIA 4WBNB 1DJQA 2VRNA 5LFAA 5EIEA 4YTEA 5A2QA 2Y99A 2VYQA 2QOEA 2QMZA 1SXJC 1QX4A 2IXFA 2ZLBA 2B21A 2ZR0A 3O1IC 4RNDB 4LJYA 4C0LA 1T2FA 4BEJA 3U4IA 5A9RA 1O77A 1LVHA 1GDDA 1N75A 3EY4A 4PX2A 2BM9A 5BWCA 2FEPA 1GJRA 2PSFA 2YXDA 3IAM6 2AF4C 4UU1A 2FCRA 1W1IA 4GDFA 3LLMA 5U1PA 4EX7A 4M1ZA 2NVUA 1V5EA 2Q3LA 4F04A 5IAAA 3WGGA 3T15A 3OUZA 2JVIA 4ITRC 1D2AA 1OYWA 1W8IA 4OHOA 4TMVA 1P0CA 1A71A 3OT1A 3P9PA 1WU8A 4IAOA 2VJLA 4OK5A 2XMCA 3QUAA 1BJTA 1ZRSA 2GHQA 1XGKA 3RYFB 4O2RA 1VE9A 5HCUA 4OBBA 2I22A 3A36A 2BDUA 5EXSA 2QVXX 5D5PA 3CB2A 1KH1A 1CRQA 1QPGA 2PV0A 2EU8A 3COWA 1EM6A 3L43A 1JG2A 3VJKA 3ESDA 1O96B 2HMWA 4PO3X 1SKAA 5KJEA 2I4MA 2OMEA 1C1YA 3ILVA 3HBAA 4MXDA 3EFOB 3UF0A 4EARA 1RCTE 2YHBA 3OOHA 5AW8A 2OY0A 2PUHA 4GSLA 5CA1F 2XYVA 1IOVA 2VJOA 3V55A 2CXXA 1CQJA 3VPCA 2YJ3A 3DXYA 3HR7A 1GIAA 3VR6A 1I7QB 4K5QA 2J9ZB 3ZS9A 4LWPA 2CT8A 4C6HA 5TIIA 1W49A 2J87A 4HOYA 2J33A 4HQNA 1T5BA 1GGFA 1HDXA 1MNAA 3P26A 4X66B 1BXGA 2GEFA 2B25A 4IMPA 1FPMA 4MB2A 3ZCXA 3WHKA 5IK2A 3K5HA 5FLYA 3LQ4A 1AKWA 2ORWA 1UMDB 4X3CA 3WDMA 1KR5A 4XDHA 1I10A 2FSUA 3C3BA 2GF2A 4ZU3A 3AHJA 3UXYA 2BH2A 2YFQA 2PIAA 5GADl 3W8EA 1SG9A 2BFCA 1NASA 1TF5A 4ZOAA 1D7AA 2B30A 4MRSA 1EMDA 3WSVA 3NETA 5A4MS 2WVHA 4FZ3A 4BGDA 1P1JA 1SUWA 3DONA 1NATA 2O20A 2RC5A 2Q3EA 1E2FA 3QNMA 1K6JA 4FGZA 2ZUVA 2IHTA 3ET4A 4YNBA 5CYOA 3A9RA 4EYOA 3UV6A 4X63A 1NW6A 4BX0A 3CX3A 4CUKA 2BE9A 2DQKA 1QTRA 1LLDA 4C1BA 3OIWA 3GZTB 3I53A 1ZD8A 1PHPA 3LNCA 2V7QA 4JQSA 2P77A 4DLNA 4PLGA 5MFPA 3UC5A 5BP7A 1X7YB 3H4VA 1I80A 4JELA 4QYXA 1JJAA 2C97A 5EP1A 2FWMX 3IPYA 3O8NA 1QO9A 1ZMOA 4KZKA 3TEMA 2IPOA 2IV2X 5K6RA 3ZEAA 3D7LA 2BY4A 3PWZA 3O03A 3IAXA 2Q3MA 4LOAA 1AGRA 2NUAB 3PK0A 3PDJA 3SHOA 1BVYF 3QI7A 3SIRA 3F6SA 3W7AA 4B6PA 2QRVB 6REQB 5LQAA 2ZWIA 1ABFA 3DWEX 5B37A 4X84A 3HYSA 2QUIA 3OZWA 4TKUA 2CVOA 2YY7A 1DOHA 2VJDA 3CB4A 3V8QA 4EJ6A 5C2JB 4NHEA 5EJ6A 4X7MA 1W5SA 2VPIA 4E09A 5DASA 2IE8A 3ZNPA 2CBXA 5AW1A 1BOFA 1U1FA 2OFWA 2IYYA 3NKVA 2JEZA 3AR4A 3R5KA 4B5KA 2IVFA 5K2OA 2UXBB 3EPKA 4EAAA 3DLHA 5KNBH 4FHDA 2Q62A 1BDJA 1FQJA 2XY4A 4HVTA 5TMPA 5DWVA 2Y1DA 4OHWA 3PTAA 2PEZA 2VP0A 3KEFA 4CCYA 2HRBA 5ECYA 2QM8A 1RKQA 3GBVA 2EKQA 2C9BA 3M1YA 4RJLA 5L6LB 3AESB 3EIOA 2VA9A 4B45A 5TNXA 1WXGA 4MAFA 1FNNA 3L01A 5JR3A 1P9LA 4D81A 3ZGZA 3F8TA 4G9GA 4AM8A 2IH5A 2Q5FA 3T0IA 1L5HA 1OZGA 4O6VA 4BVBA 2YDYA 2Q6VA 5LPNA 2I71A 1KIMA 2QIOA 3DB2A 4EYKA 4NECA 4B3XA 3FOZA 1NVUQ 2RHDA 1YDHA 3UWOA 4EG3A 4DNOA 4A1FA 3OHMA 4UM9B 2O6LA 3RT7A 2Q0XA 4OSEA 1VMDA 2A33A 2YOGA 4K05A 3ELYA 2R751 5CFQA 4IO1A 2ERXA 2G04A 3B53X 1VYHA 4LW8A 5HS6A 1SGWA 4PG5A 2VATA 1UT6A 3BA1A 2GEVA 2WKWA 1P81A 2FX5A 3EPJA 1C8VB 5CJJA 3FTNA 4FT4A 5G53C 5FPSA 4BMYA 1C30B 4BJ6A 4P8RA 5IZCC 2PY6A 3E84A 2JA2A 3D9QX 1L7PA 1E77A 4D9BA 3ITKA 1Z35A 4MDEA 2P62A 2Z5VA 4Q15A 1VB5A 2VUHB 3STWA 2D00A 4EUFA 1J0AA 1XZCA 3FNFA 4NEHB 3PPIA 5JE8A 4DGQA 4FSHA 3G0DA 3A4MA 3SVZA 3I64A 4FJ0A 4V1CB 3SXPA 5MN6A 2RB5A 1AF7A 3ZN2A 3SZUA 2D06A 4JB0A 5C9ZA 4DNPA 2AD1A 3RVKA 4FLFA 4MUFA 1U7UA 4F0JA 1AGXA 1KOFA 2BOVA 3PC3A 1OASA 4FMCB 4EL0A 1W76A 3HGTA 2J31A 1SZDA 4TM7A 1F5SA 2VO1A 2AMJA 4YBZA 1WPXA 4H4CA 3VVCA 1WBBA 1ACMA 3JWJA 2Q4EA 4L72A 2AUMA 4IG9A 4E5KA 3P9RA 121PA 1QYWA 2IF2A 1RZ3A 3FHOA 1Q7RA 3GRKA 1LF5A 3RU3A 2QJFA 4AQDA 1P3JA 3I9MA 2EJCA 1G8JA 2HU2A 4H7KA 1S2NA 5FTWA 3RO7A 4AJLA 1EESA 4Y7DA 1PL6A 4FFLA 1ZMTA 1QB8A 4CF3A 5HF5A 2R6CA 4QUHA 2GM3A 2IVZA 1R18A 2OLEA 1H0SA 3DKPA 3FFWA 4AKGA 4QGHA 5KTKA 4JC0A 1I6LA 3A1FA 4MKRA 4NJMA 3U3MA 4HYQA 1BS1A 2P6PA 2VAMA 3Q10A 3NIBA 1V2HE 2RHRA 3W8RA 5AKXA 4AKTA 4F71A 2HJRA 3DYVA 5B7NA 1KQFA 1I3KA 4Y2TA 1W85B 2O2YA 2RHHA 4A0RA 4WXRA 4JXXA 2ZBPA 1VMKA 4MIYA 3DL7A 3H8VA 1AUXA 1SU7A 1JQ3A 2ACWA 3BFJA 4JODA 3RIMA 1NXPA 4KE8A 3TS1A 3LCCA 1U0JA 2IYOA 2PEYA 3ELUA 2E21A 4QDUA 4KKVA 1QWOA 2YFYA 1F20A 2CXTA 2ZBDA 4RTNA 5KYXA 5LNK6 3HP7A 5CW2A 4R9NA 2XCQA 4DSUA 4WCVA 3USCS 5JNLA 1QC5A 3QWAA 4GPIB 2GAOA 4ER7A 1XVIA 2CLCX 2AJDA 4CUZA 2J3HA 3DAYA 4JKYA 2QAGB 5LYJB 4PR3A 3SJ7A 1QU2A 5K0TA 2C8KA 2O07A 5U4XA 5DHRA 4EK9A 3DTTA 1L6IA 1MAHA 1QDLB 2A3NA 3I9LA 1EFKA 2AUTA 4OKIA 2W2VA 4D2IA 2WTNA 1WXHA 2GQ0A 3LKVA 5DNAA 4KIWA 3TLGB 3VHLB 1RC8A 1RMYA 1HLPA 1TGYA 4ZRMA 1KE1A 1B0ZA 1E5TA 2E2WA 3ZDQA 1X7DA 1SVWA 3GZ4A 4YO8A 4BKMA 1WHTB 1T9CA 2VDUE 2NM0A 2O1XA 3FRIA 1Z2EA 3K0AA 3KBOA 2FGKA 3I5XA 1Z4PX 2BUCA 2OKGA 2WU4A 2YN2A 4IKEA 3LXMA 2OBNA 3EAQA 2CNOA 2IXGA 3FPBA 1HH4A 1Y4SA 3LHKA 4RVNA 2ZAIA 1O9BA 4EKDA 4EUNA 3QXSA 5AJYA 1D2HA 2OCAA 2RGNC 2D0IA 4IPTA 3TX2A 5D7BA 4CL3A 2OLJA 2W6ZA 3MTEA 1GAXA 4P38A 5JWOA 1LPAB 4BXOB 1E1LA 3AM3A 3AQIA 5G02A 2ZT7A 2ORIA 2JGIA 2BMAA 1E9DA 3IPAA 2AOUB 5AM0A 3U44B 1NBMA 1Q21A 5AVOA 1XK7A 3D3WB 4PM4A 2GYWA 4UUNA 2WFAA 2XSZD 3IT1A 2GD2A 4KR2A 1ECJA 1XNHA 3R20A 3N74A 4CKWA 1G0NA 3BWCA 3KL2A 1FSZA 1PT9A 2MOKA 2BE7A 2HNKA 2P8JA 5IM4A 1RXWA 2BEKA 2PVSA 1Z5NA 4TMZA 3UC9A 2FMIA 1ML3A 2C3YA 1NRJB 3GCWA 3IUJA 1TYCA 1FL9A 3PPWA 5J2TB 4KGDA 5KOJB 3GLFB 4FWIB 3W5IA 2Z56A 3SDBA 3FI9A 4GR9A 3ZE8A 1DJLA 2D8AA 4J43A 3LRPA 3JZMA 1NLZA 4MHOA 5HGXA 3M9LA 2BCGY 5AR1A 5HK9A 1YRAA 2WD9A 1O94C 3H9UA 3QBDA 1CF4A 3URKA 2QORA 4QFDA 3ZWQA 2OZLA 4OP1A 2C9ZA 4F4JA 3HBMA 5I7RA 4CG0A 2UZ1A 3SE0A 2YWJA 4RBNA 4PBSA 5EEHA 5KJCA 3N0WA 1PR4A 4M49A 5BO5A 4DV1B 3ZWPA 2QM0A 3EOBI 1UAYA 2VXCA 5FUWA 1VSQA 1QMPA 2GTIA 2VUUA 3TQHA 3M4JA 4G24A 4Z49A 1WPRA 5JNUA 3M6MD 3HCCA 5IDYA 1HQCA 3LCVB 1B1CA 1OWLA 4X60A 2I6SA 4MEBA 3ESBA 1PSWA 1QO7A 2HDWA 4S1NA 5ALVA 4EY4A 1O03A 1AC5A 2JJ2A 1WTAA 3JQAD 3PUWA 4MVYA 4YCAA 3RU2A 3VGJA 4F5WA 5KJFA 3I9JA 2D1FA 3ZWYA 1UL1X 1Z5UA 4FEEA 4LSZA 5H70A 3QVGB 3JRNA 2FWPA 3H6HA 1RMTA 3EVDA 1AQIA 1DLJA 1Q2XA 1V71A 2XE8A 1HNZB 1ZWLA 5A62A 2GILA 3G0GA 4LYFA 4OREX 2YBDA 3GXOA 1Q7BA 2P65A 4MUMA 1N8TA 3HKBA 2YTZA 2V7UA 4B0OA 1NLFA 1MFPA 3GAMA 3LQQA 2OCDA 3OJCA 2XGOA 2A9PA 4L85A 4PC3A 1W5BA 2JH9A 1X1CA 4IRUB 5T5QA 2FR0A 1V7ZA 2J6CA 2V4UA 4Y2RA 4O4LA 3S68A 5EHIA 3DHNA 1FS5A 3N53A 4LRXA 2F1IA 4MX8A 4ZVRA 2Y27A 5KTTA 4BO5A 1REQA 1SHKA 3L8CA 2BN4A 1EFPB 4OHFA 5JCXA 1ORWA 3A04A 5BNIA 3MTJA 4ZQGA 2CNWD 4XEUA 5F76A 1B6GA 3JZFA 2G4LA 1M6WA 1OX4A 1VSBA 4V0QA 2ZRIA 2F17A 4BATA 3RSFA 2ZSHA 4FYMA 3F3MA 2X76A 2CJPA 2P1ZA 5AJUA 3KV1A 3NHYA 3HO6A 1ZGHA 2GHIA 3SQMA 1CEQA 1NI4B 4F3YA 2C2ZA 3ELWA 2O2HA 1TMOA 5DB4A 5ESWA 1NWCA 3CH6A 1J56A 3OWHA 2P2LA 5EXXA 3STHA 1F2VA 1U4OA 2JBAA 5AHRA 1Q3HA 4QLOA 1JEJA 4N5IX 3ZZ1A 4BMNA 3UYLA 1U3TA 3D3JA 5M04A 5ITZA 2Q5LA 4DREA 3TEJA 3OM1A 4MITA 4PLTA 3V1UA 2VKQA 1EVIA 3H6GA 2J3LA 1WKBA 2P40A 3Q7PA 4LRWA 4O25A 3T1YB 3KPJA 4Q7LA 3W3AD 3T9FA 1TTTA 4YAKA 3S55A 1S2GA 1CETA 2LIPA 2XWJI 2GX6A 3D8UA 5DM0A 3F3YA 1Q0RA 2HO5A 3J80A 2NO9A 5F9FA 1VCOA 1E3EA 3L5KA 1JXOA 1QF7A 1KAHA 1KY2A 4QNNA 5B2FA 3O0DA 3PXBA 3EB9A 1ULAA 4IJ5A 3QE2A 4MGEA 3PNMA 1OT5A 3AUXA 1XRMA 3QTTA 4MLCA 5B1EA 4KR9A 1EB9A 4B8WA 1Z4LA 4DAEA 1QVZA 1U0EA 2AOVA 1GG2A 4X6YA 2WJZB 2CJWA 5KOHB 1CUHA 4WESB 1PGOA 1CE8B 1OAAA 1VM6A 3CC8A 1DWQA 3AY7A 3DEJA 3GJQA 3T7CA 1YCFA 4XPIB 4CFZA 2QJRA 1C0PA 1DPGA 2PFKA 2VYVA 1NDQA 1JZSA 3FMGA 2X40A 3U4MA 5K4AA 4B3GA 1XXLA 2WZQA 2OHXA 3RS9A 2QMHA 4XARA 5BQXA 5KJ1A 4OHYA 1H8HA 3U7FB 2B7LA 2FMHA 2I99A 1DIRA 3FIJA 4L27A 3S2EA 4ZMRA 1TYEB 4N47A 1HR0B 2AMYA 1X92A 3N2EA 1N3IA 3RVMA 4AY2A 2ZIGA 4L4ZA 3UT5B 1Q15A 2O7SA 5LQJA 5C53B 2ZSKA 2XQKA 1VGQA 3L4EA 1YD7A 3SS9X 4AJ2A 4UTRA 1K5GA 1M1ZA 1U4NA 2ICAA 2MT9A 1UMCA 1AMNA 5AXDA 1OROA 2RHWA 3HEMA 4MKFA 3UO8B 4GLOA 4EPWA 5JEEA 3DEZA 1E3TA 2WAYA 2ZVPX 4RKEA 5AM1A 3VNQA 1LLFA 4C0BA 1M72A 1HZJA 3F5MA 4TTAA 1JP7A 1HE8B 4DLYA 1U02A 4Z53A 5A9SA 3L8HA 4W1QA 1E69A 3QLUA 2C78A 1XDDA 1X1DA 1ZN2A 2YVLA 4RYLA 4BZWA 4L78A 1DQSA 1XAHA 3GDOA 1CY7A 2DUUA 1O5OA 1WB9A 1GTSA 2A9RA 1IWBB 1Z4NA 3IQEA 4AG6A 4QPDA 1B8NA 1N5LA 2H9IA 4HTAA 5ALPA 4YT8A 2VRCD 1UXJA 1NWHA 1QXSA 3OCVA 1UWCA 3TRHA 5JAIA 5JQWA 4BNFA 1Y9EA 1JQ5A 2GMWA 4XVHA 2CL6X 2JGLA 3U37A 3CRRA 1Q3TA 1PR0A 3DKIA 3CUVA 3QPCA 4NY1A 4YCNA 4Q19A 3H05A 3FGOA 4MYCA 5TJHA 5H02A 3HY6A 2RB4A 3A1UA 1P5FA 1LC3A 2ZIXB 5DM1A 3RSCA 1MW9X 1QBKC 4AMUA 4XX0A 4AXXA 4LF7B 2HW8A 2OHOA 1TVKB 2XKAA 2O7QA 3GRFA 1QFSA 2P3QA 3GDFA 4RGBA 4LJRA 2FW6A 4URVR 2H48A 1KOLA 3RRJA 3RNLA 1JKFA 2Y4OA 1FFEA 1PX2A 2GAIA 4J9VA 1M75A 3DLTA 1XQWA 2A1UB 3JTMA 3NC0C 4I6JA 4QTTB 3CSSA 1MH9A 4BLTA 4BWVA 4MQEB 1PYGA 4P5PA 1SAYA 3CYFA 1ZD1A 2M9MA 5TPWA 3HU1A 3KTAA 1XI2A 5G1OA 2LUOA 1YA6A 1Y8QB 3VV3A 3PZRA 2QRHA 1KJ9A 2RH9B 5DTQA 3AEXA 2JAXA 1W88A 5KZMB 5LSAA 4KPYA 2GDZA 1UBNA 1E3DA 2MSLA 4G0WA 2P8SA 3DCIA 4OLBA 1V7QA 3EW9A 1NFFA 2C2MA 1CG6A 3N0RA 3OE7A 2HXGA 1GLGA 5DOZA 1Z4QA 2GN9A 3K0KA 4GPTA 1L8QA 1AQYA 3ZDBA 4LK2A 1INLA 3JQ8A 1R4AA 3VZSA 1CUVA 1ZM2A 2P5SA 2AQ8A 3ENZA 1I6KA 1YKGA 4FI3C 1KO1A 2WUVA 3GFPA 2SBTA 4PO9A 1HE4A 1OHHD 2G1AA 2C77A 4JKIA 1UJ4A 4ZANA 3NWEA 2IU3A 5GPBA 1G16A 4H7PA 1LZLA 4PFJA 3K9GA 1TKCA 2YYSA 1T3SA 2HK8A 2ODPA 3NDJA 3OBBA 4AKIA 4JJ7A 2I91A 3NHZA 2Q5IA 2ZQ5A 5ERGB 2R2GA 1R6XA 1VA4A 1BGVA 1U3UA 3NMUF 5B1SA 2CXUA 2NSDA 2W83A 4NYMR 2VJNA 1ZICA 3BSYA 2ZUEA 2QN3A 3O2QB 1SCNE 5JWRA 1MDBA 1NE7A 1EM8B 1URPA 2DSNA 1ZJYA 3RT1A 5K45A 5HBGA 4A82A 3AGPA 5IUNC 4DKXA 2ZIUB 4FDUA 1K06A 3DZCA 3WXMA 5JYBA 3GLFE 1R0BA 3KUKA 3WGMA 3IMFA 4BP1A 4RQUA 3CRNA 1I4EB 1V1MA 4OFZA 2R5NA 4BV3A 5DMXA 4U2BA 5CDHA 4FFOA 4AYWA 1EFVA 1I1NA 1V5IA 2O3JA 3AV0B 5DX1A 2H1IA 4RHFA 3V3TA 1EUCA 4TS4A 2YXEA 5ES4B 2ZYTX 3T52A 4O4LF 3EIWA 3QXXA 3U2QA 1IBSA 3SR3A 2NU8A 3HWRA 4DW8A 1EGVB 3AHDA 4MR9B 2JHCA 4NBUA 4JB3A 1BU5A 1P8AA 2ONKA 3KOOA 2AS0A 4HB0A 4OB8A 4TWAA 5CDGA 1RLJA 3A14A 4ZVSA 2NPFA 1OFVA 3NUGA 1PCXA 1GTMA 3OJ0A 3KKEA 1R8YA 4R54A 2HQOA 2JFBA 4Q48A 1TIPA 2QRJA 4INPA 2L42A 4KSBA 5AHOA 3V6MA 2VL7A 4B2IA 3LU1A 4D5EA 2P9EA 4HH1A 4OPMA 4MSUA 4R2HA 3CLRC 1CRWG 1DFIA 1ECCA 1WLSA 1R5NA 3CJRA 3BEDA 4WOJA 3H9JA 4K3UA 1SBTA 5KNDH 3T5PA 1XA3A 3W2EA 4EY8A 5K8UA 2O8EB 2E85A 5D00A 1L5FA 2HTFA 2OP1A 4OJQA 4NZZA 3N5KA 3DJFA 4WY2A 2VA8A 4HHEA 1ISHA 3KZCA 1MAUA 1P6UA 1RJGA 1TIBA 2NU6B 4G0PA 4RVSA 3Q8XB 3JALA 2PGJA 3O4HA 4CKBB 5B1DA 4GFDA 1GN8A 2O8BB 4FEYA 3W04A 5IFLA 1QKIA 3HB1A 3D8TA 4WY8A 3R4VA 4Z8XA 3TR5A 4QVGA 3TNDA 1MA3A 1W0JA 2DUJA 3PA8A 4WTOA 2RG7A 2ZTLA 4Y67A 4N5LA 3PT5A 2BISA 3K35A 3UW3A 4BCBA 1A4UA 1WB6A 3K9LA 2H1SA 3KXLA 4HDAA 1ISFA 2X5JO 1V6SA 4HLUC 2CBZA 3BMOB 2QAIA 1UJBA 4R2MA 1XEFA 2ZPTX 3TJMA 4DN6A 1DXHA 4QEKA 5F52A 2GFHA 3PFKA 2I4TA 4A6PA 1KPIA 4YMWA 1KXJA 3HKDA 3RK4A 5AESA 2WIKA 1YBHA 1AKVA 4V3CA 2IEDA 3E2PA 3O93A 1Z07A 5BYJA 4KSCA 1ZXLA 4EDHA 1WUTA 2B3DA 3AG6A 1FRFS 3EH1A 2DBQA 4R31A 1ZVQA 3C1UA 4ARZA 4Z9YA 1UBKS 2PKRA 5C3UA 2VSOA 3ZGNA 3WFZA 4JSYA 1KI2A 1LQUA 1WMAA 3UV3A 4A0GA 1WD5A 2XZLA 1W48A 3WQHA 2FPGB 1JEQA 4E6PA 4TS3A 1XZAA 2C2XA 3TPZA 1MX3A 1V1JA 2FQQA 2JD0A 2CNLA 2V8OA 4GZLA 4B8YA 2WBLC 1N2EA 4H08A 3SF8B 1NBOA 1G5RA 5ICMA 2JLYA 7ABPA 2UU9B 1IPFA 1WXEA 4GOMD 5HF9A 3WZMA 2IC5A 2D2IA 4MRRA 3A8TA 1F4VA 2NLOA 3IIIA 2B4RO 3P0RA 3Q3HA 2LE0A 1XE3A 1D03A 4JP5A 3GGGA 4XIGS 4BNUA 1M6NA 3I1JA 1RLMA 1O6CA 4J0KA 5DM60 3RKUA 1DUIA 1A8UA 2AT1A 2BM8A 3ZNOA 4JBYA 4A8JC 1DG9A 1GY8A 3K1TA 2IIPA 4M7PA 1E32A 4IZOA 4QJIA 4DSOA 1QFZA 2DQ4A 3H16A 3GPBA 3QFSA 3TFQA 1FDSA 2Y1XA 1E5LA 2H6EA 3UUFA 2FHPA 1R0ZA 1TUGA 2P0AA 1S2LA 5GONB 3S5JA 4F72A 4XUDA 5TVGA 2CLLB 3R75A 1SFRA 1Z6QA 2ZB2A 2AEEA 2CUTA 5AD1A 3BXEA 2Z5FA 3W6UA 2YYYA 1E2NA 1BXRA 2X8AA 2WDPA 1H4TA 1FDIA 4TL6A 3CR3C 5TARA 3THRA 4BCCA 5BMOA 3EIEA 4G5OA 4J0FA 5E1OA 5C7LO 3EQ9A 2VJYA 3IR5A 1J22A 1PR3A 2I8AA 4B46A 2QMEA 1OWOA 1JIXA 3M1LA 1Q16A 3N76A 1J99A 4KXVA 3O9MA 4OLHA 4DA7A 1L5MA 4FFVA 4X0EA 5C51B 3FSRA 2YWFA 1SIOA 2E48A 2X9GA 4HDSB 3I8OA 4KL8S 4V2UA 1NR1A 2OVFA 4Z9XA 5CK4A 1XDBA 3SC4A 1TM5E 1ZH4A 5K09A 3L1UA 1FFXB 1X70A 2AOTB 3QKUA 3OJXA 4QDKA 2V7EA 2X3YA 3TE6A 2B0JA 4C7BA 1D2EA 3NVDA 1E66A 4FGWA 5IDQA 2WK1A 3OEHD 2FPOA 3ZH9B 4ZDKA 1UKYA 1F7VA 4UW9A 2RGAA 4G5FA 2E4UA 3INGA 3G9QA 3BGWA 3SXJA 1NPYA 2B7BA 1AKTA 4B33A 1AURA 1JGTA 3CH5A 2PX2A 1AK1A 3PQ6A 4LKRA 1G20A 4Y7CA 4G4SP 2C4UA 4L75A 5HQ3B 1ZHOA 2OCPA 3C3KA 1BH2A 1HGXA 1U2SA 2FQ1A 3BMNB 3OZUA 3ZCRA 4D6YA 4D99A 4Q7QA 2KMLA 4DXHA 2OORC 3QPUA 3SU8A 2QVLA 5LD2C 2FFAA 1QF6A 5CNJA 4D45A 4BVAA 3FLEA 2QG4A 4AY5A 4FILA 4OAOA 2E3JA 3NHUA 3F7TA 1UKZA 2WWFA 4DQKA 4C7KA 1NDHA 4LQ4A 3R6WA 3H1EA 3C3JA 1LJLA 1M2JA 1SCAA 1A9OA 1VCMA 1PTJC 3BCRA 4X8MA 1M2HA 1Q12A 4FYHA 3WK7A 1TL7C 4BHTA 4EDFA 1R1DA 2UUPA 2OXEA 4FZ5A 2VSQA 2BPOA 3LHDA 2OOKA 4H18A 2AFVA 3I6ZA 4MYTA 2WP8J 5I7HA 4U7PB 3U0VA 3NKFA 1ZSNA 4FTWA 1QO0A 5CHYA 2HJSA 3DTVD 1YT5A 4QFMA 1W2GA 2VTEA 2IDZA 3B82A 4JEIA 1ATIA 2PXAA 4I1YA 3E3OA 3G0IA 2MR6A 4FYPA 3O7WA 3NHFA 4TL8A 2QU8A 5BSRA 3PFGA 1D7OA 1ZOSA 4K0RA 4CU5A 2QB5A 3MYYA 1G1AA 3RLIA 4F1KA 1RYNA 2BFWA 2BLNA 2OECA 1ESMA 2C5EA 2KJQA 2XLBA 4XW2A 4JBGA 1M76A 1Z0AA 1E2KA 1U6KA 4TPKA 1ZKDA 2VWGA 4KAJA 5FQOA 1S3SA 1BCSB 5AVXA 2NO6A 2BJVA 2FWJA 3QKRB 3LX4A 1RYBA 2XXAB 4IHQA 4U3JB 2DPXA 5I3ZA 3CKLA 4ZHSA 1KI6B 3L79A 4KVAA 3GRAA 2FMXA 1GEEA 2V5UA 1PR5A 2PK3A 3HB5X 5AXBA 1DTEA 5JZVA 4UOZA 3UWMA 1O5TA 2ZT5A 3QRWA 4O0MA 3M49A 1FLDA 4IX9A 2IDJA 2V65A 3MOSA 4GYWA 1QV9A 2ODTX 1POWA 3NBZC 1HDEA 4OXRA 3DQPA 3Q85A 1O57A 1USUA 1RJWA 2ZJ5A 2TMKA 2C9CA 3EA5A 4M0EA 3VRHA 3X1XA 3ZBPA 4JT2A 5L3ZA 3UAYA 2XQVA 1L3BA 3OZXA 1NSTA 3HB7A 4AZ3A 4MLPA 2YZKA 3OTGA 3RC3A 2XB2A 1TCAA 4GRDA 3L0YA 1TKAA 3VO8A 4JR1A 2Z8ZA 3B5IA 3SM3A 3ASVA 1RKUA 2V9ZA 3RARA 3VR0A 5LR6A 1BGWA 3SC3A 2VTDA 2GHRA 5KYKA 2FOIA 2GESA 1L8LA 2G25A 5ADVA 1VECA 2GPNA 3B78A 5HJEA 2BR4A 2CUZA 2F7SA 3TCNA 1XNGA 1X19A 1FRQA 3L6BA 3L0OA 2N75A 1QYVA 2F4VB 3KXPA 2EFCB 2VWPA 1NUPA 1N1EA 2XUJA 2AZXA 4CDGA 1VHLA 2P6RA 1KDTA 1GAJA 1E99A 2FE4A 2LXNA 5JC1A 4KVFA 5E1BA 2GR9A 2GPBA 4MQFA 4MVJD 4Q3LA 4ZODA 2P1DA 3FMVA 2OHVA 4CMEA 3L4KA 4GVPA 1LGYA 4E12A 1V3TA 3L0SA 3FRHA 3FOCA 4NCXA 2CYCA 2V6GA 1CZKA 2PKQP 2NU9A 2C4MA 3MXTA 4LVCA 5J9FA 1L4KA 3U19A 4UHBA 4R2JA 4I1PA 3NRBA 2ZRJA 4CNQA 3Q15C 2YRWA 4JLBA 3I6IA 2V9CA 1K86A 1OTYA 2BGNA 2HSEA 5GAJA 2H1VA 2W2MA 3K70D 4XSVA 1G8YA 4BO2A 4DGSA 3DH0A 1UKAA 1Q1AA 1UXKA 2VQ3A 3QVOA 4MUNA 3WK4A 2OGWA 4N0PA 1GCUA 1WCIB 2VXOA 5AW7A 4N8EA 3HJNA 1ENYA 1W94A 1XG5A 4XRRA 2J0UA 3DOIA 1XA0A 2WM2A 1QCZA 1E64A 1NT4A 3DLPX 2BF4A 4AZTA 4E03A 5FEUA 4RGQA 4MUBA 5FTJA 2HH9A 4E5NA 2WTAA 3JVIA 1KFBB 4ECEA 4URZR 1JQAA 2I66A 2AHOA 2YFKA 4LYYA 4MVJH 3QEOA 3GEMA 3NTOA 4EHJA 2AEFA 2YC2C 1L5LA 4L4XA 5I7FA 5BR7A 1IN8A 1I51A 1N5IA 3KZKA 4TKVA 1M1NA 3KWJA 4G4SO 4ITUA 4RVHA 3BTUA 2WUGA 5IWAB 3FROA 3O92A 2L18A 2N0SA 3KB8A 1CUFA 5FOTA 5CA1B 5IZ4A 1SH7A 4Q05A 5DO9A 4UJ3A 5E6SA 3PI6A 1C50A 4NPCA 1Z4MA 4B32A 1ADFA 1P1RA 3D3KA 3EAFA 4DKJA 1DCMA 3EUFA 1TW3A 5J4YA 3EGWA 1YQDA 2O1WA 1R15A 1FS6A 4WRRA 3PJRA 1E1RD 3F7MA 1DARA 5FDFA 3I32A 1DZ3A 1SZJG 5AI0A 5KU7A 4NAHA 4ZPXA 3T3EA 3QYAA 2BBTA 4ZOCA 1SCKA 2XUOA 3RD5A 3KLBA 4ZRNA 5FAXA 3N59A 2X0DA 4ICIA 2RARA 4JXKA 4OKSA 4DV4B 1FBNA 3DWIA 1KERA 3SYNA 2PXXA 4FYVA 3AL2A 5KCZA 1O2DA 4RU1A 1K2WA 3CO0S 3OPQA 1XN1A 1P3Y1 1PAUA 4W7HA 2C7RA 2GGSA 3JD2A 3KFXA 2DBRA 2VR1A 3MB8A 3DL0A 1O3YA 4DR5B 2A0UA 3O74A 4J9UE 1ZN8A 4KWEA 2IPAB 1ZBQA 1T2AA 4PEVA 3OWXA 1L7OA 1SOAA 1Y3IA 2QTLA 2A14A 1X6VA 3N7UA 3NIWA 1UJ2A 3GLGE 1ZIXA 3RSGA 3GCDA 5J43A 3WKEA 2JCVA 4K87A 1JMKC 5HE9A 4MA4A 3RAGA 1E1MA 2PAAA 2DTEA 1ESEA 5KVCA 4TXHA 1Y89A 5JLJA 3LFHA 3ND8A 2DWCA 4P1ZA 3NC4A 4F2GA 5FUMA 2AHRA 3HSYA 4QBHA 1DAHA 3RRZA 4EHAA 4IDDA 2IPXA 2QMOA 3A7DA 2W8BB 3CW9A 4BJ3A 4YH1A 1E0AA 4CLXA 1KO5A 4HDQB 4BP8A 4R2KA 2IGBA 1OXUA 4U7JA 4W99A 2V97A 2HA7A 2OHHA 1SC6A 5LQKA 3WZLA 2Q6TA 4QUDA 2ODWA 1N2BA 4IW3B 1EFDN 1USGA 2I2FA 4Y0NA 5JTTA 3NWPA 1ZD4A 3QV2A 5KOIA 3BT7A 1C8KA 1XDUA 2JIZD 1WV1A 4QHSA 3FYTA 2WHQA 3WR5A 1T36B 4B48A 2IYZA 3RIXA 1EIZA 1FYWA 2HMUA 1E1YA 3IXQA 1TJYA 3WDSA 1A3CA 3GJYA 4HVAA 3FYCA 3C5VA 2GTHA 2ZE8A 2IXDA 4PS1A 3SKVA 4MICA 5C1DA 3TLAA 5JDIC 3PR1A 1KI7A 1NXOA 2Q45A 3A0RB 1ZY2A 3EA0A 3GOQA 3KR2A 4OSPA 5AQEA 3T99A 1FIUA 2EDCA 5TT0A 3WMXA 2WM3A 4DUZB 4LN1A 4Z9FA 4ETMA 3CPHA 4FGLA 1O6ZA 1V1RA 2XODA 3B7GA 3HQ4O 3JSXA 3K8ZA 4GI7A 4ZEMA 2PKQO 2PSDA 4I4IA 4WOCA 5B6JA 3JQRA 4TWJA 1U0HC 4CLEA 3AF3A 2IOFA 2R48A 2C9DA 1M5RA 4JLWA 3L2OB 2UV8A 4M22A 3CZPA 3O3MB 4OA5A 4QFCA 4X92A 5FPQA 2OV2A 3VDNB 4BFLA 2BKUA 4YAOA 5MFZA 5JS1A 4L74A 2XF8A 2QN8A 1CHDA 1GZ4A 1XC7A 1GCAA 5B1YA 1J7KA 1OZFA 1IDN1 1JJVA 1Z5GA 2IUSA 1E6MA 1OFHA 4GW3A 1VE6A 5FH9A 1J24A 1P0MA 3MK31 5H68A 4NBLA 4UVEA 5F7JA 1I9GA 1BO6A 3D1JA 4W7IA 3J81A 3GT4A 3S8EA 4KHZA 3DXFA 1MB2A 5HZMA 1BW9A 4AKHA 3CONA 1RIIA 1L7RA 1UFVA 2BR3A 2C4TA 4R0NA 3H2KA 4MV1A 2AJ8A 1SZPA 1V26A 1JECA 5FHQA 3VSDA 1RM4A 3SZOA 4AUNA 4EKNB 4HPWA 3U7GA 1W6RA 4JA0A 2OO7A 4XWGA 1DKMA 3BJMA 4IUDS 2GZMA 4NWIA 1VKJA 1SXHA 1QWSA 2XA9A 1L9KA 3NTXA 3U9LA 5C18A 4G5RA 3HCWA 4PCVA 2PJZA 1T0IA 4FFNA 1KAQA 2QL9A 1T5LA 2YUIA 3BRCA 3JASA 4FYKA 1DLIA 1OC2A 1DS6A 1WLYA 2YVQA 3IPRA 5FI3A 4EQ6A 4TZ6A 4J94A 4ID9A 3MUNA 4CM9D 1QDEA 1XLUA 1TC2A 3AR3A 1M2KA <