4GBMA

Sulfotransferase domain from the curacin biosynthetic pathway
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
b'SRLPGIIFILSSPRSGSTLLRVMLAGHSSLFSPPELHLLPFNTMKERQEQLNLSYLGEGLQKTFMEVKNLDATASQALIKDLESQNLSIQQVYGMLQENIAPRLLVDKSPTYAMEPTILERGEALFANSKYIYLVRHPYSVIESFVRMRMQKLVGLGEENPYRVAEQVWAKSNQNILNFLSQLEPERQHQIRYEDLVKKPQQVLSQLCDFLNVPFEPELLQPYQGDRMTGGVHAASLSISDPNFLKHNTIDESLADKWKTIQLPYPLKSETQRIASQLSYELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurM Sulfotransferase
molecule tags Transferase
source organism Moorea producta
publication title Structural basis of functional group activation by sulfotransferases in complex metabolic pathways.
pubmed doi rcsb
total genus 101
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gbmA00
4QFMA 4JLPA 4A9AA 2RGBA 3MJRA 1E98A 2F43A 5FUYA 2HCJB 3GFPA 4CT5A 2KBEA 4CVNA 3EZ6A 2JLRA 1M7HA 2F6RA 2G0TA 4US0R 1AGPA 1WXQA 3N5CA 3A1UA 5KTYA 3K09C 4PC7A 3L2OB 3W6OA 3ZH9B 2IBMA 4PHHA 3RS7A 4PSVA 1NN1A 5EQTA 2V6JA 4DUGA 1YVDA 4MKHA 2D4HA 2HJVA 4P32A 4MRRA 4B6FA 2IYZA 3C8UA 5FR1A 3IUYA 4JLOA 2O8BB 1JR6A 1NRJB 1VDZA 1XD8A 621PA 4BECA 2H5EA 4DCUA 3KJEA 2ZYWX 2VA8A 2WKRA 4DUGD 3SC3A 4LUCA 1NI3A 4RD1A 3A1SA 5DSZA 2XTZA 3IILA 1P3JA 5KU1A 4BZPA 1B0UA 3MWYW 2ZI4A 1FL9A 2BKUA 3ADDA 2PZEA 4FWIB 1OHHD 1XRJA 1NVWQ 3U61B 5JHHB 2A5FA 1KO1A 3EIHA 5DH9A 3Q7PA 4EPXA 2AXNA 4NCIA 2O8CB 5KSOA 2WWXA 4BRWA 1BO6A 4W5HA 2JJ2A 1FNNA 2XAUA 2GDJA 3NBXX 5DHFA 5DI3B 4NYMQ 3TUIC 2BV3A 5KNDA 1E0AA 3A4NA 4L9WA 4QXAA 1YZGA 4Q9JA 3GLIA 4URYR 4DLSA 5LBIA 2IC5A 4YXWD 2GTPA 3NH6A 5GJWC 1TEXA 4YC7A 5JI3E 2FFAA 3BH7A 2V6IA 3LW8A 1KI6B 2R2AA 3BE4A 3FMIA 1HTWA 5DGXA 2RGNC 4PX9A 2KE5A 2IS4A 5AUNB 4YMSA 3KL4A 3UATA 1MO3A 2VLIA 2WJVA 2ODBA 3NDPA 5JSZB 3EIQA 1QF9A 5FTJA 1W48A 3EA0A 3HDTA 2ATVA 2GETA 1GFIA 4AKHA 2HEIA 5DHAA 1IONA 5EXXA 3FMOB 2A30A 2VP5A 1ZBDA 5KPJA 5SZHB 1ZM7A 4DVGA 3TKLA 3K70C 1JPJA 1Z2AA 4JBXA 3BJIC 1QG4A 2BJVA 2OILA 5TXGA 1OFIA 2IHBA 5B58C 4C4PA 1JQLB 2FN4A 3I92A 2FSIA 1OIXA 1Z5ZA 1OLOA 3L82B 1YZNA 4C0QC 4OHWA 2W00A 2UZIR 4EIWA 3IIMA 4F4CA 1D6JA 1RJ9B 2NOAA 3GEHA 2CLDX 1W47A 2MSCB 2VBCA 1G18A 1TQDA 3NXSA 4RZ3A 3CO5A 1KSGA 2ZIAA 4NYIR 3VKWA 3C7KA 3R7WB 1ODFA 3T06B 1UAAA 1R0ZA 5J4YA 3TUZC 2NGRA 1JEEA 2IS6A 2YZ2A 2ZSEA 4JT4A 3AEZA 4KFRA 4G1UC 1G8GA 4A92A 1G3MA 1G8YA 4P3YA 2GXSA 2BEJA 1QDEA 3WHLA 5LB2A 3ZZ0A 3UMSA 3E1SA 4QJ3A 1S9HA 3QXHA 2Q0HA 4I81A 1IM2A 4FIDA 4IVQA 5BN4A 3PCRB 5HZKA 2D2EA 2J5XA 4EJSA 4Q4HA 4DDWA 4L8GA 2VSOA 2YOFA 5HTKA 5HR5A 4M9XA 4YMWA 4PAOA 3EIEA 3H4MA 4OHVA 2K5UA 3QXSA 4D4KA 1NLYA 8OHMA 1JEDA 4A8JB 1KI3A 3H86A 4HZIA 4NTZA 1Z6XA 3AGQA 4KFTA 2F1HA 2PT7A 4MQBA 3I61A 3U5ZB 2Z4RA 5IK2A 2B8TA 4TMVA 1R5BA 2QMHA 2ZE7A 2RH5A 2DWOA 1GG2A 1RRCA 4DCSA 4Q1EA 5E3HA 4R7ZA 1W49A 5AJXA 1IJFA 1SVLA 1J8MF 4S35A 1Y63A 2ZRKA 5E95A 3ZZUA 3B8HA 2O8EA 2WJGA 1VKJA 1SHKA 3SN6A 5FTKA 3VFDA 2P5SA 4DCTA 3THXA 1CF4A 4E22A 1T91A 4PC3A 1E94E 1LW7A 3ND9A 1GITA 3CIOA 2OFXA 1N0UA 2O0KA 3EXAA 4HB2A 4DSUA 3DHWC 3LLUA 1G7TA 4M22A 1C1YA 3KXKA 2EFDB 4LBVA 3UANA 3U44A 3VKHA 2O8FB 4V0ME 3LH5A 1W0KA 4OK3A 3KX2A 4O3MA 1KY3A 1ELOA 4KXFB 1ZNYA 3B5JA 3GCGA 1MO6A 4PO9A 1ZVQA 2CCKA 2OV2A 4OQFA 3MLEA 4IOMA 4CEHB 1GM5A 4IEIA 5HZHA 3A36A 4IXMA 3GJXC 2QU8A 4JIMA 4OHXA 1BOFA 2MMGA 2CK3D 4BFZA 4FCWA 1U0LA 4O25A 1U98A 5FTNA 2FFQA 4UNNA 4TLDA 1J2JA 3AF1A 1XD9A 3LBNA 4DEYA 3ICEA 4P4SB 3MG9A 2WJIA 2WWIA 4PFSA 1IXZA 4M4SA 2P67A 1P61B 2D7DA 2OE2A 4Q5IA 1FPMA 5FOSA 1AS2A 4RD0A 4KFSA 1IXRC 3CPJB 3CZQA 2A3RA 3KFVA 5JECA 4DDVA 2R8RA 2XX3A 3DKPA 3B60A 4ZDJA 4E5UA 3THYB 3K0AA 1D2MA 2RKOA 3PFIA 1P62B 4PC6A 1TF2A 2QMUA 2WWYA 3MWJA 2IYSA 1KHTA 3NVAA 2ZETA 3TSOA 2QMEA 1L4YA 1A7JA 1FOEB 1NF3A 4NHOA 2PX0A 3LXXA 3BS4A 1UPTA 3C4JA 5BWMA 3ZVNA 2QBYA 1GIAA 2L0XA 1P9NA 2ZI7A 2SHKA 3HJNA 4ESHA 4TZ0A 3WXMA 1Q20A 2GJSA 3KTAA 4BWYA 1Z0JA 5FPKA 4FI3C 1S0UA 4Z1MD 2AWOA 1T0JB 1H8HA 1CJUC 3U3MA 4HB3A 1ZD8A 4GRAA 2BMEA 2WJJA 1ESMA 1OPXA 4UKDA 4B3BA 1Z28A 4JVMA 1GZSA 2WKPA 3RYTC 4G5OA 1WBBA 5DE3A 2GRJA 5CJ2A 1DEKA 4ZDIA 1QHHB 5GJVC 2BM1A 3RWMB 4QJ4A 4LJ7A 4N3NA 4BFWA 2IA5A 3GLFE 4XWKA 1US8B 1NP6A 3TW4A 1QHGA 2I1VB 2XITA 4KYUA 1FX0A 3Q5DA 1RC8A 4ZKEA 1GRNA 4V0LA 1QHHA 3I3SR 2DBYA 4NYMR 1KK2A 1XPUA 3ZDQA 2GK6A 1XXHA 1D2EA 2ZE8A 1DBSA 2VP4A 1XTRA 3GJ0A 5FI1B 1E9SA 2V7QD 2VP2A 4LX0A 4ACBA 4ZCIA 5J4VA 2PCLA 2OBNA 1XEXB 3ZQ6A 1HE1C 1UKZA 3KFXA 2N42A 4F4IA 4ZIRA 1WRBA 2CBZA 4KO8A 1W2HA 2HUPA 4QM7A 4II7A 1P2TA 4C2UA 4V0MA 4NDZA 3AP1A 4GOXA 1F5NA 1S3GA 2C9OA 2YWFA 2FE4A 3CWZA 2A5DA 1Z07A 2NO6A 3KKQA 5K8IA 4GT1A 4B75A 5BW8A 3UMRA 3R8FA 1I4DD 1WB9A 1WDTA 3V00A 2AN9A 3KQUA 1OF1A 5AUPB 1DAHA 4DRZA 5JFGA 1CULC 1IHUA 1ZM4A 2GAAA 5EE3A 4C0HA 1G3IA 4WA7A 3RRNA 2BOVA 4G5QA 4L16A 4O0MA 1L4UA 3JZAA 4LY6A 2IS2A 4XJXA 4AI6A 1OH7A 1S2MA 1EG7A 3IO5A 4PTLA 3U3JA 4Q4JB 4CEIA 2XGJA 2JLQA 3ZS8A 1S9DA 2XTNA 1T6NA 2XOKA 3EZ7A 3LA6A 4A6PA 1MABA 4LRWA 4F38A 4L5BA 5JI2E 1KI7A 3LD9A 4BFSA 4DHEA 1GNRA 1IN8A 4EKDA 3MWLA 3U7GA 1M34E 1CRQA 3OIUA 2I4IA 3PUYA 1TADA 3LY5A 4Q03A 4D82A 5GVRA 4DEXA 4EQ6A 3GLGB 4XWOA 2GXAA 4NYIQ 5HCIA 1PUIA 4C0JA 1E9RA 3UKDA 2LWIA 3CW2A 5KNBA 2F9LA 2JLUA 5L8VA 2OAP1 121PA 4M9QA 1E2MA 5FBQB 3OE7A 3OEHD 5FH9A 4NBSA 3IEVA 1S96A 3ASZA 4JS0A 2XSZA 3CH4B 1RE0A 4ARZB 1HT2E 1KI1A 5L3VA 1FMJA 3H1TA 2J0QA 2H18A 2JGNA 2QPOA 1ZD9A 3KJHA 3T15A 3OEHA 5HE8A 1G20E 4PPNA 3EARA 4DWJA 1FUUA 5L3QA 4B48A 3JVUA 1II0A 4KFUA 1CXZA 2WSMA 2J87A 3G82C 3QQ5A 4PHFA 4CEHA 4R2IA 1Z0FA 3WNBA 3KKOA 2ZEJA 2D74A 5B64A 4JLBA 1R8SA 5J40A 1O3YA 2ZYTX 4D81A 3VR2A 4JYBA 4OKSA 1UBEA 3X1ZA 1IN6A 4BGDA 2IXGA 2Z43A 4Q9LA 3KKNA 1OT3A 4W9MC 1L7VC 1W36D 3DZ8A 1FTSA 3VHXA 1F2TB 3AKDA 2GA8A 1N0VC 1ZIOA 4B3GA 1G41A 3F3YA 1DAEA 4KYIB 3EPJA 1NL3A 3I62A 1E0KA 1RRFA 4XIGS 1RW4A 2H7VA 3VAAA 4ZDKA 1XTKA 2ZI9A 4MRVA 1O87A 1W4CA 2JJ1D 4IVPA 1YRAA 2O5VA 4WVFA 4LHXA 1XZPA 4D80A 2JLXA 3LV8A 1R8QA 3QBTA 5KSYA 4TL7A 4DB4A 2QTVB 3KKPA 3SS8A 4D4JA 1NLFA 1OXVA 2VP0A 2ZRMA 1G8PA 4TQUS 2AR7A 2OEPA 3FMFA 2AD1A 2C95A 4URUR 2ZSBA 3PEWA 3EPKA 1DOAA 4RKFA 4Q48A 1EX7A 3UIEA 2ZS8A 4WW0A 2AWNA 4OYHA 5D3QA 1RJ9A 3CKLA 2RHDA 1OV4A 4LHZA 1DAMA 3TR0A 2XJ4A 3DVLA 5AWFC 2IXFA 4HLUA 1JXMA 3PEYA 1Z47A 4RD6A 4LJ5A 4WAUA 1MO5A 1EWQA 1XFAA 1Z29A 4B33A 3TBKA 1KDPA 3C14C 2JLYA 3CF0A 3S1AB 4MDEA 1ZNWA 1TU3A 4JKYA 1SKQA 2BEKA 4G0NA 1FP7A 4GP6A 2AL7A 3HWSA 4OK5A 4LJ9A 3KQHA 4FCTA 4GFDA 1F6BA 1KKLA 4RD2A 2P2LA 2RGAA 1Z22A 4LPKA 3RHFA 3ZJYA 3B2EA 2IYUA 3D3QA 1II9A 2PT5A 2ZRFA 3PUZA 1FUKA 5J4LA 1OHHA 3O8RA 3T5GA 3PENA 4HLQB 1VHTA 2DFTA 3F5FA 3PVSA 5TVKA 4D4MA 5HPYB 3IO3A 4BRUA 2X2EA 1QBKC 1JB1A 3GLHE 1Q12A 1T5IA 3K9LA 4HAWA 5CM8B 2REOA 5C4MA 2FGKA 4BFXA 3Q72A 1FP6A 4HAVA 1E1RA 1ZUIA 4CW7A 1A5TA 1W0JD 1SVKA 1G3RA 5CM9C 3B1XA 1K6MA 2X19A 2CLCX 2CE7A 2QTFA 2GZDA 3X1WA 4MRSA 4TTQA 2DFKB 4GDFA 2FFBA 4PANA 3BWDD 3AVQA 2RAPA 4TYQA 1RZ3A 2GXQA 5EJEA 3ICQB 2O8CA 2QN6A 4JVNA 521PA 2B21A 3D7MA 2NQ2C 4TYYA 4X8LA 3U3RA 3ZIAA 2HT1A 4NH0A 3I32A 2BBTA 2ZE5A 4KSBA 3WNCA 2C04A 4UJ5A 1Q1EA 1X6VA 3NIBA 4HYYA 1Z83A 3RLFA 2JASA 1J70A 4W5JA 4OJQA 1H65A 2JDIA 1VHLA 3K70D 3LXRA 2XNDA 3ONWA 4LV5B 1XCGB 2J0VA 5F98A 2QAGC 1HQCA 2QRNA 2GESA 2BCGY 3BD9A 4JT2A 4V0OA 4FXPA 1P2UA 1ZM9A 2R65A 3LX5A 1G3UA 3EAQA 1AA9A 1YR7A 3L8YA 2JJ8A 3VX3A 1UADA 2CNWA 3QI2A 3B82A 2ZR7A 2FGJA 4QNRA 3LX8A 1DG3A 1MR3F 1YE8A 4CEIB 2GJKA 1PV4A 5FUVA 4MKGA 3B9PA 1XPOA 3IQXA 4QM6A 3FKSD 4TYNA 4TMZA 4PQYA 1M7BA 2R6FA 5KUTA 4MUBA 3TE6A 1N25A 5HKKA 3I8SA 2B7BA 2IS1A 1OE0A 1ETUA 2H16A 5GJBA 4A2WA 3RS4A 3THXB 2DFLA 2UZ3A 3RVBA 2IYLD 2EWVA 4DSNA 2FFHA 1IN7A 3WBJA 4TQAA 3TSWA 1AN0A 1WQ1R 1K5GA 1XF9A 2QQ0A 4RVCA 3VR1A 3NC1C 5CDFE 1ZIPA 1XX6A 4PC2A 3U4QA 4R2HA 5SZJA 1U81A 3S1AA 5FOXA 3CLVA 3K8YA 1F3OA 3CNOA 2YJTD 1E2IA 3SHWA 1AJEA 1MT0A 2HCBA 5DO9A 5JWRA 1E2HA 3W90A 4FW9A 5G41A 2PLRA 1NSFA 4IOKA 4HLDA 2C96A 3X1DA 4KLNA 4BLQA 2BBWA 3C41J 1DTSA 1T8TA 4U00A 2WICA 2NO7A 3RRMA 2YVUA 2NMVA 1LS6A 1L8QA 2NZJA 3FE2A 2W2VA 1G1MA 1IQPA 3GJ6A 721PA 1KO8A 4A36A 3VNUA 4S2EA 4AYWA 1SXJB 1P6XA 3K1JA 1X1SA 1FQKA 1NG1A 1I2DA 2J0UA 3QJYA 2G3YA 4MRPA 2FOLA 4Q00A 3N2EA 4OI2A 5FBVB 4OHYA 4NCKA 1Z6YA 1A4RA 2RGNA 3ZS9A 5A4JA 1NKSA 1EXMA 2IF0A 3I72A 2BMDA 3IIKA 3BXZA 3U3OA 4C30A 5JCZA 5EP2A 1Q0UA 5JJLA 4POAA 1SVWA 2OCPA 4ON9A 2Z0MA 5FFMA 1XD2A 1RKBA 4MYUA 3LO5A 3LBHA 5AJZA 4EFNA 2X2FA 4Q1FA 3A37A 3P26A 3SR0A 2ZROA 2A5YB 4NCNA 1IY1A 2CL7X 5GVSA 3FGNA 5KSZA 4TZ6A 2AX4A 5KOYA 2CEAA 3OFND 1R0YA 3CUEF 2HXYA 1G17A 5KYKA 3AF3A 4A2QA 2G1JA 3GP8A 2GHIA 4HB4A 3UK6A 1J99A 4HB0A 1W4RA 2G77B 1BH2A 4B74A 3GJ3A 4RKEA 2ORVA 4KBGA 1UDXA 5IT5A 3PV0A 2GVDC 3TLXA 3SQWA 2XXAA 2FEMA 1LFDB 4YMUA 3IEUA 1PLKA 2N46A 3KKMA 4HAZA 3X2SA 1M6NA 3PITA 2CL0X 4H9GA 4AG5A 4HAYA 3SJZA 2ZJOA 5J4HA 1XMJA 2WAYA 1SXJD 1Z0DA 1IN4A 4AURA 1GL9B 3TK1A 2QAGB 3CX8A 2ANCA 2CL6X 1CLUA 3K0FA 3AVYA 4FMBB 2C5LA 2C9CA 4PO8A 2YOGA 2GWHA 5CYPA 1SXJA 4ASUD 3OESA 4QHYA 2FPKA 3T61A 1E9FA 4LGMA 4TTPA 1S4QA 1KKMA 3NHBA 2IUTA 2JJ2D 2ZREA 3PEUA 1CR0A 1PVOA 4JSYA 1E6CA 2V4ZA 3IKJA 2WWHA 1JAHA 1QVAA 2C8VA 4GZMA 3AVUA 4XH9B 4MYHA 5CB6A 1D8TA 4GPTA 4DXAA 5LD2B 5JJKA 2B92A 3RABA 5FBLB 1G3QA 3QENA 4DDTA 2CCGA 2NG1A 4GI7A 4LJAA 2XZPA 3KZ1E 3T35A 4E09A 1XNJA 4RJLA 4MGIR 4LC1A 3QKRB 4Z51A 3AVVA 4H1UA 2G88A 1M74A 3CX6A 3EG5A 5CK4A 4RD4A 1W0KD 4ZCMA 3I5YA 2NZ8A 2KBFA 1HV8A 2B6HA 2JIZD 1IJEA 1G4UR 2FPLA 1U9IA 2WSSA 5ANRB 3B7GA 2PCJA 2W6ID 4X8MA 4DT1B 4EJSB 2J46A 1RFLA 4YDSA 3FWYA 5CB8A 4WIAA 2DWPA 1P2SA 1T4GA 2ODWA 3CPEA 1ZAKA 1N6HA 4EDHA 1M2OB 1XJ0A 4Q7MB 1X8LA 1AK2A 2QMOA 3OFNA 3R9IA 4BFYA 4A8JA 2W6IA 2FDCA 1GKYA 4BFVA 1Q44A 2FA9A 3AP2A 1RRGA 3QKSB 4KVAA 4Q66C 1KI4A 5DISB 4LI0A 2CVHA 1HT1E 3CB4A 1UKVY 2BMJA 4KHZA 4FN5A 4PQRA 3QKTA 1SVOA 5D3MA 3VKGA 2ZJAA 3B9QA 1TF5A 3HU3A 3GPLA 4AY2A 4OI1A 3AV0B 4G3XA 1D2NA 3PXGA 2FSFA 3Q9LA 4RZUA 4DLTA 2YOHA 3NHAA 2BKEA 3P1JA 4KV9A 4NP6A 1I4TD 3TUJC 4RD3A 2YWEA 3W8NA 1A1VA 1V43A 3T1TA 1KSHA 3A1WA 4QRHA 3EASA 1XBTA 4HUQA 3MMPA 4A0FA 1E9BA 5DNYB 1WMSA 2A78A 1GDDA 3AKEA 3KQKA 2EFHB 5LDDC 1TQ2A 1EWRA 4TT3A 1LY1A 5FL7D 3BIFA 2IX3A 1BMFD 2PJRA 2QM8A 1OIWA 2ZRAA 2JLVA 4TLAA 4LV8B 2ZRJA 4Q4AB 1JQJC 1N5IA 2B7CA 4QHSA 1G4AE 1DG1G 2ZRNA 1ZUNB 3U60B 4Q7KA 4HZUA 4IRUB 4P0TA 4E03A 1W4BA 2WKQA 3KXIA 1VECA 2QPTA 3RWOA 1X1RA 2C77A 4C9BA 3P4YA 1S1CA 4MA4A 2WIAA 1F2UB 4B2LA 1C4OA 2AK2A 4V03A 1E2JA 2DPXA 3TMKA 2AFIE 3AF4A 4HUQB 1NLZA 3DM5A 4Q9IA 4MUAA 5D3MB 5EZ5A 1SGWA 4XD7D 4IEEA 3OEEA 3P32A 1OB5A 3FKSA 1Q3HA 2ONKA 5FOVA 3A58B 2OSBA 3N70A 3FFAA 4C0LA 1KJYA 2NO9A 5EE0A 1D5CA 1VCOA 3QKSA 4AD8A 4MKFA 1GTVA 1II8A 5AR1A 5K8TA 2IWRA 1XCMA 3LDAA 4QOSA 3REFA 1NY5A 3AKYA 2AFHE 3I4LA 4G5SA 2RHMA 4L4UA 4DDUA 3BH0A 1E79A 4EAQA 5KDOA 2CJWA 2ZRIA 3EPLA 2ZJ2A 2H8KA 1FTNA 1UBFA 5EXPA 2CHGA 2RGCA 4HDCA 3MRSA 1ZMXA 1ZRHA 3SBEA 5FPYA 1G6HA 4BLOA 1GRQA 1LTQA 4M1YA 5L3SA 1CS4C 1E1QD 1J8YF 2Q3FA 2CK3A 2GF9A 1DELA 1XJCA 3TRFA 4Q47A 2A9KA 3WYFA 2CHQA 3IPYA 4B34A 4LYHA 1EGAA 3WY9A 3C16C 1ZM2A 3R20A 2G6BA 3QKRA 2O8FA 3BC1A 5LB4A 3VHLB 1JPNA 2GNOA 4ITRC 2FZLA 5BXQC 2NO0A 2DWQA 4C3ZA 2ZUCA 4XVRA 2QE7A 1VG1A 1ZC3A 1NVXQ 1P7CA 4DT1A 5EE1A 4Q9KA 2ZRCA 2FMXA 1KNXA 1HYQA 3HU2A 1W36B 4OQMA 1KK3A 2Z6VA 4MYTA 3AVXA 4B47A 4US1R 4LBYA 2GJAA 2C2HA 4YQFA 2GCNA 1NN5A 1G8FA 1QG2A 3L43A 3KUCA 2QORA 1IY2A 4Z54A 1W44A 4MYCA 1KK0A 4A0RA 1KO5A 1H8EA 1KDRA 1E9CA 2QGZA 1NSTA 3U6KA 1K5DA 5H8WA 4JBYA 1XXHE 5AJWA 5JLJA 4HAXA 1ZNXA 5FL7A 3PUXA 4JJKA 3OE7D 2GKSA 4GZLA 2YC4C 4G5RA 1JR3D 2P6UA 5FOTA 3SEAA 1HE8B 3FB4A 4DCVA 1MKYA 1NVVQ 4URWR 2P65A 3G0HA 3CRQA 4GSYA 4RZ2A 2ZANA 4QNMA 4DKXA 2GILA 2GJ8A 1OXXK 2JA1A 1LVGA 2PMDA 2F1RA 2WJHA 1LB1B 1M1YE 2D2FA 3BB1A 3JZMA 4RFSB 3ZVRA 3UMFA 3UG7A 3SQXA 1U0HC 2BBSA 3THWB 1UBGA 2WMOB 3SBDA 4AKGA 1E9AA 3A4LA 4LBWA 3VQTA 4ARZA 4BZQA 1KY2A 5HCNA 3SE0A 2VO1A 1YQTA 4JLAA 5FTLA 3KDSE 5EXTA 3WP0A 4DJTA 4DLYA 3FMPB 4AKIA 4XVUA 4UXIA 1BYUA 3RSLA 3GQBA 2AK3A 1AS0A 5G3ZA 4FMCB 4PZYA 3W5IA 2PZFA 3CNNA 1E79D 1ZC4A 2ZAMA 4D0LB 1J90A 5EP1A 4D25A 1N6LA 4QGGA 3THYA 1Q22A 3FVQA 4C0BA 3PUWA 3VNVA 3ZIAD 3HU1A 2P0EA 1KAOA 1N5LA 1VG9B 1JXOA 1G7SA 4GBMA 4OI4A 3SYKA 1KYIA 4EUNA 5FUWA 2G83A 1E9DA 3B85A 4QGFA 2CMKA 1NVVR 1Q3TA 4FMDF 1GNQA 1ZCBA 1YZKA 3AVOA 2QG6A 2JDID 2JLWA 2ZR9A 4IHQA 4TN1A 3ADBA 5KDDA 4M1SA 4M1MA 1N6RA 3TIFA 3B1YA 2HYIC 2IWHA 2HLDD 1KI6A 5J47A 2GVZC 4JBWA 4I1OA 4RFSA 3U3KA 2ZUBA 3T34A 3SHFA 1E2GA 1HEIA 4JJZA 1KO7A 4M1OA 3TQCA 3DPUA 1UJ2A 4MGZR 1IAQA 1VG8A 4B71A 3SYNA 4AKEA 1WCV1 1U9IC 3GLIB 3NG1A 1GAJA 4AWXA 2MSDB 3K0EA 4M21A 2AD5A 1U8AA 3MSXA 3SJAA 4FCVA 1Z08A 1TTTA 2WWFA 2J0SA 1R0XA 3W34A 1LS1A 2KJQA 4C0KA 2ZI3A 3LQRA 5FOUA 2ATXA 1C9KA 2OHFA 3KJGA 5DLQC 3HR8A 5EP3A 3U6BA 3EWAA 4JLDA 5CK5A 3AKCA 2O8EB 1QHYA 3QSYA 4PQFA 4BLRA 1E2FA 3BRWD 1XEFA 4HDOB 3UWOA 5KDLA 3ZGXA 3QXXA 1DAFA 5K8LA 3CONA 4RCYA 1G7RA 2O8BA 1SZPA 1U8YA 3QUSA 2YV5A 4DCNA 1HUQA 5B57C 4JLMA 4OI0A 821PA 4NYJR 4W7SA 1UKEA 3LWNA 1QHIA 3OAAD 3NEJA 1NMXA 4EFMA 4NYJQ 4KBFA 1UDWA 3K09A 3X1XA 3BORA 5M04A 4KCGA 2YNMA 1UFQA 3PQCA 1MO4A 3TNFA 4DSOA 4Q4HB 3FDIA 1PLJA 3FFBA 3VR4A 2ONJA 3FHCB 4A1FA 2BCJQ 3GEIA 5B30A 1FQJA 2J45A 2ECKA 4QBGB 3RAPR 4QL3A 1ONBA 1SKYB 1SKYE 1GKUB 2ZXUA 2FJUA 2ZR0A 3GLIE 4Q7LA 3KUDA 3K0AB 1TX4B 2CVFA 1YKSA 3GJ4A 3Q3JB 4GOKA 5FBWB 1DARA 1BS1A 1G16A 1E96A 1P4SA 1CR4A 3EC1A 1PLLA 4QGHA 1YZTA 3CF6R 3QOFA 4IDQA 4YLGA 2ZSFA 2ZRBA 4LJ8A 2OLKA 3CWQA 1AZSC 3QY0A 2A5GA 2N1BA 1KI2A 1N5JA 3T5DA 1X8JA 4DSTA 2QRZA 4XSGA 1E2DA 2IW3A 1D9ZA 2VIIA 3NBZC 3NH9A 4EQ6B 4GMXA 1ZU5A 2FG5A 1ZW6A 2YINC 3THOA 5C18A 3PEVA 2VHUA 3AVWA 5A5GA 2D7CA 3OEED 4LJ4A 2V1XA 3LLMA 3RS5A 3MAAC 3TVTA 3GLFB 4YMTA 4WZ6A 1MRSA 3MFYA 3QXJA 2D3WA 3SJCA 2VHCA 4B3DA 2HDNB 1Z63A 3P20A 2FV8A 4DLRA 1N6NA 2EFGA 4ZPXA 4D2IA 4GP7A 4LBZA 4N0EA 3ASYA 4OJKA 1VCIA 2P6RA 4OK6A 3DDCA 1QHSA 3TVDA 4HI0E 2WPDA 3QPVA 1JJ7A 3MWKA 2O8DB 2OCBA 2FEOA 4OQLA 5C4GB 3C5HA 3WRXC 2EU8A 4FMDB 3AVTA 2W2TA 1DVRA 4HZUB 5DN6A 3CR8A 1R2QA 3QVUA 1R7RA 4NONA 4UNPA 2RGGA 1KK1A 2IYXA 4NZYA 1YJ5A 4Q4AA 2OLJA 4TYWA 2A5JA 3QVVA 1T3HA 4TMTA 4TWZA 1GKIA 4OQXA 1SVSA 3HYRA 3VTKA 5EUMA 3W6NA 1Q1ZA 2ZM5A 2F55A 1GL7A 4JMPA 1E1RD 5JCPA 2IUUA 3AF2A 4M9SA 4PAQA 1NBMD 2Q3HA 3BERA 3WYGA 4B3FX 3RC8A 2X1VA 4JSTA 3Q8XB 2Y8EA 1OH6A 1W5SA 4Q1BA 2OZEA 5CDFA 3TAHA 3DOFA 2OCAA 4A6XA 1JR3E 4TLBA 4HLCA 1NBMA 3DL0A 1P60A 3M0EA 1R5OA 4B3XA 1OFTA 1Z6GA 2UKDA 4B43A 2RGXA 1H8ED 4U7DA 2J7PD 2YWGA 1A2KC 2EFCB 2XEXA 3K53A 3KQNA 1RIFA 3DMNA 2AKAB 4ZO4A 2JLSA 2JATA 4OQNA 3DZDA 1ZUHA 2YYZA 1UEJA 4PPGA 4O2LA 4US2R 3LVQE 4YMVA 2I1QA 3GJ5A 5H70A 3NEYA 1OFUX 3R7WA 4JLVA 4BE7B 3NC0C 5GADl 1FW6A 3L8ZA 1E2PA 1OIVA 3IGFA 4TQ9A 1L2TA 4B44A 3MD0A 1NBME 2WV9A 4LV6A 1I2MA 2E1RA 2XSZD 3KXLA 1XB2A 4IDPA 1N2CE 1GNPA 2VRWA 4R98A 3CM0A 2IUSA 1W0JA 4PPFA 4TSFD 4QG7A 3IDQA 3QKUA 2ZVQX 2HF8A 4PXAA 3LFUA 3A1TA 1DO2A 1RYFA 4F91B 3KTAB 3C15C 5IF9A 3HP1A 4BFUA 5GJCA 3CRMA 3CZPA 1E69A 2J41A 5B2ZA 3PIRA 1E99A 1F2TA 1S8FA 4HSEA 3HR7A 2X77A 4W5WA 1VCNA 2ZJZA 3M1IA 2KWIA 2QI9C 4AYXA 4M8NE 2NPFA 3H84A 2RGEA 4F93B 2VQSA 3NKVA 4TL9A 5CIWA 2ZJ5A 2KI5A 1XEWX 4WXRA 5EUQB 4KVGA 1NN3A 4V02A 4URXR 4KLZA 1UEIA 2WPDD 1KJZA 3K0FB 1Q21A 2ZAOA 1WP9A 4FINA 1N5KA 1OH8A 2QAGA 1TL7C 2XJ9A 4C2TA 3AM1A 3IHLA 1VCMA 2DR3A 3GJ8A 1VIAA 4KODA 2ORIA 2PZGA 1DPFA 2J9RA 1OSNA 2JAQA 5AUOB 3GLGA 2JJ1A 2XNDD 1N6PA 2ZS9A 2CE2X 3EX7C 1CEEA 2R62A 1KSFX 5SZIA 1U99A 1U2RA 4QKQA 3AQ4A 3CNLA 4QBFA 4B73A 2FH5B 4I4LA 2GK7A 4Q4LA 1QVRA 4Q4JA 1E3MA 1KO4A 1FNMA 2CNWD 4GOJA 1XTJA 2YKGA 1HA3A 1DE0A 2VPPA 2DHRA 1NMZA 3BB4A 4HAUA 4JVSB 4GL2A 2Z4SA 1AGRA 1Q1QA 2H92A 2D62A 4MITA 1ZU4A 3UXMA 1JECA 3VR3A 3ZLJA 4IFBA 3ETLA 1KDOA 2XB4A 2VHJA 1NIJA 3EZ2A 3DM9B 2QP9X 2DB3A 2EW1A 5BN3A 5LD2C 3REGA 4HUTA 4NE2A 4DLVA 3E70C 3H2YA 5BYJA 5JRZA 1CJKC 3PR1A 3WMGA 3TR5A 3TSZA 5F9HA 1W7AA 3KJIA 3ZD6A 2ZU6A 3AUXA 4L15A 2MMCA 3GFOA 2ZRHA 5H1YA 1XMIA 3SYLA 1KGDA 1WF3A 2DFNA 1N3BA 4FWTA 1SVIA 4LHWA 1E2NA 2V55B 1QRAA 2IXEA 3CRRA 1DS6A 4TSFA 2ZQ5A 5AJVB 1GVNB 1PUJA 3CH5A 1VYVA 4C7OA 3TGPA 3V4RA 4EJSC 4KU4A 4TL8A 3LQQA 5CYOA 2YWHA 1XXHB 3OAAA 2QA5A 2QUZA 1E9EA 2ZVPX 4D4LA 1OH5A 1KMQA 2BVNA 3EWSA 3RSOA 4A0HA 2GBLA 2P6NA 1YZQA 3AUYA 3LVRE 3AVPA 3QPUA 3W3AA 5E4FA 1AS3A 4EFLA 5BN5A 4IW3B 5TMPA 2GAOA 3FOZA 1CJMA 1DAGA 4UNSA 1JALA 2QE7D 4RZXA 2QNRA 4M1TA 3O8DA 3W6PA 4ZDWA 4LYJA 1AIPA 2BDTA 4EPTA 2J0UB 1JJVA 3WHKA 2C03A 3ZVMA 5SZKB 4BEJA 4BUJA 5F9FA 2GXUA 2ZYUX 2ZYVX 1MOZA 2C9YA 3BBPA 1BIFA 2W83A 2UVQA 3VR6A 2PH1A 2V54A 4K81B 2V3CC 1XTSA 1E0JA 4AG6A 5EE9A 1E2KA 1KZ7B 3SDZA 4ASUA 2PL3A 4IDNA 2O0JA 5FPHA 5E7MA 1X8KA 2CDNA 1OYYA 2NO1A 4K8OA 4A82A 5L3RA 1P75A 4PC1A 1Z3IX 1ZD1A 2CHVA 3K0CA 2QBYB 1KTVA 3KB2A 4V0NA 2FZ4A 4L9SA 2V1UA 1G19A 4IKEA 2BC9A 4CRWB 2GZHA 2ZI5A 4PHGA 1KSJA 2WAXA 2H1LA 2LCFA 5HE9A 1CJVC 4PHTA 3AP3A 4RSGA 2FSGA 2QAJA 1YHNA 1XPRA 3UG6A 1N6KA 5BYKA 5FR2A 3ZQJA 1P2VA 3N2IA 4ZI3A 5A0FA 4CEJB 1KOFA 1DADA 4LYFA 4PZZA 1G291 2C98A 4UNQA 2ZSAA 4LZZA 3U2QA 1Z0AA 5L3SB 4P31A 1S1MA 1KNQA 5JSZA 5JBQA 4IXNA 2J59A 2REBA 2FU5C 3NDBB 2QY9A 4ILEA 4PZLA 3EC2A 4Q7JB 3QF4A 2ODNA 3AB3A 1PJRA 3H0KA 2O52A 1ESNA 1MV5A 3KB1A 1SULA 4A4DA 2HF9A 2F3TA 5FPSA 4ZI2A 1U94A 3PJRA 1KDTA 1II8B 4KJZA 3K0SA 4ESVA 1CTQA 3B1VA 3QEJA 5KO2A 2FX3A 4BFTA 1A2BA 5DN6D 1XEWY 3BFVA 2QT0A 3E2IA 1VG0B 2EFEB 3Q7QA 1CR2A 1OJLA 3X1YA 1R4AA 5J4KA 4BPBA 4QBIA 4JVLA 2QROA 5UKDA 3GEEA 2C99A 2H17A 3B6EA 3CX7A 1E2EA 3SOPA 1W2GA 1IXSB 1XZQA 1ZJ6A 4BEBA 3R9XA 3UPUA 1UM8A 1P5ZB 3QF4B 4QC2A 1TEVA 1QHNA 4Q18A 4TLCA 5TV2A 3U44B 6Q21A 4JLJA 1PZNA 3OF5A 3RS3A 1E2QA 2XOKD 3CF2A 2A2ZA 1FFHA 3LRPA 4CT4B 2HV8A 1EFTA 2JIZA 1ZNZA 2Z5FA 5P21A 5CJPA 1D9XA 3I73A 4CEJA 1Z8FA 1W4AA 4JLNA 2J7PA 2V8OA 3BGWA 5C1BA 2PMKA 1SVMA 1G5TA 1U90A 1XDBA 2OT3B 4BQSA 2DY1A 4AC9A 1RRPA 1JR3A 1XWIA 2ODEA 4X8HA 3W9YA 1EFHA 2QQEA 3FYHA 4M9ZA 2QP3A 2LKCA 4Q1DA 3DEFA 5DYIA 2J3EA 3EZFA 3TAUA 1NKTA 4EPWA 1JNYA 1BMFA 1E0SA 3ECCA 3QG5A 4MH0R 2OFOA 3LAWA 4IVRA 5DI9A 2F43B 3OZXA 4UQOA 5FUXA 1ZCAA 3G5UA 2RGDA 3U7EB 4DBLC 2X8AA 1DAIA 4TTRA 4M1KA 3GMTA 4D26A 2FPMA 3WBKA 4UXHA 3QXCA 2ZRGA 5JEEA 3L0SA 2Q9BA 4XSHA 4G01B 4YONB 3ND8A 2G1KA 2IT1A 3T1VA 5CITA 4XTCS 2HT6A 2QGNA 4B3CA 4TMWA 4F92B 5TY0A 4Q9HA 2VHQA 2BM0A 2QTHA 1W46A 4XD7A 4LDJA 2QENA 3CR7A 1RYHA 4QHTA 1HURA 1T5LA 2BWJA 5AK0A 4B32A 5C2JB 1MH1A 1X3SA 3NWJA 2GBLC 3GLHB 4N0DA 4URZR 5EP4A 1TAGA 4A8JC 1Q1BA 1R6BX 1G5PA 3ADKA 1T8UA 3A4MA 3QIAA 4JL5A 4OBEA 5FBRB 2Q9CA 1Z2CA 3TJZA 1S3SA 3T1OA 4DLWA 2GCOA 1GRRA 2V7QA 1AQUA 2G9NA 1GILA 4GMDA 2GF0A 4O2RA 5BQ5A 2W2XA 5FTMA 4ABYA 2J7KA 3QBVA 1NG9A 2QZ4A 4UJ3A 3RDPA 4LK2A 2DCUA 3HPRA 2WBLC 2KSQA 4DLZA 1E1QA 3OHMA 3QF7A 2WIBA 2QP4A 3DMDA 1OXTA 4B76A 4JL6A 1Y3AA 3HYTA 4HEJA 1TUEA 1J7KA 5KHOC 5JS8A 4XTRA 4G5GA 5TDHA 5LPNA 2ZUDA 2WMNB 4DC9A 4ZKDA 5F3WB 4TYPA 2QEQA 1CJTC 5CIQA 3T12A 421PA 1AM4D 1U8ZA 2ZITA 2FF7A 2O8DA 3O8BA 1AKEA 5IRCD 1U0JA 2IK8A 1XU4A 3T1QA 3I5XA 4MDFA 2PEZA 1M7GA 1Z0IA 2NPIA 3IIJA 5G53C 2PJZA 3B78A 2ANBA 3D8BA 1OKKD 3EA5A 2D06A 2F9MA 5C46F 1FZQA 3P4XA 1OW3B 4LJ6A 5DI3A 3F8TA 2ZRLA 4PO1A 1KMHB 2WOOA 2GEUA 4OL0A 3U7FB 4JL8A 1TMKA 1CR1A 3WNDA 1T0HB 3SFVA 1EK0A 2F7SA 3L0OA 1P72A 4RFVA 4PSAA 5FPTA 3K9HA 2ZE6A 1E4YA 3I1FA 1YZUA 3ADCA 1Q57A 1Z06A 3BFXA 4R9UC 3EW9A 1EFCA 3O47A 4AYTA 2W58A 3U7HB 1WA5A 5FI0B 2VEDA 3KQLA 1CU1A 5JEDA 3SZRA 2WOJA 3QEOA 2EQBA 3U4QB 1XP8A 4PAMA 2FWRA 4BLSA 2QT1A 4WOPA 2VTKA 5TARA 4LHVA 3M6AA 2IYQA 3ZVLA 2P3SA 3RRZA 2IYYA 4XVQA 4MGKR 1TNDA 2OFWA 1DO0A 5FOWA 1NNEA 3E5HA 3P27A 1UF9A 4RY2A 4TL6A 5JZVA 1CKEA 3MJHA 2AKYA 1EESA 3SI7A 1MABB 3LNCA 3RS2A 3D31A 1ZYUA 4LJYA 1XD2B 1Z6AA 2OCYC 1CRPA 4TLEA 1G5RA 1VPLA 2GCOB 3WP1B 1MRNA 1ANKA 4V0KA 1CBUA 2NIPA 2BMFA 3GFTA 4TMKA 4ZV4A 1R0WA 4QGAA 1KI8A 3GLHA 3QNUA 2HXSA 3RANA 4A0GA 4C0AC 1COWD 2ZJYA 2IYVA 4KSCA 4ERNA 1RVDA 2IEZA 3V9PA 3TW8B 4CDGA 4XOIA 3B1WA 5CLQA 4CF7A 2WM9B 4TT3D 4YDHB 2OBMA 5KPDA 2IL1A 2GJ9A 1AKYA 4ZCLA 4Z1MA 3MUFA 4OHZA 5JRJA 1UBCA 2PEYA 3NBFA 4AIIA 3CBQA 1COWA 1W1WA 4WXPA 2OG2A 4M1WA 1XMSA 4X8OA 2R6CA 4NU0A 3CRVA 1UKYA 3K9NA 1GOTA 2R9VA 1VYUA 4BLPA 3BAFA 5IHPA 2Q21A 4ZIRB 2R6AA 3J81k 4IOLA 2W0SA 1I4LD 3L0PA 4DB2A 4BASA 2VHTA 3IQWA 4Q1CA 3GD7A 3DO6A 4KAXA 1QZXA 2GEDA 1AQYA 2RMKA 4E07A 2Q9AA 2BJWA 4ACAA 4LOAA 1BYIA 2Q6TA 3OIYA 4DLUA 1P73A 1TQ4A 2REXB 2QSYA 1XTIA 2OXRA 4GNKA 5CLLA 1FX0B 4Z8XA 1SXJE 5TB5A 1NMYA 3PG5A 2VP9A 3BOSA 3HPQA 3IBGA 1GWNA 2BHRA 1AZTA 3UWKA 1T3LA 3NBYC 3OIWA 3BK7A 1F2UA 2XTMA 1KZGB 4LWZA 2I3BA 4CIDA 4R71A 1XTQA 3DKVA 2BIFA 2AHOA 4Q1AA 4UXJA 3IHWA 2JEOA 2IEYA 4IDOA 4Q21A 4NCJA 3DOEA 3WMFA 2QM7A 2HLDA 2O0HA 1Z0KA 1IOZA 2IHYA 5JJIA 2YHSA 4URVR 2OUKA 2XB2A 3PUVA 5E7IA 2IF2A 4DLXA 1E32A 1KI9A 4Q02A 3RS0A 3AGPA 1SQ5A 4QJ5A 3MCAA 1JBKA 2VF7A 5AJYA 3CRW1 4HLUC 5E7JA 3GLFA 1WE2A 3A1VA 3FHTA 3SJBA 2G0NA 1OYWA 5K8UA 1YR6A 221PA 3W5JA 3LW7A 4CYMA 1RPZA 4Y0AA 2F1JA 5JHGB 5AUQA 1YR8A 1LV7A 3JVVA 1GUAA 4WZBE 1OB2A 2HJGA 4H1VA 3QE0A 1NJFA 4BZXA 5KNCA 3WMEA 3WYAA 1N0WA 2XZLA 3VR5A 4Q19A 2LKDA 1YR9A 4DIDA 3V4FA 3IBYA 3ZD7A 1V5WA 3OIVA 2IYWA 4P4SA 3MGCA 5KSPA 4KITB 4J0QA 4B6EA 2IYRA 4MKIA 2BBOA 4NCHA 3RNLA 1IBRA 2WTUA 1TUIA 4Q01A 3QPWA 1HQYE 1TU4A 2YC2C 1G9XA 2ZRPA 1F60A 2GEVA 3K9GA 2W6JA 1NVUQ 4I99A 3WRYC 4JYCA 4F7WA 2AXPA 2OM2A 3FHOA 4JKIA 1KIMA 2ZJ8A 2ZI6A 4FMCF 2KB0A 4EPVA 4M0LA 1CIPA 4DIEA 4BLTA 4F4JA 2VSFA 2WWWA 1X86B 3CPHA 4A15A 2R6DA 1W5TA 1SHZA 1G6OA 2E9SA 4D0GA 1K8RA 4DZZA 4JZKA 2WHXA 1R5NA 4EPYA 4LYAA 2JLZA 3GJ7A 4FD2A 1KAGA 4P33A 4K46A 1LNZA 1F48A 1W36C 1NY6A 2EYQA 1NJGA 3VU9A 4LHYA 4HATA 1LF5A 1OXUA 4NKRA 4KI0A 3SNHA 2VF8A 3M4YA 1XJQA 2EYUA 3C5CA 2F3RA 4AK9A 4PR0A 1QHXA 4JLKA 3NTUA 5HKKD 3TH5A 3FKQA 1TQ6A 5JMTA 1GL6A 1BKDR 1HY3A 4P4UA 1G64A 1EFRD 1IN5A 3L0IB 4B2PA 2OESA 1EX6A 2Z83A 1E4VA 2OAQ1 5EE5B 4NPHA 3ZYCA 1N6OA 5EZ6B 2ZS7A 2XNSA 4A2PA 5IK2D 4C7OB 1CP2A 2J1LA 4LSGA 2VYFA 5F2EA 3RRYA 3Q5EA 4I1SA 4WZAE 1B23P 2WZQA 2CXXA 2ERXA 2NTYC 3LBIA 4UNRA 3O8CA 1FMLA 1KMHA 4P4TA 3D6TB 1IY0A 2ZPTX 2ASEA 2CCJA 1GP2A 3W8RA 4LC0A 4C0SA 1P9RA 2ZU0C 4TMXA 3TQFA 4HDQB 2WWGA 2VH5R 1VYTA 3EZ9A 4MRNA 1YZLA 2CJWB 2CLSA 3B1ZA 1ZINA 1G8HA 4MGYR 3Q85A 2WJYA 1TF7A 3EPHA 1M8PA 3B13B 5EXSA 5FL3A 5JS7A 1VTKA 2W0MA 1OKKA 3RC3A 1EFUA 3R9WA 2WSSD 2WVJA 3VX4A 5IDVA 1NIPA 4B35A 4M2LA 2EVWX 2VSXA 4B2IA 1OFHA 2MSEB 1XMVA 1ZP6A 3QG1A 4PPQA 3IPXA 1Z6TA 3K0CC 2RB4A 4IFEA 2ERYA 4LCBA 2XXAB 1G7CA 2OXCA 3A8TA 2C78A 3BH6A 2QSZA 2VP6A 4CZ2A 1WBDA 1HH4A 4Y0VA 4Z8YA 3F0TA 5G3YA 1JI0A 2ORWA 4D6PA 1N6IA 2FNAA 2GCPA 2Q3MA 4XWAA 5JWHA 2TMKA 2W6JD 4I1UA 3FTQA 2QL6A 2R6GA 5ELXA 2A7QA 3AF0A 4I1VA 3W3ZB 2ZRDA 4NMMA 3A6PC 5L3QB 1SXJC 2ZJBA 1E2LA 2PBRA 4YXWA 4EPRA 3SU8A 1T3SA 3GLGE 3K70B 2XZOA 1VIYA 4RCZA 2E87A 1NN0A 1G21E 3BB3A 4LPSA 4U5XA 1OXSC 2V9PA 4NL4H 1DAKA 2ZTSA 1KJWA 2ZSDA 4M53A 3THWA 1XEXA 1VMAA 4IJMA 2FSHA 2IYTA 2VL7A 1YU9A 1YRBA 4N1AA 3SFZA 1GSIA 3R8CA 1XCPA 2H57A 1ZM3A 2HYDA 1T9HA 2DYKA 3BFKA 3AH8A 4QBHA 3ZZTA 3I8XA 1P9WA 5DIFA 1JAIA 4IDHA 4WBSA 4CGZA 5H68A 2F1IA 5JWOA 2OO7A 2R44A 4PSKA 3VU9B 2B8WA 1TPZA 1EFRA 1A82A 2JCSA 5DYGA 2GZAA 1R10A 1US8A 2PX3A 4IOJA 5G40A 2PLFA 5J5CA 1H8HD 2EWWA 2OBLA 1LF0A 2QPAA 3FPAA 2RCNA 2P5TB 4D0NA 3VMFA 4U02A
chains in the Genus database with same CATH superfamily
1Y4AE 3KV3O 4G1CA 4ZOAA 1FVXA 2F43A 2HCJB 3H5IA 3RAFC 3ROTA 2VT3A 5AM3A 3OTGA 2WYOA 1KA9H 4QJIA 3DTVB 2GWRA 3F4KA 1DTEA 1AGPA 3A1UA 3HV0A 4DW8A 2ZDGA 1USWA 4YRMA 3E9EA 1PJBA 3Q9SA 3F46A 5LIPA 1C1XA 3R6TA 5EQTA 1J07A 1JQDA 1XZNA 2V6JA 4NCAA 2QRVB 2EQAA 3PI6A 4GMFA 1NOKA 2CXRA 4O1HA 3CE9A 2IYZA 4RIIA 2OCIA 3LXMA 3EPPA 4P3KA 2H5EA 4ZP1A 3ITEA 2X8BA 4RQAA 2ZYWX 4JJ8A 4ZRDA 3ZLVA 3SC3A 3E7PA 5DEIA 5IU6A 1NI3A 3LECA 3A1SA 5DSZA 3IL2A 2JFXA 4EUSA 4YLEA 1M6VA 4BZPA 1B0UA 1PR1A 2EIXA 1BS9A 2BKUA 4HVAA 4OA5A 2PZEA 1M75A 4JC5A 5JHHB 1RPNA 3FI0A 4C07A 4E1VA 3E15A 3GBVA 2XVAA 5DH9A 4EPXA 4ETMA 3JTMA 2PK3A 2O8CB 2H00A 4OD0A 1SK9A 3KPVA 1FNNA 5HUHA 3QEMB 1E0AA 3BSSA 2X86A 1R18A 4J6FA 2C0CA 1QR2A 3R7AA 1MW9X 3QEKA 2DLDA 2R47A 2Y99A 1IBCA 1PNVA 1G55A 2V6BA 4DLSA 2EL7A 5LBIA 4WMLA 3PL1A 3TIGA 3KETA 4UQPA 1P7VA 1XHEA 3S1LA 1VPWA 4BS9A 4YC7A 1DBVO 5JI3E 1UJ4A 2IIBA 3A70A 4GG1A 3T0IA 2V6IA 2BGWA 2WZDA 2R2AA 4W7IA 4S05A 2AQIA 2CNOA 3IKLA 5EERA 1HTWA 2FPGB 4URFA 4CMJA 1X1AA 1ZONA 4YAIA 3W4KA 3UAGA 1C80A 2KE5A 3KL4A 2RC5A 5JH7A 3W5UA 2YVKA 3I9OA 3COWA 4CM4A 5TF0A 3EIQA 1S6YA 4MWGA 5EFZA 2PVCA 1NWHA 3EA0A 3GXBA 1UQTA 2CZCA 3FCCA 5K9ZA 2ZZKA 3IJPA 4U8HA 4ERXA 1R4ZA 4B7UA 4K2HA 4K9LA 3HWRA 3FMOB 1ZBDA 3D4OA 3NKLA 5ALUA 4ROTA 1BHO1 5DK6A 1JPJA 1EHIA 1V3QE 3MIIA 2AG8A 4JBXA 1QG4A 3KOXA 4NZMA 3AT1A 1NBHA 4MV4A 2OILA 3VO9A 3ZE6A 4QODA 4H4DA 3T99A 5K6RA 6ABPA 3ST7A 1KFCB 4ZT5A 1JQLB 5SY9A 3DOUA 2LBPA 2H7YA 3P45A 1Z5ZA 4MQEB 2Z4TA 1OLOA 1Q7CA 5F52A 2FOXA 1IZ7A 4HGYA 3HB7A 2M6LA 1YZNA 4RHUA 4F60A 4WE3A 4W1PA 4OHWA 1L5LA 3MTBA 3KR2A 2I67A 4BNZA 2W00A 1UZUA 2NOAA 2XIJA 1U8CB 3HKCB 1W47A 3NBKA 4OO3A 5KTRA 3FUWA 1YQEA 3ZW9A 3WWYA 5AOVA 3GOHA 4HKTA 4HNAA 3HNPA 2ZIAA 4IJUA 1IWOA 1N2EA 3C7KA 1XNRB 4RO0A 1ODFA 2YJ3A 3R7DA 1ISGA 2A3NA 3VHRA 4NFSA 3TUZC 5HNKA 3HM2A 3WYDA 4DUPA 1VMIA 5LQAA 2ZSEA 3DBRA 3AEZA 3NHMA 1XF1A 3KUXA 3SIPA 1G3MA 4P3YA 4ZTZB 3X0DA 5ALIA 2ATCA 2W6OA 4YS6A 5LB2A 3ZZ0A 2EKPA 3STHA 2XB9A 1Z6ZA 3REOA 1JILA 1S9HA 3CJRA 3HJHA 3QXHA 4I81A 4L3WA 4YH1A 4BU1A 1IM2A 5BN4A 4AJEA 1CY2A 4Y98A 2BE9A 4Q4HA 2V3VA 2Q7OE 5GZ6A 4CKBB 5HR5A 4M9XA 4YMWA 2Y1CA 4PU0A 3VO8A 3B5EA 5AYVA 1Y8ZA 2JBAB 1YR1A 5ECYA 2WI8A 3QXSA 2NZWA 4BDSA 3A31A 1A8HA 3ACDA 2A59A 4X45A 1VL1A 4KFTA 2F1HA 2NSDA 2PT7A 4QICA 3H4TA 1YTUA 5JFOA 3KK0A 2Z4RA 1SZDA 3ANMA 1I1QB 4FGLA 4TMVA 3UMGA 1R5BA 1YBHA 2ZE7A 4ZANA 2RH5A 4R1LA 1RRCA 3PQFA 3GFSA 1WEKA 2NZUG 2DQZA 3VDMA 5A9TA 2B1JA 1J00A 4R7ZA 2MHCA 1W49A 2DUJA 3LCJA 1V48A 1TA9A 1SVLA 4MV0A 2D5CA 2IH2A 5JAPA 4ZU1X 3QMPA 1WOMA 4O4HA 1EFPA 2J33A 4P58A 2XCQA 2TSYB 3D4IA 3FNGA 1VKJA 3AHIA 1DFGA 3VFDA 2WHQA 1CF4A 1XYGA 5KX5A 3QLEA 3OQ1A 4IQ4A 4TWIA 4QBTA 1H6AA 4E22A 1T91A 1E94E 4XFDA 4NAHA 2D54A 3ND9A 1GITA 4A3SA 5JFTA 1LEHA 1N0UA 5JZSA 3LLUA 1G7TA 5JYEA 2Q4RA 3KXKA 5F2OA 4OUKX 3J80A 2ZYSA 3N6XA 4TM7A 3ZNPA 3VKHA 1F1JA 4V0ME 3F3KA 2CB9A 2BTOA 3KX2A 1U1CA 3DEIA 4OK3A 5I7HA 1CQXA 3AB7A 4O3MA 1DKQA 2WIFA 1PDVA 1Q15A 4JH0A 1ZVQA 4GXNA 4KO1S 3MLEA 3C43A 4AF6A 5HZHA 5EIBC 1P9LA 3A1CA 4QOEA 4FOSA 3OOJA 1ONOA 4OHXA 1SCNE 3C6KA 2XMPA 4TYNA 1PNRA 3WL4A 2QS9A 4TXMA 1B0AA 1RNLA 3CXUA 2CFRA 4BFZA 3INTA 4LXGA 3ZE9A 3TJRA 1U98A 4OJNA 4R1TA 5DHPA 5FLKA 2CBXA 1J2JA 3FZEA 4PYMA 4TLDA 1K68A 3TRJA 1A8IA 4A5OA 1C8BA 2AYYA 4UU7A 1GPNA 2GCGA 1P61B 3UGTA 4JLWA 4TV8F 2OE2A 4BXOB 3TLMA 4QGBA 4Q5IA 1FPMA 4EG8A 1UOOA 1TT5B 1QCZA 1P8JA 2D2IA 2WSYB 4KFSA 3FYDA 2PUJA 4RD0A 5TQ2A 1EI9A 5I7EA 1I3KA 2D1TA 5FHRA 4HTAA 3K0AA 3PFIA 2HBYA 1NUQA 5HBGA 3VYSB 5IVPA 2WWYA 2V6MA 1Q95A 1S7GA 1FB5A 2VZLA 2BFBB 2CJXA 2X9VA 1XTPA 1KHTA 1Y1RA 3EVAA 4RK0A 2B4YA 2FZKA 3FOAA 1A7JA 4NHOA 3AY6A 1NXTA 2DP4E 5BWMA 3ZVNA 4HXGA 3RI3A 2XYQA 1P9NA 2ZI7A 1O94C 3KLOA 5KKNB 1A7KA 1G1AA 3WMXA 1QIKA 2CVOA 3NP7A 4TZ0A 3VC7A 4AMGA 4KDRA 3RK0A 3K2EA 1S89A 2BJHA 4QE3A 4Z1MD 2AWOA 2P78A 4P36A 3O4FA 1U3DA 1ZD8A 1DMSA 2QRQA 2YY5A 2EF1A 4GSLA 2AEFA 1A27A 5H3HA 3Q3VA 4BP1A 5ICEA 4UKDA 1VB5A 4L6CA 3MHTA 5EAIA 1HXHA 1B4DA 3WIUA 2WKPA 3B1KA 1O6ZA 4N7RA 3RFFA 4B4VA 1BA3A 2IZ5A 1E5DA 4OQYA 3LG2A 1OBOA 2O59A 1C0EA 2PR2A 3L7MA 2BGTA 2BM1A 5J5VA 3UMJA 4QJ4A 4BAZA 4DCGA 2G04A 4U9IS 5DW0A 3GNQA 2QR2A 1F14A 2NXWA 4CM1A 3TW4A 3HA7A 1QHEA 1YFZA 2XITA 4KYUA 2JD2A 5H83A 2WY2D 3KKLA 3Q5DA 3QVTA 2A6PA 4Y9TA 4V0LA 4EG4A 3EUFA 3I3SR 5KKAA 2DBYA 3HGTA 4NYMR 2L19A 2GK6A 4EH1A 3M82A 1RPAA 1HWYA 1U0NA 2O2DA 3U0VA 4A26A 1FTWA 5L3ZA 3H17A 3VOTA 3PX2A 4YROA 2CKMA 3IPLA 2GHTA 3PYLA 4LVNA 2X6RA 4N0PA 4CI9A 3JAKB 2JH8A 2XHEA 4M49A 4YBRA 5FI1B 3NRBA 1KDYA 3M34A 3ZGOA 4EJ2A 3L8GA 2YR0A 1E9SA 2V7QD 3E8MA 3RD5A 3L9WA 4ACBA 4ZCIA 5IXYA 3FVWA 4K6GA 2IDZA 3R74A 2C1XA 4J4HA 2OBNA 4BX0A 3PXEA 1BDMA 4AXBA 2QMQA 1X1EA 1AMOA 4FYVA 2H9IA 4JJGA 1UKZA 3EXIA 4KNWA 1Y7LA 2N42A 4NK5A 5C51B 4HQLA 1PT7A 1TO6A 2BFDA 2WF8A 4KO8A 1IAVA 4FGJA 1W2HA 1J2RA 5BV7A 2O0MA 3O82A 4QM7A 2JGEA 1MOPA 2R00A 3K5PA 4GOXA 2C9OA 2ZP1A 3L79A 4OCZA 3WYEA 3ZZMA 2FJ0A 3RF7A 1Y1QA 1NNI1 5AJHA 4QUBA 1R8YA 3UOAB 2ACVA 2NO6A 1RQXA 1OX6A 4GT1A 1ML3A 4YJ3B 4HHEA 3O73A 1I4DD 3O4GA 3A2KA 2ZG6A 4BRZA 1HYEA 4N5IX 3RIXA 3EVFA 1PGJA 1BE6A 4EARA 2WU1A 3OFSA 5HMMA 2E21A 4KI7A 4JI6B 3WOVA 4DRZA 5JFGA 1ECGA 4YRJA 1CT9A 5FWNA 1OZ0A 2GAAA 3Q7EA 5E6UB 1THTA 1NZFA 2BOVA 4G5QA 4L16A 4RA9A 4PN3A 1M6HA 4DHWA 3CR3C 3PKZA 2JCXA 1QONA 3H2BA 3TAXA 2IZ6A 2WTMA 3E27A 1EG7A 1LPAB 2AMFA 4XA8A 2VQEB 3GDOA 3UFXA 2FXVA 5KAMA 4CEIA 1I9CA 2HSDA 3I37X 4JXJA 3RWBA 3ZS8A 1S9DA 2EJBA 3C8MA 5IAOA 3C1AA 2XTNA 1T6NA 1LQUA 3KP1A 3LA6A 5IBQA 1MABA 4LRWA 2CGEA 2H1FA 4EHAA 4F38A 3HMKA 4DM4A 2FPPB 4G89A 1NXQA 3BWEA 2PWYA 3Q88A 2VYCA 2UUCB 4AT1A 4DHEA 3QBJA 3GRRA 1O0CA 1IYZA 1RYEA 1Z4QA 3LP8A 1RI2A 1USKA 3PUYA 2I5PO 2FEXA 1T6BY 1TADA 2I2BA 3DBLA 4DG5A 5GVRA 4Z7OB 5ALGA 3GLGB 1RKXA 4H7DA 3HQ4O 4LJSA 2PYIA 3KT0A 4LVUA 4EABA 4FLEA 4KIGA 3L7IA 3STYA 4C0JA 3P9PA 5CX1A 2LE0A 4IZIA 1DHTA 4KV7A 2OAP1 5FWXB 1L3CA 1WZCA 1JDBC 1QGUB 2D5BA 4ZOLA 3FM9A 1NZJA 3BD7A 5KWSA 4RY9A 3NCHA 4RHXA 1WPXA 3E3LA 3IEVA 3ASZA 5ALOA 1XI2A 4ARZB 4B8YA 3E5MA 1E5VA 5JY6A 1KI1A 1JPVA 1X92A 4S1VA 4UUPA 4PLPA 2QUHA 1ZD9A 3ZDZB 4YFYA 4EW3A 1FRQA 5AI4A 3KJHA 4R5MA 2QYTA 5HE8A 4J94A 1UDCA 4N9WA 4UMDA 3AFHA 1YD7A 3LX6A 1GD1O 3L4EA 4DWJA 3E1GA 3H0EA 4QDXA 2W93A 2ZUEA 4J1QA 3NOQA 2J87A 3G82C 3QQ5A 3RJMA 4QPNA 5JJ5A 2A67A 4EGCB 5AKHA 2ZEJA 2D74A 4S3MA 3GPCA 4JLBA 2HGSA 5B64A 2AN5A 4D81A 2H65A 4CEHA 2FR1A 2OOSA 1FMCA 2EEZA 1UBEA 3WFJA 3B3JA 3JQFA 2QX4A 2JGJA 3KKNA 4R1QA 3KL2A 5IYZB 1PEAA 1YACA 3GEGA 3IR5A 3S81A 3IV9A 2VFAA 4ITVA 4MV6A 2UZ1A 3OZ7A 4L07A 4XYMA 3VHXA 1OV6A 3A0RB 2BY4A 1PK9A 1ZIOA 2FQXA 1YS4A 2FMTA 3TRHA 3I62A 1RQPA 4E5DA 3SQMA 4J0IA 4ZDKA 3TN7A 2ZI9A 2BUAA 2ADFA 2W2QA 1QOQB 2H2FA 5CVJA 4KIJA 2JJ1D 4ZA2A 5F4BA 3JQ8B 3FPHA 4I1IA 1ENYA 4JB2A 4KRXA 5G4LA 1XLTA 1HFWA 2G06A 2Q6LA 3LV8A 3V34A 3G2PA 1UPUA 1YULA 3V3TA 3F2VA 1R8QA 2E48A 4P5PA 2FG6C 4TL7A 3HN6A 3KKPA 3RF6A 2ZTHA 3SS8A 4D4JA 3MMXA 4ICIA 4B3TB 1G8PA 3ZC3A 3K73O 2AD1A 3B6IA 3QW4B 4URUR 3MILA 3PEWA 3EPKA 5BRJA 3I6ZA 4PLCA 3STVA 1EX7A 3SZ3A 4F5WA 5DTIA 5DNCA 2PY6A 4WW0A 3RJZA 4EW1A 4J43A 5D3QA 4CIXA 3TR0A 2RHDA 2PRYA 1NBWB 3OU7A 5AWFC 3FRIA 2IYEA 5ESXA 1LBHA 1LK5A 5DHSA 5LP1A 4GYYA 1QLWA 1Z47A 4WAUA 3EHEA 2UUPA 1MO5A 3GWGA 3QFHA 2HIHA 1Z8HA 3UXYA 1EWQA 3EXIB 4G56A 2HW8A 1FDTA 3HH8A 1Z29A 3W5BA 2W6NA 1UOEA 2O50A 5K51A 1KDPA 1PZGA 2JLYA 1JUDA 2QZZA 3EXG2 2QTNA 1MZVA 1ZNWA 1TGYA 4AJLA 2HF2A 3VSEA 4G0NA 1P2FA 5F2NA 1FP7A 1QZTA 2AL7A 3HWSA 2OGSA 4FCTA 3CTPA 1F6BA 5C8VA 1I7PA 4OQ4A 3A1DA 1MD9A 2RGAA 2VA9A 4MOWA 1L9XA 4TZKA 3PGMA 3D3QA 1M0EA 1II9A 4GQBA 4QUKA 1I7NA 1ZX1A 5EJFA 3WLOA 1Q83A 3Q6IA 1H22A 1Y6QA 2EKZA 3KQWA 1SEVA 4H1TA 4A8HA 3HVJA 3ZI7A 1SG9A 4PWYA 1JYEA 1J1UA 4CM4B 1C7RA 2HPAA 1WUJS 1GPBA 1XZMA 1O7JA 3GLHE 4DPLA 1SQSA 2AUNA 3K9LA 1S8OA 1QRTA 4LF9B 1P1CA 1T8WA 2AMVA 1FEZA 1ZUIA 3EXFB 3OZSA 1W0JD 4JA2A 3ZKAA 4IHAA 3D3JA 5CM9C 2IQIA 3IYLW 2J67A 3NC4A 1WHSA 5IDYA 3B1XA 2GBCA 3ROXA 3EDYA 3EQ8A 3VI3B 1GV0A 4H1HA 2DH6A 4GXQA 1TUGA 1RFGE 1M8JA 4OAOA 3C0KA 3UUFA 4WLOA 1PWEA 3ANLA 1IH8A 2VYND 3BWXA 4MRSA 4JBIA 4PANA 1DEOA 1NVBA 4C1BA 4POOA 1I3MA 5H7XA 9LDTA 1HTTA 1NU8A 5JAUA 1RZ3A 1QGUA 4L0CA 2GXQA 4NE9A 2O8CA 3ED5A 4IIHA 16PKA 4ZTUB 4JUIA 3VRHA 3JYQA 2B21A 1J0CA 2I3ZA 2LIVA 1B6GA 2NQ2C 3CT4A 5FV7A 1ND6A 3U3RA 5CVCA 1XPJA 2OV3A 3FHJA 3L7KA 3R3ZA 4YAKA 2ZE5A 3CFYA 3MBOA 3HKEA 3QU7A 2AKEA 3QE9Y 2C04A 4UJ5A 1KRWA 3D6JA 3HBMA 4PZDA 1MV8A 1UOPA 3DAGA 3TIIA 3PQ8A 4KXVA 1J97A 1RP1A 3DVAA 2R7KA 3T5MA 3FOEC 4W5JA 2RGWA 3SVLA 2JDIA 1VHLA 4UM9D 3S2ZA 4A5SA 1C3LA 2VKTA 1QM5A 2A4KA 2WG1A 1ULSA 5KYGA 2DJ5A 2FPWA 1X7ZA 4G5HA 4I4TA 4LV5B 5HOQA 1UL1X 1MO2A 2C4MA 3OFKA 3OP4A 4OIFA 1GCIA 1RHMA 4ZK2A 5K7SA 1GTL1 5TIIA 4FXPA 4FKMA 2PJDA 4MEJA 2CNLA 5E6UA 2XVYA 3C6XA 2QNIA 5T4EA 3EAQA 2FTKE 1CUIA 1E6KA 3O1LA 2NYVA 3QI2A 4JROA 2FGJA 3MWDA 3WA7A 2Q6OA 1YE8A 2GJKA 1U7UA 1U2GC 1MTZA 3FKSD 1RJFA 4Z9FA 3B8EA 4PQYA 2EL9A 4LRUA 1YAHA 2YBEA 4OP1A 2BD0A 2P1DA 3RAEC 1YWGO 2IH5A 2B7BA 1V47A 2IS1A 4QLBA 2R8EA 5EZYB 3FBTA 1J42A 2PLAA 4UEKA 3IP3A 1QU3A 2G09A 4P35A 1QH9A 1RC1A 1YUBA 4MZDA 4KLAA 3RVBA 4RYDA 2C92A 1FJ2A 2XYRA 1AN0A 4TQAA 1XQ1A 1XF9A 1L1EA 3CA8A 3TSWA 3NC1C 3ZG6A 4X66B 3QTLA 4PC2A 2YXNA 5SZJA 3SZOA 5JNLA 1Y1KE 4JBNA 3SF8A 2ZSUA 4DBZA 4K9KA 1NV8A 1T29A 3CNOA 1FP1D 2YJTD 3ABZA 3LVBA 3OOWA 3SS9X 4EG5A 4D42A 3C7DB 2QSUA 1YMUA 3MJCA 1NXPA 4MQLA 1R6TA 5T41A 4HLDA 2GPTA 4R8KA 4DNQA 5I5EA 1WHTA 3QMMA 3X1DA 1R6AA 2QJOA 3RT9A 4BMNA 1Y6ZA 5DYWA 1DTSA 1NJSA 1FLDA 2WICA 3ONEA 3RRMA 3TTYA 4LTNA 3FE2A 3IRVA 3EW7A 1OLUB 4RQUA 5DXFA 2W2VA 3PUHA 4GXTA 4RLFA 5AW9A 1KO8A 4AW9A 3VNUA 2PXCA 4S2EA 4AYWA 4GD3Q 3BDAA 1HG0A 1P6XA 3SVTA 5EHIA 3OQ6A 5AM4A 3KALA 2FR8C 2G3YA 3WZLA 4RTLA 3N2EA 4OI2A 1G2IA 2KMLA 3F6CA 2BI4A 1N2XA 3ICVA 4GOLD 4O4LB 3T3HA 4OHYA 1Z6YA 1G9TA 3OIFA 4NAVA 4H60A 4C7BA 3ZS9A 3H11B 2BFNA 4GMKA 2BMDA 3IIKA 3BXZA 4YFVA 3U3OA 4W5QA 3H1PA 4WXEA 1MZPA 3K1AB 3IVXA 4JU8A 1Q0UA 5JJLA 4N3GA 4POAA 1SUCA 5AVZA 4QYIB 1JIQA 4QUIA 1XD2A 1XCOA 1UBNA 2EJCA 2J9GA 4MYUA 5AJZA 3GJSA 1VE9A 3B3FA 3SR0A 5KNBH 1EBBA 1D2GA 4PLYA 3FGNA 3PGXA 5KSZA 1TKBA 4GS5A 1EG2A 3KHTA 5TQ0B 2J5KA 2VPWA 4K6KA 3CUEF 3KR1A 4Y1RB 4BO4A 4W5TA 3LC1O 3HDGA 5KYKA 1LBTA 1TTHA 2IIVA 4ZZ1A 1A7UA 1KBQA 3AF3A 3EGOA 4IYJA 2GHIA 5DM2A 2VN8A 2JLAA 3GYGA 4U6SA 5HG0A 3AUSA 3UK6A 2R5FA 1J99A 3ZTTA 1EBFA 4GOND 1AO0A 1NA5A 4XWGA 2O3RA 5JQGA 2O1SA 2QL9A 1PZFA 2HGZA 1GA6A 2X2OA 4YV0A 2PWAA 4N5LA 1NW8A 1PLKA 1UOQA 1H2ZA 1ZK2A 4TUYB 1M6NA 1QF7A 3S40A 5K2OA 3M5CA 4B4OA 4FSXA 4E1AA 1J8FA 1NHWA 3AL2A 3SJZA 4BPRA 2AQKA 4IDAA 4XR9A 3GPIA 1C2TA 5LM3A 2AEEA 1CUXA 4NBNA 1WIWA 3I04M 3F6PA 5JDCA 1DKLA 2B78A 4KR9A 5BSUA 2Q9UA 2O3TA 1CUEA 4AULA 3CX8A 2CEKA 2MYTA 4H31A 3SX0A 3AVYA 4P83A 3VYRB 3GT0A 1O95D 4BN0A 1F06A 3MT8A 5JSYA 5CYPA 3PQ4A 1MENA 3L46A 3OESA 4N03A 1EB8A 3DFZA 5DGIA 2JRLA 1JV2B 3QM1A 4TTPA 3TPZA 1KKMA 4BVHA 2C4NA 1ZD2P 4GH5A 1VL6A 3PEUA 2B5WA 3PDWA 4L9AA 4AP5A 2D6FA 5AH0A 4JSYA 1KAMA 1NXVA 5G2OA 2O8NA 1LK7A 4RENA 4D9CA 4YXFA 3RUAA 3ORQA 2B35A 1P0PA 3H8JA 4MR8A 3D1VA 2JGIA 1GT91 2ON6A 3VNSA 4PF1A 2YIVX 3FZNA 3CO0S 1JJIA 5A06A 5JJKA 4DXAA 1AUPA 2VF5X 3TLBA 2HH9A 3RABA 3PTLA 2CUNA 3Q5GA 3DT9A 2E89A 2GM3A 3SLKA 2Q2OA 2BI7A 4DDTA 4NOKA 3U7QB 3AMVA 2NG1A 4MQFA 1DKRA 1GGKA 4LJAA 1GTG1 5HMLA 4ZVKA 4MRMA 4EY5A 2ZUTA 4M76B 4PAWA 3NHFA 2QX6A 3NHRA 4L2IA 1XNJA 1EDDA 4R4JA 4RJLA 4LC1A 4OHFA 3MTQA 1M1XB 4H1UA 2XDYA 4MPJA 4RD4A 3V1MA 2X3UA 3ZXSA 3AY3A 1JEOA 4NFHA 2JIZD 4B6RA 1Q2XA 4M98A 1YZYA 2AN1A 3KAQA 4XI9A 3FZYA 3FWYA 3BJZA 4WIAA 1YASA 3GPBA 2OECA 1M2GA 1QOPB 2IHUA 4AO7A 1XAHA 7MHTA 1T5DX 4EDHA 2VJKA 1M2OB 1QAOA 3N2KA 5CFRA 3OFNA 4AJOA 1D1PA 4UHHA 1BS2A 3MCUA 2W6IA 1M6WA 2BM8A 3VO1A 4EB6B 3IE1A 2IZZA 1NUTA 4FZVA 4XM1A 3JQ9A 4J76A 4WRRA 3MELA 1KP2A 1YZVA 1RRGA 2BELA 3AP2A 3BRWA 1LTKA 5GP1A 4G1VA 1GKKA 2VUSA 3IHKA 1KI4A 3C70A 3PXBA 1I6KA 1OXKB 3G2OA 4HQ0A 3MAGA 3LPCA 4J91A 5CXSA 5DISB 1HT1E 1TTPB 1UQRA 2C4VA 4BX2A 2BLNA 2BSQA 1POWA 3LZ6A 2QTWB 3LL4A 4TQGA 3G0BA 5D3MA 2R8OA 3VKGA 3GFQA 5CH8A 4DWWA 4ARSA 3GPLA 3C3DA 3WLLA 5JCOA 5EJ9A 3AV0B 2GO1A 3BJEA 4YCMA 1R74A 4IVNA 3THSA 3M6VA 4RZUA 3PFGA 1OYOA 1C3XA 4EHLA 2D7JA 1AK1A 1I4TD 1E3EA 1YVEI 4RD3A 5U4QA 2RE8A 2BFAA 1I6WA 2YWEA 4MDHA 1FJGB 3T8YA 3U4AA 3W8NA 1WM1A 3K5HA 3DMFA 3A9UA 3ZBUA 1TE2A 1QKJA 4HUQA 1QFJA 1FU4A 2IPAB 5H82A 1UAYA 1EX1A 2AHRA 5I7RA 4RIGA 4WD3A 4BVAA 1KEUA 4TT3A 1FSPA 4HP8A 1LY1A 2H06A 3IQHX 5FL7D 5C9ZA 1QQTA 1BMFD 1TM7E 2QM8A 1JAYA 1XJWA 4UHDA 1Z12A 5B1HA 1PV1A 1LGYA 2XMCA 2ZRAA 2ZT6A 1P0MA 4LV8B 2ZRJA 3NDJA 1DWPA 3EK2A 1G8JA 3I6IA 4JBLA 4QATA 1WXFA 1PR4A 1G4AE 1PIWA 3TNDA 1ZUNA 2VDWA 3JASB 3N2LA 4CLDA 4AAYA 2J4CA 2WYUA 4HZUA 4OKNA 4QUJA 4E03A 3WWOA 2WKQA 1VE1A 3CNBA 6YASA 1SJ9A 2QPTA 4FFMA 2WQ6A 3PI7A 3NBUA 1X1RA 4NE7A 5AJTA 5JD3A 3DZBA 2JK1A 4MA4A 2XB8A 1Q1AA 1C41A 1F2UB 1V35A 4BEVA 2AK2A 4V03A 5M5BA 1JIKA 1NDUA 1L7BA 1N8NA 4LE1A 4MDYA 4MIOA 4BB9A 1WETA 4ARCA 4BNFA 3K0KA 5DGTA 2IFTA 4XPIB 3LRTA 1O96A 4KK4A 4MUAA 1CY6A 1E3JA 1V4NA 2AJ8A 2HN9A 2NU6B 1X9IA 2YFKA 2Q0QA 3BEOA 3OEEA 4GC9A 1UFVA 4OBWA 5K4AA 1NVTA 1ZSYA 4UU8A 3E3MA 3N70A 2PKRA 1KJYA 5A4KA 2FMKA 4KIFA 4AD8A 3HVKA 1OXBB 4K1XA 4P82A 4DV7B 2VLBA 1EKXA 1TM2A 1UMBB 3I4LA 3JAWA 3KB6A 3INGA 2GHQA 5JXJA 1IM8A 1E79A 4OLHA 4EAQA 5BV8A 4OSEA 5KDOA 2CJWA 5CG2A 1NW5A 4ZO7A 3QJ5A 3MVEA 3EPLA 2P75A 9MHTA 4GMGA 2Y1LA 4AJIA 4JBHA 4YP1A 1ZRHA 4BLOA 4B46A 1GRQA 4I1YA 1LTQA 4M7PA 4Y7DA 2VEOA 3N8GA 5LFAA 1EXVA 1CS4C 4EECA 4CM9A 1ST2A 4YT4A 4DA0A 2CLKB 5A3QA 1GYRA 1DIHA 4LW8A 3TRFA 1UKBA 4B34A 3WYFA 3LWZA 4BNNA 4GIBA 3IPYA 5I4KA 1T4CB 5AQEA 2B99A 4YCSA 1P5HA 2GZ3A 5K3DA 3C16C 3DJFA 2H11A 4BNUA 5ITWA 1H93A 1TPYA 3R20A 2O8FA 3ZZNA 2K6GA 5IVIA 5LB4A 1QZUA 4J7CA 2R4QA 3DHVA 4ZQBA 5A5DA 3G0IA 4C3ZA 1NP3A 2ZUCA 1WW3A 5INTA 5BV1A 4ND2A 5CVDA 1C4XA 4DT1A 5EE1A 2F2TA 2ZRCA 2JBWA 1KNXA 3IDFA 2PZLA 4EJMA 1SB8A 3HU2A 1R4MB 5EHQA 2Z3ZA 4PLZA 4LBYA 1JSRA 4QDOA 3OZGA 4DCPA 1MX5A 1R15A 3MB5A 4ZQHA 3WS7A 2GCNA 1MC8A 5ITZB 3ED1A 1CUVA 1X9HA 1ZMTA 3L43A 2CXSA 2SICE 4RGBA 3R3JA 5IPFA 2FG7C 3ZWBA 3N7TA 1IY2A 3DKRA 1BG6A 3VPCA 3NWBA 4WBNB 2I55A 1KO5A 2V7EA 1KDRA 1U4SA 3AZQA 3MPUA 4A0RA 5D84A 4YRSA 3U6KA 1CUAA 1AY0A 3B6ZA 1K5DA 4O4JA 2ZXFA 2RBEA 4JWTA 5BMVB 5CDHA 5FL7A 2HNKA 1C3JA 1A8PA 4CQMB 1XDWA 4WKPA 5HJEA 1HX7A 1MQ8B 4W99A 2AJBA 4BKOA 7GPBA 5JCXA 1U8XX 2H1IA 3PWTA 5C8YB 2QJWA 1MT3A 4M9CA 2HRDA 2P65A 3E3NA 3CRQA 2OO5A 2PKWA 4YAJA 2Q5EA 3L7OA 5B4VA 4DKXA 3ADOA 4Z9YA 1RRMA 1LVGA 3K71B 1LB1B 1M1YE 1XFDA 1Z35A 2X0IA 4EEXA 2V0CA 2O7SA 4R54A 1L4LA 4ECAA 2BBSA 5I5GA 3RYCB 1UBGA 1BCRA 1SKAA 4TRNA 1H2FA 3OCZA 4BVEA 2I4NA 4L5IA 4S1WA 4F6RA 4AKGA 4YA6A 5E9JA 3K9FC 2UU9B 4YIHA 1MC1A 2P2NA 2Q3EA 2ADMA 3AU9A 3OA0A 3R5SA 4Y2GA 5HA5A 1YQTA 4JLAA 4IM7A 4PFQA 3SC4A 1X15A 5EXTA 3ODPA 4DLYA 3FMPB 4AKIA 3DCYA 5JDCC 2AQ8A 5JT1A 3RSLA 3NTQA 1R1DA 2BONA 2JFYA 1BVYF 2WLSA 3WA6A 1CR6A 1RP7A 2K7ZA 2PZJA 1Y81A 3HC7A 4WNAA 5I7OA 3IVCA 3L4JA 3TNJA 4HUJA 4PZYA 5I3ZA 3AY0A 4HYTA 1CY4A 2YFQA 3CNNA 4HWSA 1ORRA 4L57A 1D1TA 4B17A 3NASA 4F71A 4UFPA 2BHNA 3BJMA 2ZAMA 1DWQA 4M89A 5EP1A 5LU9A 1TT7A 4D25A 1JE0A 3ANXA 3THYA 3R0QA 1L9KA 2X23A 2HB6A 1ND5A 2GYUA 3D3KA 3FPBA 5ESDA 8LDHA 3EXHC 4YCCA 4U2BA 3HU1A 4DPMA 2BF7A 2WJAA 1KAOA 1N5LA 3F1LA 1JXOA 3RV4A 5GIOE 5E38A 1IHOA 1ZJWA 3VV3A 3K1ZA 2INGX 5KTSA 4U7PB 1AKTA 4OY3A 3ZHTA 3MTDA 1H5QA 1C2YA 5I9MA 1XYVA 1ZCBA 2WM8A 5DHUA 5CFPA 2BEWB 2W70A 1M1ZA 2PUHA 1I0IA 1SC1A 1SRRA 2ZR9A 4HDSA 4OYRA 1XGKA 3BIOA 4M1SA 3PTZA 4KAFA 1DC3A 1LSJA 2IGBA 2JHPA 3F90A 1KU0A 3MYRA 3NAMA 4I08A 5HIMA 1A72A 1KI6A 4F06A 4Q7QA 1U6IA 1P7PA 3EA4A 4Q24A 5M2QA 3U3KA 1IJBA 3BIXA 3T34A 3K6SA 4GVLA 1HEIA 4JJZA 3USZA 3LUHA 3DPUA 1UJ2A 1ZGJA 4MGZR 1VG8A 2GAFA 1F5SA 3SYNA 4JI3B 4AKEA 3KWLA 4GKKB 5CT8A 3IDAA 5AI8A 3KWFA 2BGLA 1GZDA 2B4QA 5K09A 1P1KA 2R68A 1Y9EA 1N1GA 1MGPA 4Z49A 3FR8A 3GQBB 3FNHA 1JLMA 2XMGA 3HCNA 2UVPA 2ETXA 3I9FA 3JYPA 3MSXA 5CTJA 4J3NA 3WE7A 2XDWA 1KH1A 1SC3A 4R3WA 1GN9A 1SVNA 3JAKA 3MZ0A 4C0KA 3KLMX 2ZI3A 3LQRA 5FOUA 5FWAA 3TMYA 4HR7A 5BWOA 3NRCA 1QWOA 2OHFA 5DLQC 1GPAA 5EP3A 4HQRA 4HWGA 3V32A 3U6BA 3ON5A 3EWAA 2IDKA 2PH5A 1QHYA 2NT4A 1EVLA 1RI4A 1NR7A 3HY4A 3HZZA 3CSSA 2X8JB 3H9JA 4MAMA 4NVRA 5HIIA 5ALZA 5IJXA 2N47A 3GNLA 5E0OA 1C7IA 1ZESA 3DE5X 3E81A 2V58A 2ZSIA 2V65A 4R81A 4E4TA 1G7RA 1SZPA 1NUPA 1XVTA 2GHRA 3SMVA 1JQ5A 2EP7A 4KJXA 1XMXA 4DCNA 3FPSA 3OKAA 1A8UA 2E5LB 2P3LA 2HHHB 4NYJR 1VHQA 4WCFB 1N4AA 3LWNA 4NXNB 1QHIA 2W11A 1ADYA 1KVQA 1NMXA 3NEJA 4EFMA 3QKWA 4MWDA 1UDWA 2MR5A 1U2GA 3Q1LA 3X1XA 4QTYA 1P45A 4KCGA 4BNLA 5M04A 4MV1A 4JT9A 1N8KA 2PKQP 1UFQA 4Q3NA 4BO7A 1MO4A 1OPRA 2C4WA 2YHIB 2BGKA 3TNFA 4X61A 1XLVA 3EXHA 1HLPA 1MJNA 1PLJA 3FDIA 3VR4A 2ONJA 3FHCB 3KPJA 2EARA 3RAPR 2QVLA 2FKNA 2H07A 5G0VA 4EEKA 2PUWA 1XNHA 1ACLA 1SKYB 4HF7A 2XUFA 3S2SA 4G5FA 3J7AC 1GKUB 3AZOA 1O2DA 4K6HA 2ZR0A 1W88A 1E6MA 3WB1A 4M6WA 1IEWA 3K0AB 1XZ8A 1F12A 3PC3A 3PX7A 2Z8XA 1GZ5A 2CLMB 2Q07A 1YCFA 3WDLA 4GOKA 4DAOA 4X1OA 5KCZA 3QFTA 1GGEA 2PTGA 1W75A 1ID1A 3GGCA 1HE2A 3CF6R 3QOFA 4LOKA 4E46A 2XQIA 5K3SA 3AR9A 4L4SA 5FV4A 3COVA 2OLKA 2HJSA 1Z4PX 1DBIA 3H5RA 3PJGA 2G6TA 4TTSA 4EKYA 2CFSA 1H0RA 1KI2A 1W96A 1N5JA 5CT4A 3O5AA 4PCLA 1TYBE 1UT5A 3PJFA 2J3MA 1JEQA 4XSGA 2LGJA 2ECPA 3QH4A 2OV8A 3AHJA 3NH9A 4CR6A 4ZYXA 1JHMA 1WHSB 2AE1A 3WK8A 1XZFA 5REQB 5E3JA 1LX6A 1DQYA 1RZUA 3V1LA 4FM9A 1WXDA 4RTMA 2V1XA 1RBQA 3T3EA 3CF4G 3JRXA 1TZKA 5AW2A 1V8DA 3MAAC 3GLFB 2I76A 1XWWA 3EOAI 1MRSA 3AW8A 3GBSA 2XZDA 4KH0A 5K4GA 2WA2A 4QLAA 3ZIUA 2XUPA 3QXGA 3WIOA 4HN2A 3G0DA 4F3TA 3HYCA 4FYXA 2FV8A 2KPOA 4ZPXA 2YCLA 1SD2A 3ASYA 1QHSA 3TVDA 4HI0E 1B8NA 1FU7A 3F9IA 4O2AF 3QPVA 4JJFA 4MI3A 5DWDA 2Q28A 2X22A 2JCBA 4BBPA 5A6VA 3STWA 1GHTA 4JV5B 1EXWA 3OUTA 5C8ZA 2PU7A 1RHQA 1PJ2A 3R2JA 1TOAA 3EUWA 2IU4A 2JVJA