4GBXB

Crystal structure of an immune complex at ph 6.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
189
Chain Sequence
VLFQGPGDTRPRFLWQLKFECHFFNGTERVRLLERSIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DM alpha chain
publication title Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 189
sequence length 196
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gbxB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gbxB01
3NIFF 2NR6C 2NR6D 4X7CC 2IG2H 4F7MB 4PRBA 1U3JA 3ULVH 1QFUL 5DYOB 4OM1H 1K3IA 3M17A 1ACYL 3LV3A 1U8QB 3BKML 4GFTB 2KQNA 1X7QB 3QQ3B 1F58L 1CL7H 3L1OL 4HULB 3GHBH 3TESA 2WWKT 5HPOA 4NZUH 2R15A 5E8PA 5AZ2L 2GSIB 1R3JA 2VC2L 3ZHLA 1UWXH 5E8NB 4ZTPL 4P4KC 4P4KD 4GSDH 1FC2D 1HOCA 5C08E 4HKXB 4G8FB 5E0QA 2IFGA 5IMMA 1UEMA 4B7LA 5DRWA 4LLUA 1BD2A 1LO0H 5GS2D 4F9PC 2FX9H 1UM5L 3NH7L 2DIBA 3DSFL 5ENWA 2BJMH 1CLCA 3B3IA 2F5BH 1NGYA 2D4FA 4LSRH 2A0LC 2A0LD 5C7XL 3CFCL 5CJQL 4OFPA 2J8HA 2B1AL 4EJ1C 5M95B 3TCLB 4JZJC 1NL0L 4K3DL 3BP5A 2YUZA 2FNBA 5HXMA 1MH5A 1RVFH 4NZTH 1MHHA 3QNYA 2MCPH 3IVKB 3QG7H 4B53A 2E8ZA 2FEEI 2Q7NA 4P59H 3FT3B 1A0QH 4XCEA 1J8HD 2ZSWA 5DMJB 1N5AB 4KZEH 1OSZA 2YD2A 3MRGA 4V1DB 5GS2H 3LPWA 3HPJA 4XNZB 5JTWA 4WGWB 4P4KA 4X5WB 2VIRB 1OW0C 4UT7H 4XMLH 1BJ1J 5E8EA 4OCSH 4H1LG 1A6PA 3HC0A 3C09C 4WFFE 1MCFA 1RK0B 2P5WD 4QT5B 5E2UL 3MLYH 3MLUL 3VE0B 1K4CB 3GO1L 4P3CH 3VD7A 3LN4A 1NBYA 1FYTB 5GGSB 1FVCA 5HVWA 1P84J 3BWUC 4GQ9H 5D2NA 1UM4L 4DUVA 1Z9LA 3ZTNL 4MWFA 3S4SA 1HXYB 4M6AA 3SY0B 3U6RB 4NNXB 1KEMH 5IESL 3OAYH 1RJLB 4M7LL 1F3RB 4H88L 4HUKB 3GFUA 1FL6A 3BZFB 3QHZH 1U8PB 4NT6B 3OHXB 2FGZA 5CJ5A 4G42A 4Z18A 2OI9B 3FO2A 1CWVA 1D5IL 1J8HA 4XHQA 2IBGA 4KPHH 3RA7L 3CSYB 4BZ1H 1IBGH 4QRUB 2GJ6B 4C4KT 3NCJL 4ZYKB 1EDQA 3IF1B 3F65A 4K7PH 3MRJA 2ORBL 4MB5A 2ZNWA 1WITA 1TVHA 1HKLH 2WSKA 3IFOB 1YMME 1U8IA 2D03H 4XP6L 5J6HB 2LE9A 4GLRI 2DTMH 2P5WA 4P9HH 3RL1A 2C7UA 4PLKC 3MXWH 3O3BA 3R0MA 5IIEA 1YJDH 3RNQA 1MWAB 2DQHL 3QEHA 4K7PX 5M7QA 3FAWA 5KANI 4UDTB 1P1ZB 5GPRA 5D2LA 4HIJB 4WCYL 1UEYA 2YD7A 3WS3B 3RL2B 3HR5A 3MV7D 5E1AA 1TNMA 4NZRH 5C0DA 4AY0A 1N8ZA 5GGQH 1IC5H 3HZMA 5JPMA 1WZ1L 5CD5C 3CFBA 5CD5D 5CINL 4YGVB 2MJWA 4IDLA 1FL5B 4H1LB 2V2XB 1ZVHA 3GMOB 4PBXA 4JREC 4IIQC 4ZD3H 4WEBL 3PDOB 4L4JA 1O5DT 1F11A 1FSKB 2H8PA 1QFOA 3GB7B 4KXZI 4OB5L 2X5PA 2AKRB 1GZPB 3OKNA 3AAZB 3UEZA 1JZ8A 1I8KB 5EU5A 3TO2A 2Z35B 3Q6GL 5LBSL 1GRWA 1BM3H 2ZCHL 4AENA 3U79A 1K4DB 5GGUA 3F7PC 2PNDA 4ODHL 43C9A 3WLBB 4KI5D 2V5TA 2YKLL 1B6UA 3MV7A 4G80B 2Q76B 3WUWG 3WNPA 4MZ3A 1M7DB 2A6KA 4G6ML 5HYEA 4FP8L 3UTPD 4MVBD 1CFSA 5DD0L 3U2SA 4QHUB 1OF2A 4BYHA 4H0GA 5FGCB 4HKBB 5F7WC 1KCSL 2VDQH 4HLZG 1DLHB 3S5LA 1ZEAH 3UZVB 1K6QL 2R56H 3V4PL 2AS5M 4WRLA 2J5LB 4WWKD 1MCPH 4K3JH 3HZKB 2AW2A 2OS7A 1V3JA 3RWIB 2EE6A 1YYLH 4PRPB 5EUOB 4NC0B 1A1NB 2DM2A 2DIJA 3MSPA 1JFQL 2I9LB 3MJGX 1A8JH 1OGAD 3B9VA 4Z7WB 1KLFA 5EORH 4XPFL 2R23B 5CSZA 2W0FB 4EUPG 5ICXA 3SGKC 2Y9RT 4NHUB 1CXLA 2CR3A 3MXVL 3C2SA 4FQXD 4FQXC 4NNPH 4OD2B 3WFDL 1RUMH 3JUYA 2NY3C 2NY3D 1FAKT 3I50L 3D25B 1JPFB 5FM5O 1S7SB 1XF1A 3HLAB 3BP7A 2BFVL 4WHCA 4X5XA 1J18A 1E4WH 1OAXH 5DD5L 1EO5A 2QQNL 1WCBB 4LRIA 1F4YH 3STLB 1QYGH 1FGNH 3SDCD 1MAMH 4OLYH 4F58H 5J1SC 1FNLA 1CG9B 3QXAB 1PEZA 2L7JA 4JPIB 5SWQA 1XF4A 2R9HC 1A21A 2R9HD 5EZOL 2VN7A 4R7DA 1G9NL 2ZG2A 5DA0B 3SE8L 3V5KA 4MDIA 1LQSR 5IFHL 5DK2A 4FTVB 1Z5LB 5LCVH 1JWSB 1TCMA 3LY6A 4JDZB 5IV2B 1L6ZA 5IB3A 3C5SB 3DYPA 3HTLX 1SY6A 2BY1A 4OKVB 2C1OA 4FQJL 4FZEH 3WO4B 3LKNA 3U83A 12E8H 1OGAA 2IGFL 3WUWB 3TA3B 3UYRL 5FEBA 2EYRB 5FB8A 4LPCA 2A6IA 3D18B 4XMPL 5KVGH 1OCWH 4ODTL 3T3PE 1PW3A 3D39B 4FQXA 4YDJB 4P48A 5D7SH 2BSTA 3D2UB 2OL3B 4RFOH 1P4IL 4OT1H 3ULSA 1MPAH 3SJVD 4Z78A 1MJ7L 1QBMH 3FT4B 1HQRB 1MCNA 1TVBB 3L5XL 4PJFF 3TBWB 5FA4B 2VDOH 1EXUA 2VDMH 1S9VB 1OGTB 2WBJC 2J88L 2WBJD 3SDCA 2VNCA 1HSBA 1IC4H 4YEFA 5GS0L 2ZCLH 3T8XB 5E94B 1RQ5A 3DO7B 1FLRL 2AK4B 3N85L 3T3PF 2HVJA 3RVXD 1AJ7H 3WNKA 4I48A 2Y5TA 4X6CE 2JB5H 2YPVL 4X6FB 1JYWA 3NFNB 1UFUA 4EUPB 4Z77A 3Q1SH 4RAVB 3RTQC 3RTQD 3VWJB 5T3ZL 1A7NL 1IAIL 2W59A 5EUKB 5I19L 4AIXA 1IJ9A 4YHOH 3VXNA 3SCMB 1Q0XH 3T2OA 3DROA 4Y4FB 3CLEL 4JO3L 5GRUL 4PV8B 3U30C 2AK1L 4JM4H 4WI9A 4ELMB 1ADQH 4ZQKA 3SPVB 1JGVH 3C6LC 4C56E 1RD6A 3FOLB 2XT1B 1F4XL 3EYVB 4ENEC 2XTJB 3SJVA 1WGOA 2DQGL 2ITDA 4GW4A 4X6CF 3BAEL 1ADQA 4GRWB 2HMIC 2HMID 3JV4B 2D3VA 2E3VA 3B83A 2B5IC 2ZZUT 1A7BA 3EDEA 5FECB 4OCMC 1CFNB 3IKKA 1A3LH 1U91A 2WBJA 1DSFL 4R4FL 2DWEB 4AMKH 4I2XA 3PQYE 4YHMH 5TF1L 1K2DA 2FX7L 3OKLB 1BQSA 5IGXL 1QACA 3CDGB 3U9PH 2BVYA 3OKEB 4LARH 1T22B 4RNRA 3ZE2F 2BNQB 1CGSH 3VDCA 4IRJB 3RTQA 4AT6B 4UILH 4U3XA 3VFSA 2B2XH 2RGSA 3V6OE 2F5AL 4NBYB 5HYJD 4Y4HD 3HI6H 3MMEA 3MGTA 4GAJH 2WNGA 2V5MA 3H3PL 4GW5A 3FTGB 3UP1A 5MEPB 4C58B 2DQFA 4U6VH 4MGXA 5HDLA 2NTSP 4BQ6A 1RIUL 1CE1L 4DKFL 4PY7A 2GFBA 1N26A 2OMBA 4ERSH 1EERB 2VDRL 5JOPD 4L3ED 3WN5A 1WISA 4K9EL 3SQBA 1LP9B 1T1WB 2M1KA 1EFXB 4JFXA 1QOKA 1XGPB 1DCLA 5IEHB 4HKZA 3WIFA 1GC1C 4MNQE 5K9JL 1KJ2B 1UACL 3EKCA 4KDTC 4NKIH 1BF2A 5FV1L 5L6YH 4GS7B 4YDIH 2VXTL 2XRAL 1LD9B 3SDXB 3V7AG 2FCBA 4HIXH 5E00B 2R0ZL 4PJ5E 3MLWL 4PUBL 4XTRD 3VFMB 3FFCB 2FJFA 4LU5H 4M5YL 2P42B 3W2DL 3BZEB 4CNIB 3HE7B 4Y2OA 1VACB 3CVHH 2X41A 4S1DC 1B4RA 5HYJA 3QIBB 4Y4HA 2NY5L 3C5ZB 5D8JH 3WFHA 1I1YA 2IALB 1AD9B 4OUUB 4GAGL 1DVFC 5TDPB 1DVFD 5EOCL 3HUJA 3NA9H 1E4XL 3W9DA 4R97B 4PJIF 3CVHA 2RHEA 2PYFB 2NXZC 4OI7A 2NXZD 1JVKA 4LHUG 5IG7B 3SDAB 5EBMA 4RMWA 5EC1B 5ITFB 1A9EA 1QLFA 1GC1H 4E41E 1KIPA 3QA3B 4KY1L 4FQCL 1YY8B 4L3EA 5INDB 1IQWH 1T03H 3LZFH 3H7BB 3VDBA 4PJ8C 2H1PH 1ONQA 3WNLA 4TUOB 4OCXL 2CUHA 4FA8A 1FFNA 4CU8A 1IE5A 4P2OD 1Z3GL 2P49B 3MNWA 3FN0H 2W60A 2UY7A 2VDLL 3C60C 2IPUK 4F7TB 1FDLH 3PXHA 3TC9A 3BEWA 3BOVA 4M7JL 4OSUL 3ARYA 4G6JH 1VKXA 2DL2A 5F7EH 1ZAGA 3L5WA 1HEZA 1NGZB 3D87B 4PG2A 4QHLB 2C4FU 4A6YB 1DVFA 1FNGA 3HHRB 4F80A 2I24N 3NACH 3SE3C 1N59B 4E0RB 3LH2H 4H0IA 2FX8H 5LKNA 4JFFE 4YHKH 4PJEE 4DOHE 4MXWH 1U8LB 2BX5A 5HHNA 3BH8A 3WKNA 2ERJB 2HKHL 3VA6A 2FYYB 4JPVH 5B8CA 1ZT1A 1IGML 1NGWB 4LRNH 4KTYA 1NCAH 3NN8B 4CKVX 5EBWB 4NO2B 5ALBL 3QXVA 4P2OA 1AGDA 5DI8A 1OB1B 4Y1AB 5SWZD 4TSCL 4S1SL 1NCNA 2A74B 3GSUB 3ESUF 1CR9L 3C60A 3KYKH 5ESAA 3VFOB 2WINA 3FB8A 5ICYA 4HGMA 5DWUH 4LDOB 5T5NF 1LK2A 4MQXC 4PP2B 1JV5A 4MQXD 4MXQC 5ANMB 2B4CH 1CICC 5DZNA 3NPZB 4OTXL 4YFDB 4H20H 2F8XC 2V7HB 2VXVH 4O51B 3VWKB 2NNAB 3SE3A 2PYED 2VLLB 2F19L 1SYSB 4NKOA 4X9HA 4FQQA 4TPRL 1LEGB 5CCKL 4O02L 1A1OB 3JWOH 3QBTB 3QDMD 3VCLB 1CXHA 1EEYA 4ZOBA 1DQQA 2FEDD 2GY5A 3D69A 1WFNA 3QULB 2ADIA 3RZCC 3RZCD 5EZJB 2NY1C 1QFHA 4QRQB 4Z0BL 5F3HB 4GRMA 3NPSC 1FRGH 3AROA 5ID1B 5SWZA 4GG6A 4NGHL 1Q9LB 3OMZA 3MA9H 4N8CH 3LD8C 4Y7MA 4YHPA 1IL1A 1FCGA 5D6DA 4AIOA 5FKPA 2QHRH 2EKJA 4JM2F 4PGBB 1DE4A 2H2SC 1X5XA 2R4SL 4DN3H 1HNFA 3O4OC 3TIDA 2DD8L 3P11L 1F3DH 5I1KH 1C12B 4WHTB 3KPRE 2PYEA 1RZ8A 2R4RL 3MLVL 5I8OL 1KT2B 4PJBA 3QDMA 4TULH 2ZUVA 3K8KA 5J12C 1ZLWK 1OAZL 1RUAH 3VXRB 1JTPA 1NFDB 3RZCA 2YEZB 3ZKXB 2IF7A 2DM7A 3L6FA 4KI1A 1S7VB 3K1DA 1IEBA 3SGDI 4CDGC 4LKXA 5GJTL 1D9KD 4JFYA 4NWTL 4TUKH 1P4BL 1MQKH 2YXMA 4EIGB 3VD9A 4RZCB 3HRZA 2CLZB 2EDNA 3JWDC 2D0FA 3L3JB 2IH1B 4YNYA 3DARA 1PDKA 1JNLH 5AZEH 5EO1A 1T7XA 4XBGB 3D6GA 3KS0J 1OAUL 1HYSD 3DMMC 4EVNA 3BPOC 3DMMD 4DGVL 2NQCA 4C57C 3QUML 3FQUA 4X8XA 2CDFA 2HH0L 5KSVB 5FXCH 3KLDA 2UZIL 5EZIL 2OM5A 4TRPL 4DVBB 5TH2A 5DR5L 5JA8B 1WFUA 2H45A 1R5VB 3MUHL 4JY5H 5DSCB 1MLBB 2G9HB 4UZGA 4JQIL 4YH6A 3DVIA 1RHHA 5K9OA 2KQMA 4NSKB 1G0XA 1MEXH 4HPYL 5IJVA 4LSTH 3DLQR 3WIIH 5FDWA 5BRZB 4MCZB 1DN0B 2CK2A 3JWDH 3L7EA 3MV9D 1LNUA 4KTDL 3CK0H 3QFJE 4GMSH 1HHHB 1MCEA 3Q3GB 2CLRB 2DLEA 2H2PC 3NIGF 1R5WA 3RUGA 3NFSL 1EMTL 4K3EL 3S98A 3DHMA 1D9KA 3AXLA 1K85A 5TDNA 4LLYA 1H15A 4BUHA 1W72A 1T7YA 3P4OB 4JO4H 1X5ZA 4S1RH 1RZGB 5KSBB 2WUBL 3U4EB 3EZ8A 5CD3B 5JXAL 2WWMD 2CRMA 4JKPH 4PJXB 4MD0B 3V0VB 1MAKA 1LEIB 4K55A 4L29A 3DMMA 1P9MA 1WSST 3RJDA 1JBJA 5L2KE 1QFWL 2APVA 2I5YL 1W0VA 2OTUB 4ZOAA 3U1SH 4RMQA 3WFBH 2GSGA 1KIRB 5IBUG 4QOKD 4Q6IC 4YUEL 2ILLA 5E24E 4M1DL 4MA7L 1HH6A 2C3VB 2X4PB 2JCCA 1A6AA 4XCNA 4ZG1A 5C71A 3W39B 1JPTH 4S2SB 1CDCA 3WHXB 5GISL 4JZOB 5LAXA 4ODSH 4U1MA 2VQTA 3ULVE 1DBBL 5TQ0H 1WQVT 5CJ8A 2A77H 1RZ7L 4ZUSA 2NW3A 3MV9A 4PRDB 3O8XB 3CC5B 2VR9A 5IB5B 2ICWB 3QEQD 5L7XH 4NQVB 2LU7A 3CUPB 3CDYA 5A2KH 3NCYP 5EOTA 5J6GB 4PJDA 4U7SA 3K46A 5F7DA 1D6EB 4J1UA 3OKKB 2R1XA 3KJ4B 1BD2E 4RGNB 3OKDB 1T66C 1MLCB 1T66D 2QEJA 5GS1C 5ACZB 1KPVA 2OXHA 3GM0A 3UJIL 3OB0K 2IBZX 3ES6A 3HNTL 2DQEL 3ZKMC 3GUTB 2HJFB 2A9ML 5C0IB 3MLPA 1HIMH 4QOKA 4JO2L 1D7FA 3LN5A 5JIIA 3RIFF 3OXSB 2X4NB 4JPWL 4DEPC 1DR9A 2AVGA 3MRKB 4HJGA 5EA0L 4XP5L 3VFPB 3NBNA 4KQ3L 5I8EA 1K8DB 2GUOB 2ZKHL 1KACB 1JNNL 2FSEB 4Q9BA 4ZPTB 3REVB 2J8UB 3RY6C 4RRPA 1IEAA 5F44A 1IKFH 1UCBH 3QFDB 5CMAA 4YE4H 5D7IB 4P5KB 1G7QB 2FHCA 5BZDA 1G7IB 4YHNA 1KFAL 3MRMA 3BDYL 5IFJB 4ISVB 3QEQA 4WO4B 5C0NC 5HHQA 5TQ2L 3GMRB 1BOGA 2HG5B 4G6AC 3L3HB 4G6AD 2WW8A 3TN0D 4U0QB 4M6NH 5DUBB 1QSVA 3L7FA 4J3SA 5JDSA 5JHLL 2FL5A 3CDFA 3EO9L 1QQDB 2UWEA 5GS1A 5CWSA 5D2NE 2BY3A 4XNMA 4ONGH 4FQ2L 3GNML 1INEL 4HIHA 4BUGA 4EI6A 3SDDB 2FATL 3LHPH 4RMUA 3JVGA 3L5IA 1NLBL 4HK3J 3RWDA 1JRHL 3WXWL 5GGVH 2VSDA 1O7VA 4OZHB 5KW9L 5KVDL 5JPNA 1R3IH 5C0JA 3INUL 1SYVB 5IKCB 3F58L 2CSPA 3STZA 1RJYB 1QFWM 5D71L 1KB9J 1J5OH 1SEQH 1J8HE 3DUHA 2DI7A 1S9YA 4WEMB 1MRDL 4U2ZA 3RY6A 3T2NH 2W38A 1IM9B 5DK0B 3RHWF 4ZSOB 3G5ZB 1KXTB 2PCPB 4H5SA 1ACZA 3B9KD 5CEXB 4KVCH 2HTKC 2HTKD 2XZZA 4M02A 4HWEH 3H0TA 1FH5L 4JN1L 4JFED 4YBHA 3EDJA 4OZFH 4IJ3C 2HWZH 1AGFA 1JGDA 3TN0A 2P5WE 4KVNH 6FABL 4LLQB 5D9SB 3VXMD 4HFUH 5F6IC 5AAWA 5HHOD 4KAQH 3D85D 3ARGB 2FLRT 4S10A 2NY0D 3P4NA 3W81A 3WIHL 3JXAA 4KH2A 3BRFA 1FORH 4OZFA 2D9QB 3IJSA 3EOTH 4XNYL 5E2WH 3TBYB 5E5MB 5MENB 2ITCA 4UTBL 4WI2A 3O45B 3VG9C 4XWGL 2FIKB 2YD3A 5D2LE 4OZIA 4RGMC 3U7AA 5BVJA 1CFVL 3O11B 1SQ2N 4JO1L 5FO7B 2DMBA 4OQTL 2EIDA 3BGMA 1S7RB 1U41A 1JZ7A 5L9DH 1YDPA 4EDWL 4X7TA 4M8QA 1QNZL 3VFUB 2HJLB 4TOYL 1IGIH 4DN4L 2OP4L 3HMXL 4Z95L 4WW1B 1FNFA 3PV6A 3MRPA 4G8EB 2VDNH 3B9KA 3GMLB 4X80L 3O0RL 4XPAH 4MB3A 1MI5B 4JFEA 2ZUTA 1TETH 4KDWA 1TZHB 1U3ZA 4NDMB 1W0WA 1UA6H 4TYUA 5AWNL 2XA8L 2ICCA 1S7UA 1MY5A 4OCYL 4PLNC 1XAUA 3VXMA 1QG3A 5HHOA 4HDIA 1OP5K 3D85A 3FB7A 3UTTB 2BY2A 1A4JA 4XCYA 4XNXH 3B9AA 3R06B 4FN0A 5DEGB 2FECL 1E6OH 3GHEH 3P0VH 2OR7A 1NCUA 3PNWB 3BP4A 1SHMA 4JB9L 4ZFOL 4G9DB 3MV7E 1YECH 4MAYB 4ZFFB 3H9ZA 1E4KC 4OF3A 2EKSB 3IDUA 5HHMB 3GSXB 1CD8A 3PIQB 1LVEA 1TFHA 3B9DA 4F7MA 4HG4K 1J1OL 5DYOA 1ZGLB 5IQ7H 2DIAA 5ILTL 1U8QA 3BKYL 1X7QA 3QQ3A 4Q9CA 2BNUB 2JIXB 5HY9B 4L3CB 3GSWA 5T3XD 3QSKB 4OGYH 2BERA 1I3GH 3EHBC 2GSIA 4V1DD 1UM6L 4BSVB 5E8NA 1OARL 5DMYA 1Q8MA 2IANB 3HI5H 4G8FA 5AYQA 4J12A 3RU8H 4R2GB 2XN9B 4R3SB 4QHMB 1BLNB 4MA3B 1UKSA 1YNKL 3MZTA 1FYTD 1VESA 4KI5E 4RISH 3QUYB 4G9FB 5I18H 4HK3N 1YEEL 3LEVL 1IAII 1E4KA 4XPBL 5L88L 2EXYC 3MRLB 2EXYD 3OJDB 1N0LA 4P2YA 3UTPE 4DAGH 4MHHG 3EYQC 2J4WL 3EYQD 1F4AA 1X5YA 5FHAH 5T3XH 4F57L 3IVKA 4J3UA 2COQA 1RHFA 3FT3A 1S5IH 2D31B 4ZTOH 1A5FL 2KDGA 3CMOL 3CFJB 3FRPG 1N5AA 4HX1B 1I9IH 2GJ6D 1OVZA 2DQJH 1S3KL 1YNLL 4V1DA 2M26A 4LQFL 4NCC1 1IT9L 5FGBC 3CD4A 4LSPL 1PKOA 1FPTH 1JIBA 1UWEH 2VIRA 4X5WA 5I1EL 3MR9B 1F4WL 4RA3A 4XVJL 1AC6A 4L1HA 1PGRB 1QA9B 1WBZB 1OGAE 3X14B 1U2HA 1RK0A 4QT5A 1M7IB 3VE0A 1K4CA 4IM8A 1FYTA 5GGSA 2YPKB 1S78C 3TVMC 1S78D 2DMKA 5ITBH 1TXKA 5JMRA 4NC1C 1QZ1A 4D0BB 1HXYA 1INDH 3SY0A 3U6RA 1H9VA 1HDMB 1G7JB 1RJLA 3KPLB 5HI5D 5HI5C 2R0WL 2AJUH 3BZFA 3F7QA 1U8PA 4NT6A 2VXSL 2JJWA 2X40A 3OHXA 1A7QL 1C5BH 3UTSD 3P30L 3KXFB 4LLVB 1ZVSB 4NO0B 3PWLA 3QCUL 2DM4A 3VD5A 3HC3L 4UIKH 1TZGH 2CGRL 3MREB 4QRUA 4KROC 2GJ6A 4ZYKA 3IF1A 1WIUA 3RWGB 3RVWC 5FGBA 3OAZH 3IFOA 5FUOH 3U36B 3BH9B 3HS0B 3T2QA 1MWAH 3MCLL 2LFGA 1FSKC 3K4AA 5J6HA 1UYWH 2DBLH 1TJIH 1NCWH 2Y07L 2BHYA 1MWAA 32C2B 1P84K 4I3RH 4YHIB 4FFZH 4D9RD 3LRSB 5GRXG 4UDTA 4Q9RL 4HIJA 3SJVE 1KN4H 4KRPB 3WS3A 4H1LH 3CAFA 3FQRB 2FD6L 1ZSDA 2OMNA 3UTSA 5ESQA 1RFDL 4HXBH 1F5WA 2IADB 3QQ4B 2R0KH 4LNRB 5GRVL 2C3GA 1Z9MA 4GW1B 3CIQA 4YGVA 4I2XE 2QADC 1F90L 1FL5A 1PG7L 1RUKH 2V2XA 3KYNB 5SX5H 2JELL 5T1MB 1HCFX 1FVDB 3GMOA 3U7YL 2XNAB 3K81A 5CKAA 5K9KB 4KKAC 4KKAD 5FYKU 5JZ7C 5JZ7D 3PDOA 5INCB 3SKUD 4NBXB 3MV8B 3GB7A 3CLFH 3BVNB 4P2CG 2AKRA 1GZPA 1JPST 3AAZA 1P7HL 4PRPD 2Q6WB 1I8KA 2AJYH 2F74B 2Z35A 1KC5L 1EVUA 4UB0H 1K4DA 1CTNA 4WI8A 1R0AH 4K94H 3IDXL 1XR9B 2OK0L 1CT8B 3K74B 3TNMA 3WLBA 2PR4L 4YBLB 3JWNC 1AFVL 2VXQH 4QRRB 4G80A 1NLDL 2Q76A 2VLRB 3IFLH 1CXKA 3U0TB 1M7DA 4J6RL 4PJFB 4I3SL 4QHUA 1FGVL 4HLJA 2W9DL 1FE8H 1I7TA 2ADGB 4HKBA 1EH9A 2DN7A 5BV7L 5E99H 3OWEA 2NYYC 2NYYD 1DLHA 1NFIB 1HYRC 2OCFD 4FFWC 3CXDL 4OLWL 3TWCL 4HFWB 5FV2A 3B5TA 3NAAL 4HJJL 4Y16C 4GKNB 3O2WH 3EO1B 3FO0L 3HZKA 3KDMB 3V6BR 3PP4L 1OTSC 2ORBH 1OTSD 5T1DL 2W1NA 4FTVD 1L7IL 5HYJE 3FMGL 3RWIA 1SVCP 3GRWL 4PRPA 5EUOA 1A1NA 3HUJE 2D7TH 2I9LA 1H8NA 2AP2A 3TA3D 4Z7WA 3MACL 2R23A 3FRUB 1UJTA 4PJ7B 2P5ED 1OHQA 4JDTH 4PP1C 2KUTA 3IB4A 4YK4B 2W0FA 4GKZB 1J05B 4JRYB 4DGYL 5HHVL 4DWHA 3Q6FB 3D39D 4NHUA 5JOPE 4OD2A 1N5YL 4L3EE 2D7OA 3D2UD 3X12B 4Z7OF 1H3PH 3D25A 1JPFA 1S7SA 4KK6C 1KCRH 3HLAA 2IMMA 4FQIH 3VGBA 1RZKC 2C5DC 3QDJB 4WUUB 4LEXH 4K8RD 2EIEA 3HUJF 1WCBA 4RDQF 1YYML 3BN3B 3STLA 1VFBB 2IEPA 3DX6B 1ED3B 1CG9A 3QXAA 4JPIA 2O5YH 3BDBA 2Z31B 2AK4D 3KGRA 4I77L 4FTVA 1Z5LA 5LGKA 2XZAH 1JWSA 2Y25A 4JDZA 5IV2A 1SM3L 1KELL 4M6OH 3C5SA 5IMLB 4OKVA 3MRIB 3VWJC 4AEHL 3VWJD 5EIIB 1NKOA 3WUWA 4RFEB 2OL3H 3TA3A 4HLZH 3SCMD 4OIIL 2EYRA 2D2OA 4Y4FD 2P5EA 1AY1L 3D18A 3BPNB 5F7HA 1T0NB 2PXYC 1FNEB 2AEPH 3QPXH 1WZLA 2ZCHH 3D39A 3DOSA 1QSFB 3D2UA 2OL3A 2IBBA 4X4ZA 4K8RH 1C7SA 5FDYA 1QTYT 4NJ9H 3EOBB 3HAEG 4UQ2B 3BT2L 5IW1B 4BQ9A 3SO5A 1CDJA 1U8HB 2XTJC 2XTJD 4R6UA 4TNVF 2DMCA 4YXHH 5JW5B 4Y2DB 5IWLA 3FT4A 4L4TB 1EEQA 1HQRA 3TBWA 1TVBA 5FA4A 2E6QA 1S9VA 1ODAA 1RJZB 2CMRL 1I9RL 3NFPB 4EUPH 1JMZA 1JF1A 4I13B 3T8XA 5E94A 1U92B 1XFPA 2AK4A 4D8PB 1R24B 1NKRA 3DO7A 2VABB 4AK1A 4X6FA 3NFNA 5J1TC 3LRHA 2BNQD 1JGUL 4IRJD 4RAVA 1ZOXA 1GZQB 2JJUA 3VWJA 1HINL 4NP4L 5EUKA 2NTFB 4LAQL 4L5FL 5MERB 3SCMA 4U1JA 3RGVB 4Y4FA 5ADOH 1EEUA 5IR1B 5ECJE 1ZANL 4PJIB 4PV8A 3HNSH 3MQIA 2EDLA 1OQOA 4ELMA 3QIUC 4GRWH 3IS0X 3SPVA 4Q6YA 2PKDA 4H8WH 1TTGA 4DW2H 4ZPVB 1YA5A 1H8SA 3FOLA 1EPFA 2WIMA 5C92A 5CZVH 4FHBD 3I6GB 5I1HL 5HI3D 4CVZB 1OL0A 5A2FA 3EJJX 3VRLF 2AABH 4W6WB 1WTLA 3MFFB 4R4ND 3PWPB 4M7KL 3JV4A 4UAOC 5EOQL 3SKJL 5E4IA 1U8JB 1PSKL 3HE6C 3MLZL 5SWZE 4GG6E 1EFXD 5FECA 1CFNA 3ALWA 2V9TA 5IBTL 2DWEA 3SDYL 4ZO6A 1T1XB 4HCRL 5GQBA 1S9XB 3CDGA 3F6IA 2AERT 3B5GA 2HRPL 3OKEA 1T22A 4X9GA 1UENA 1E0OB 3O2DL 4XAWL 4CGTA 3QCTL 4E41B 3S8WA 3RP1A 3EYOB 1QPPA 3SOBH 2BNQA 4PJHB 4IRJA 3FFCD 4AT6A 3HE7D 3T4YB 3MOBL 2XA3A 3HAEB 2PYEE 5HJ3B 1X3DA 3QIBD 3C5ZC 3C5ZD 4JFOB 4MD4B 1GHFL 4W68A 5C0FB 3FTGA 2AXGB 25C8H 3E2HB 3QDME 2IGFH 4PJBE 4Y8DC 5MEPA 2CR6A 4R97C 4K7PY 5HGHA 3SDAC 3SDAD 4NN6C 1MFBL 3DX7B 3OV6A 5I8KH 1CGXA 1A6VL 2R69L 3BO8B 2ED9A 3O6KH 1KJ2H 5F21B 3KJ6H 2QSTA 1MRFH 1LP9A 1T1WA 1EFXA 4NNYB 1XGPA 3O41B 2R29L 4JQVA 1LO2H 4CU7A 5IEHA 2DOCA 1KJ2A 4KQ4H 4HKJB 3MRDB 4XH2B 3WD5L 1ZA3B 4Q2ZB 5KN5B 4AEEA 1YEGH 4KJYB 4PJBF 1F3JB 3OX8A 3LQAH 3HB3C 1LD9A 3SDXA 3CGTA 3MOAL 4KMQA 2VRAA 5E00A 2GT9B 3VFMA 3HG1B 3FFCA 2BK8A 4TN9A 4HS6B 4UINH 4WIQA 3BZEA 4CNIA 3HE7A 1VACA 4Z8FH 3VH8B 3EJZC 3C5ZA 2Z4QB 2IALA 3R8QA 1AD9A 4OUUA 5GXBB 2X1PA 5TDPA 3V6FB 3C6SB 2V9RA 1LK3H 3OPZH 2PYFA 5D7KD 3SDAA 5EC1A 5ITFA 4ONFH 1R3KB 2OR9H 1QSEB 2YPLB 3KR3H 3QA3A 3VD4A 3RUGE 1YY8A 5CP7B 4NO5B 2ERJC 5INDA 5HGDA 2X89D 4DUWA 1WZKA 3H7BA 1J0JA 2GITB 5IHUH 4HBCL 1F3DJ 1N6VA 4DQOL 1YEKL 4GRLB 4KK8C 4KK8D 3A0OA 5DLML 5CLWA 1MREL 4FQHA 4PJ9C 4Y1AD 3DXAB 3QCVH 4NCDA 1UG9A 4A6YH 4F7TA 4ELKB 1BHGA 1DBMH 4JM2B 3K8LA 3V6ZA 1VEOA 2OZ4H 3VXUB 4ZAKB 3WSQL 1NGZA 3RUGF 4QHLA 5F7MC 2N7AA 4E9LA 4A6YA 1ZA6B 2G5RA 3MCKB 4YFLF 3DRTB 3LKRB 2JCCE 5ELIA 4HGWB 4YR6B 2X05A 1FV1B 3NCYS 1NSNL 3VWKD 1JRHI 5DURB 1N59A 1XGRB 4E0RA 5I8CB 2XACC 2YK1H 5JHDB 3VW3H 5EFIB 1QBAA 4NHCL 4XPGL 1T2QH 3MV9E 1U8LA 1RY7B 1S9WB 4HD9A 2FYYA 2VKWA 2X89A 2IG2L 4NKQB 5E6IC 3ROOB 4Z9KB 3ULVL 1NGWA 3H42H 4PJDE 1WAAF 4OM1L 3NN8A 1RZJC 2D7QA 1OAKH 5EBWA 4NO2A 3STBA 2D0HA 5GHWH 4HZLB 4DFHA 3MYJB 1CL7L 1OB1A 4Y1AA 3GHBL 2XXCB 3R0NA 1AIFB 2A74A 4NZUL 4OZGA 3BP6B 3VFOA 1NC4B 1QD0A 4OI9A 5DGQA 5F72S 3VA2C 4QOKE 4GSDL 5ANMA 5LXGH 5E8DH 4XI5C 2V7HA 3K7UA 4XI5D 1LO0L 1IAMA 4O51A 3OKMB 5E8OB 3C2AH 2BJML 4BQ8A 2NNAA 3NCMA 2VLLA 2F5BL 4LSRL 2Z8SA 3IJYB 1SYSA 5HHXH 4QNPE 3QRFM 1LEGA 1A1OA 3BPLB 3VCLA 4JGUA 3T1WA 5H94B 3QEQE 3QULA 1RVFL 3X11B 1U3HB 4NZTL 5EZJA 3ZKXC 2MCPL 5D1QB 3QG7L 4QRQA 1U58B 1GGCH 2QHLA 4P59L 4NN5B 3MUZ1 5F3HA 1A0QL 2YZ1A 2FB4H 2V17H 2IWGA 3GIVB 2B7DT 5DJ6B 2UWEE 3ARBB 5H35B 5ID1A 4KZEL 4YPGB 4U1GB 3V8OA 1FJ1B 4LASH 5I1CH 4QNPF 5F88B 5KSAC 4GLRH 4PGBA 4UT7L 1JWMB 5FUCC 4XMLL 4OCSL 3M45A 3MRHB 3T09A 2FECI 2X7LB 2EE9A 3IFPB 3MLYL 2Z93B 3ZDZE 1ZTXH 1C12A 4WHTA 2W0KA 4XVSH 5I1LB 5DUPH 3ARPA 4GQ9L 3QEUA 5K59E 4WI4A 3BGFB 3AGVA 2EDRA 4OFVA 1KEML 4CVUA 2NY6C 1NFDA 3ALPA 2YEZA 1AR2A 3QHZL 5BRZD 1SBBA 4ORZC 1S7VA 1VSCA 1NUNB 3O6FC 5FM8A 2K7QA 1YEFH 1BVZA 3NGBB 4MHHI 4KPHL 3ZDZF 4BZ1L 1IBGL 4RZCA 4P4RB 2XWTB 3TJHC 1DBAH 3L3JA 3S4SG 3V5DB 4K7PL 3AC0A 3OJ2C 5K59F 1HKLL 2MMXA 4OZIE 1D3CA 1E28B 1ETZB 4XBGA 1MCSA 5FYLD 2D03L 4Y0GA 1R3JB 1ZLVH 1P2CB 2DTML 4P9HL 3L3KB 4ETQB 1NCDH 5KSVA 4XVTH 3MXWL 1EUTA 3ZDYF 1MAJA 3MJ8B 4DVBA 1YJDL 3K0WA 4XRCB 2VB5A 2BNRB 1A64A 3ECBB 5CGYD 1JZ2A 5DJDB 1KLGB 1R5VA 2E27H 5DSCA 1MLBA 1AXSB 3QR2A 4G7VH 5ENWB 4QGYA 4NSKA 5KAQF 1Q9WA 1Q9OB 4JFEE 5EZLB 3KNBB 4NZRL 5BRZA 1DN0A 4ZUUA 3JSSA 2DAVA 4MXVF 3VXME 5GGQL 3ULUD 3O8XC 3Q3GA 3O8XD 5HHOE 1IC5L 1CVSC 3QB7C 1XGYH 2QSCH 2YBRB 3KLAB 4EBQH 4LEOB 5FYLH 3QQNA 3O3UN 4F3FB 3ZTJH 1PEWA 3P4OA 3KJ4C 1X4XA 1RZGA 4RGND 5KSBA 4FFYH 2XFXA 3U4EA 3RVUD 4XCEB 5CD3A 1YQVH 4MD0A 3BX7C 4ZD3L 3V0VA 4FQ1H 1LEIA 2BRRH 3MRBB 1J1XH 4KV5E 4NOFA 2E9WA 3QNZB 3F8UB 1J87A 2OTUA 5B21A 5TFSH 3BD3A 4P4KB 1ZLUK 2WQ8A 4F7PB 4NQCE 3RVVC 2VMFA 1BM3L 5FHBH 2C3VA 2X4PA 3L95B 2VN4A 4OD1H 2CXKA 3W39A 3LN4B 3UTOA 3ULUH 4S2SA 3WHXA 3NZHH 3O4LB 1KG0A 4JZOA 3GSRB 1PLGH 4CN6A 3EDDA 2EZ0C 2EZ0D 2R2CA 4JZJB 5JIKA 2EDEA 2UUDH 3T65B 3CC5A 3O8XA 5IB5A 4WO4C 2ICWA 4WO4D 1JYVA 4AM0B 4NQVA 2CUIA 3CUPA 4FMFA 5CS7A 5IEKB 5GRZA 4PRNB 5J6GA 1D6EA 3OKKA 2VDQL 4G42B 5GIRB 3OKDA 5HD8C 1A6ZB 5HD8D 1ZEAL 1VFAB 5ACZA 2R56L 2LV4A 3SDDC 4K3JL 3SDDD 4PFEA 3BE1H 1T1ZB 3GUTA 2HJFA 3ZMRA 3MLTA 5FYJD 2C3WA 5C0IA 2HFEB 3T08A 1YYLL 3VFNB 3NCCB 2P1YA 3OXSA 2P46B 2X4NA 4MS8C 4MS8D 4XBEH 3VI3F 4W4NA 3MRKA 2P5WB 3WFZA 3VFPA 4M62H 2C7UB 1CVRA 5EORL 3RI5K 2PN5A 5C07B 1TQBB 1K8DA 2GUOA 3TZVC 2QLVB 3SQOH 2FSEA 3QHFH 4X7SH 3REVA 1FBIH 1DEEB 2J8UA 5BJTB 5T3XE 4U33A 1IM9D 4WW2C 4NNPL 5IHBA 3QFDA 4U1IB 1RUML 5D7IA 3V7MA 4P5KA 1G7QA 4V1DE 4XXDB 4PYGA 2VWEC 2PUQT 5IFJA 2LU4A 4ISVA 4WO4A 3H9YA 3GMRA 2HG5A 3HR5B 1E4WL 1OAXL 2MSPA 3L3HA 1FYHB 4X6EB 3WEXB 3LEXB 4NQEE 5FYJH 1FO0A 3HZMB 1F4YL 1QYGL 3W0WB 1FGNL 3S35H 1FYTE 1QQDA 1MAML 4OLYL 3BRGC 3ARGC 5FUZH 3ARGD 4F58L 1UADC 4XXCC 2JJVA 4MNGB 3SDDA 5MEND 4M8VA 5I74B 1LEKA 5LCVL 2XWJB 4BKLA 3PWJB 1A7RH 4OZHA 4XT1C 1IEHA 1SYVA 4ZO8A 4TNWF 5IKCA 4FZEL 5B4MC 1CXFA 2B0SH 12E8L 1RJYA 1G6RB 4Y8AA 3S35X 5BS0B 1XCQB 1KEGH 2PTUA 1QR1B 4YUEH 4PB9H 1QLEH 5KVGL 3S34H 1OCWL 4HBQA 3EUUA 3WL9A 1IM9A 5ABDE 3OF6D 2DM3A 2GJ6E 4RGOH 5D7SL 4RFOL 4ZSOA 4KJPC 1QBBA 2PCPA 3Q5TA 4OT1L 5CEXA 3RGHA 3OJVC 2IAMB 1MPAL 1MI5D 2AJ3B 2C4XA 3EOAA 1NBQA 4ZO9A 1QBML 5C0CB 1A7PH 3RPIB 3ARSA 2A6KB 2VDOL 2VDML 4LLQA 5DZOA 5D9SA 2WANA 5D72H 2YSSB 1BBJB 3UTTD 3RKDC 3RKDD 3ARGA 3P4LA 2CUMA 4CADA 1IC4L 4TNWK 1I1AC 4JANB 4XXCA 4FABH 1ZKAA 3TBYA 5DJXB 5E5MA 4NC1E 5MENA 1AJ7L 1T04B 1JTTA 1TDQA 3O45A 2JB5L 2FIKA 1HZHH 4IIQB 1XGUB 2VDPH 2YUWA 3Q1SL 1WTGT 4MAYD 5FO7A 1I9JH 4MYWB 4YHOL 3UTSE 2C3XA 1S7RA 1Q0XL 4M48H 5HHMD 1KB9K 3VFUA 2HJLA 4JM4L 1ADQL 3OF6A 4WW1A 1JGVL 1JGLH 5F9WB 4P46C 2VL4A 4G8EA 5I1DB 1S7XB 3GMLA 4YPJA 3T0DA 2FO4B 4TTGA 2JIXD 3GKZA 1MI5A 2OSLB 1R5IB 4NDMA 1TZHA 2Y1VA 1H0DB 3PF2A 1XF3B 4IRZH 5L8JB 2DI8A 3GGWB 4NZJA 2IAND 1A3LL 3EFDH 4G43B 4X5XB 3UTTA 2BDNH 4NFDA 3KPNB 4S11A 5DQDH 4AMKL 3BN9D 4YHML 1HK6A 4R2GC 4R2GD 1OQXA 2XN9D 5DEGA 3U9PL 5HPMB 4LARL 4D9RE 4RFNC 3HA0A 3PNWA 4CVXB 4KZDH 2I27N 4UV7H 3QUYD 4G9FD 3WNOA 2HFFB 2H26B 4JG1H 4UILL 4G9DA 4MAYA 2B2XL 4ZFFA 5GS3A 2DQCH 2EKSA 5SV4A 1H3UA 1WLHA 1WEJH 3HI6L 3PWNB 3PIQA 4GAJL 1CYGA 2WLYA 4JKKA 5CFHA 3HI1B 4Z0XB 4R4BA 4U6VL 3D48R 2V7NB 3IDNB 3RY5A 2ZUUA 1ZK9A 3MV11 4PGDB 1G84A 2BNUA 2JIXA 5HY9A 4L3CA 2X9XA 4ERSL 4YAQB 4JG0H 5E2JA 2OXGA 2APBA 4BSVA 4FFVC 2IANA 4PRPE 4Z78B 5EUOE 1AGEA 5F89A 4NKIL 4ONOA 2XN9A 4R3SA 2V5RA 1NDMB 3N50A 4EZMA 3UC0H 3FL7A 1BLNA 4QHMA 5L6YL 1BAFH 4YDIL 1DBJH 1SMAA 3CFKB 4HIXL 1HSBB 3QUYA 4G9FA 2V2WB 4LU5L 4M7ZB 1J1PH 2CO7B 2EO9A 3CVHL 2EDDA 2VJXA 1REIA 4UOJA 5D8JL 3OJDA 3MRLA 1MHEB 4XHJC 4LSVH 4XHJD 3GBMH 3NA9L 3TH4T 4XP4H 4G7YH 3KXFD 4NO0D 2VISB 2D31A 4Z5RA 2OTPA 1GC1L 3WBDA 3CFJA 2GAZB 4ZFGH 1VADB 3UAJC 4HUVB 3UAJD 4HX1A 1I7UB 1EEZB 1T03L 1IQWL 1RAMA 3LZFL 4FTVE 2H1PL 1BIHA 3MROB 2WWKO 4JY6B 1K8IB 3O0RH 4QXTB 4CU6A 3MR9A 2VKXA 5J06A 1Z0NA 1ZHNB 3MBXH 3MLSH 1QA9A 1WBZA 1N2RB 3X14A 4KKLC 4KKLD 3FN0L 1NAKH 1TTFA 1M7IA 3K2UH 1VB9A 1A1MB 2P5EE 2ZOKA 2J8OA 1FDLL 4YDVB 2YPKA 4G6JL 3D39E 2IBZY 5F7EL 4YDLC 4ZNCD 5D7LB 4LCCB 4D0BA 2YD4A 5FGSA 4M1CC 4CMHC 1HDMA 1G7JA 2R1YB 1UB6B 3KPLA 5FGRA 5DF0A 3RTQB 3HR6A 4KRPC 4KRPD 5C0GA 2BMKB 3NACL 3GJFK 5DJ2B 3W11C 3W11D 1Q38A 3LH2L 3KXFA 4LLVA 4Y5XC 1ZVSA 4NO0A 2FX8L 5AYUH 4LF3B 4YHKL 4MXWL 3L3IA 5DRXB 3MREA 1BREA 3C6LB 2AK4E 4OLVH 1F6AB 3PDDA 4IOSD 4JPVL 2VUYA 4IMLA 3RWGA 4O00A 4O9HH 2ESVB 4LRNL 1IC1A 1NCAL 5D93B 3U36A 4U1KB 3BH9A 3HS0A 2W91A 1G6VK 1KTLA 1HHIB 3TIEB 3BW9A 3HC4H 3MV8D 3LDBC 1EO8H 3VXPB 2B5IB 5C09B 3DI3B 4M4RA 3NMEA 1WVZA 2VAAB 3KYKL 5IB1B 3R1GH 1I9EA 3HN3A 5TGBB 3VMPA 3L3DB 4ELME 5DWUL 3CJJA 32C2A 4YHIA 5I1IH 3VXTB 4PY8I 4JGMA 2B4CL 3LRSA 4H20L 2VXVL 4NWUH 2XTJE 1FNAA 4GRWE 5A43C 4QRRD 4LHJB 3I9GH 2VLRD 3FQRA 4G6FB 1QEWB 2ADJA 1I1YB 3ARFC 3GSQB 4P3DB 1WUNT 3QQ4A 4WU5B 4U2YA 4DK3A 3JWOL 4GW1A 4ZFZB 2P8LB 3KPQB 1S8DA 3KYNA 4F2MB 4ELMF 5GGVY 5T1MA 4F8TA 1FVDA 2XNAA 3FZUD 4K71B 4WU7A 4IDJH 5JLZB 5GZOD 2BNQE 1TZIB 5INCA 4OF8A 1LILA 3CFDB 1DFBH 1L0QA 2VITA 3MV8A 1MSPA 1FRGL 3BVNA 1ONQB 3MTRA 3PHOB 3MNVB 3N9GH 2Q6WA 3MA9L 3ELAT 4N8CL 2F74A 3A67H 1H3TA 1KULA 1J7VR 4AH2B 2QHRL 1LO5A 4JKLA 2YN3A 5EWIH 3IU4H 1CT8A 4LLDB 4YK4C 4DN3L 5CKGA 4IRSC 3IFNH 4JRYD 4NUGH 4QRRA 2PETA 2VLRA 1IQDB 2DICA 4U31A 5I1KL 1LP9E 1RIVH 3U0TA 1VFMA 2DQUH 4PJFA 4YO0B 4RSVA 4QWWC 1JZ5A 4QWWD 4TULL 2ADGA 4WUUD 3QDJD 3KYAA 3SKMB 4D0CB 1RUAL 1EAPB 4MB4A 3MLRH 3KAAA 3SDXE 1NFIA 3ZYOA 4HFWA 3TT3H 1PBYA 4GO6B 3OAUH 3FFCE 2Q7YB 4AEIH 2Z31D 4GKNA 3K4ZA 3OL2A 3EO1A 3KDMA 2VLKB 1CL7I 4PJ8B 1SJXA 4PGEB 4TUKL 2AV7B 3DGCR 1MQKL 4XVUD 3QIWB 3DECA 3JUZA 1JCKA 2E9JA 5J1AB 1JNLL 5AZEL 3C60B 3FRUA 5ESAB 2F58H 4PJ7A 4JFPB 5ICYB 1YEJH 4JLRB 2Y07H 4GKZA 1J05A 2OJEB 5DVMA 4JRYA 3Q6FA 1QSFD 5E1HB 3TEUA 2AXFB 3X12A 3AMKA 2C26A 1DEDA 1V8HA 1IMHC 1KB5B 1XGTB 2XY2A 4HXAH 4Y2DC 5KVFH 4JY5L 4Y2DD 3W5NA 4L4TD 3QDJA 4WUUA 4AG4H 4C59B 4HS3B 4Z7UA 1MEXL 1U8NB 4O2CB 4BQBA 4LSTL 1VFBA 4N8VB 3WIIL 4F37F 3DX6A 1ED3A 4GKOA 3JWDL 4OJFH 5F7FA 3DV4B 4RAHA 2GTZA 3CK0L 4MJ5B 3LEYH 4GMSL 2Z31A 4MJID 5FYKD 2ADIB 3EYSH 3U48A 2Y23A 3PXJA 1JP5A 4S0SD 3VFGH 4W81A 2X4OA 3SKNB 4JO4L 2P44B 4ZMAT 1AQDB 4OLZH 4S1RL 1EJ6A 4EI5B 5IMLA 4GRMB 4NOBA 3MRIA 3G6JB 2NXYC 5EIIA 3J8F7 3E3QC 4JKPL 5SWZB 4RFEA 5D7KE 1V7NH 5F97E 3RPKA 3NTCH 5EPMA 5FFLA 5KG9B 3ROLB 5A16B 2EDKA 1T0NA 1FNEA 3X3GH 3U1SL 1QSFA 4MDJB 3WFBL 2N1KA 1CICB 4QRSA 4UQ2A 3U0WH 3T0EC 5IW1A 3V7AE 2PR4H 3UZQA 2EDWA 5JW5A 4Y2DA 1J9CT 3V79C 1JPTL 1VGKA 4JDVB 3PWPD 4L4TA 3EFFB 3MUJA 1I75A 2EO1A 5FYKH 4Y1AE 5T5FH 4ODSL 1NJ9B 3RZWA 1RJZA 1JHLH 1IAKB 5TQ0L 4OZGE 4DUXA 2A77L 5J4MA 4PJBB 4EQ2A 3I3DA 1S7QB 1U92A 9CGTA 1L0YA 1R24A 3KPTA 4MJIA 4D8PA 2W92A 5L7XL 1CFTB 5ANME 1MIEH 5DJCB 4PJAA 2VABA 1BQLH 1WICA 1YEDB 2NY1B 3ZKNC 2D9CA 1AP2A 3VFTA 3QJFB 1GZQA 4LKXB 3CH8A 2BHUA 2NTFA 1EUUA 3RX8A 5MERA 2WMPA 4UU9B 5IR1A 4RWYH 4PJIA 3LD8B 4FZ8H 4MJ4A 3E2HC 1HIML 4OZGF 4ZPVA 1X4YA 1N3NB 1ND0B 1IRAY 3NVQA 5GGSY 1RU9H 3I6GA 1M7XA 4XWOD 5HHVH 2CDFB 4JHAH 1C08B 4CVZA 3THMH 1UGNA 3MFFA 3PWPA 3VGDA 1U8JA 3ARXA 3GI8H 1EHLH 1CBVH 2RQ8A 4BFBD 1IKFL 1UCBL 4YE4L 1T1XA 1JTOA 2IFFH 1S9XA 1XF2B 2A9NH 3HAEH 5IJVB 3H9SB 5F93C 3N1MC 4YBQC 3A6CH 3GSVB 3QI9C 4OM0H 3D0LB 4M6NL 3RUGB 4PJHA 3HG1D 1UH4A 1K9TA 4WHYG 3P9MB 3T4YA 4NFCA 5I0DA 3P9LA 3HAEA 4RRPG 5HJ3A 3FB6B 4LLYB 3WNMA 1K3ZA 4E42B 1W72B 4ONGL 4JFOA 1JZ3A 4MD4A 3LHPL 4YIQB 4U1LB 5H8DA 5E4EC 5C0FA 2PW2B 3TCXA 3ARTA 4MSWB 5GGVL 1X5FA 3TV3H 1R3IL 4NKMB 5FOBA 4N9GB 2NZIA 5AAMA 1NFDE 1U93B 3DX7A 4N68A 3TYFB 1T0MB 4BSWB 3LVEA 1QSED 2YPLD 1T2JA 5JR1H 1J5OL 1SEQL 5DEFB 3T2NL 4NNYA 3ZE0F 5F1NA 3O41A 5JW3H 4GRLD 4XNUH 3Q5YA 4HKJA 3MRDA 4XH2A 1ZA3A 1N6QH 4Q2ZA 2MOVA 4KVCL 5KN5A 4HWEL 5EOCJ 4KJYA 3DXAD 1F3JA 3RRQA 5FUCE 1R3LB 4O4YH 1NDGB 2HWZL 4JM2C 2GT9A 4JM2D 4KVNL 1MJ8H 1NFDF 3EYUH 3HG1A 3DURB 4ZAKC 4HFUL 4ZAKD 3VXUD 2BVQB 4HS6A 4KAQL 2EYTB 5EULV 3VH8A 1FORL 2Z4QA 3EOTL 5E2WL 3V6FA 3OGCB 4BELD 3C6SA 4KC3B 5GS0C 4LSDA 5DURD 4M1GH 4K3HA 5JHDD 1X6NA 4M3JA 2DJ4A 1ZLWH 5BRZE 2ENYA 3OQ3B 1R3KA 3ZYIA 3SN6N 1QSEA 2YPLA 2DL9A 5L9DL 4QOKB 1GGBH 4NO5A 4Q6IB 5DD3H 5T3ZD 2GITA 1IGIL 5HDQH 3WLWC 3WLWD 5KAQG 4GRLA 3HMWH 4FOMA 5KSBE 2X4UB 2VDNL 3OJMB 4KMTH 4XPAL 1MHCB 3DXAA 2A6DB 5FYLE 5C0RH 1TETL 2X70B 1UA6L 3I3BA 2DQTH 4ELKA 4OFYD 1NC4D 4JM2A 3VXUA 2HFGH 3QDHA 4ZAKA 5HHQB 2KPNA 4NQTA 4X99A 4XNXL 4N1HB 2EDXA 1W0YT 4M93C 1ZA6A 3MCKA 1IGJB 3DRTA 4XBPB 3BGAA 2JB6B 3LKRA 1E6OL 5JDSB 4HGWA 3GHEL 4YR6A 1FV1A 3P0VL 1AQKH 5HYFA 2CDGB 1XGRA 5DQJB 4H26B 5I8CA 2OQJB 5JHDA 3O6LL 5EFIA 1YECL 1HXMB 2QR0B 3BPLC 3PGDB 3QXWA 3ULUE 2BCKB 3DUSB 3VG0H 2EEDA 4APQC 1U3HC 3ROOA 1U3HD 3NABH 4DEPB 1G0DA 5D1QC 2VZVA 5D1QD 2GCYA 5IQ7L 4RGNE 2FJGB 4NN5C 2BY0A 4HZLA 1U42A 3ARBD 5ACLA 3I2CH 1AIFA 4OGYL 4QYOB 1I3GL 3BP6A 4OFYA 1NC4A 4PV9B 3QUZB 3TT1H 4OD3H 3HI5L 4LIQE 1XZ0B 4OF0A 1OPGH 3ZHDA 5I0ZA 5I1JH 1AGFB 3RU8L 35C8H 4PRHB 2AI0H 2OR8A 4KU1A 3O6MH 5EG6C 5E8OA 2GIYA 4RISL 2J8UE 3H6JA 3IJYA 4X6DB 5D7IE 5I18L 1XCTB 3CCHB 2CLVB 2EYSB 2FBOJ 2NZ9C 3V4UH 4J8RB 5JO5B 2EIBA 4DAGL 5EBLA 3G9AB 5FHAL 5T3XL 3X11A 4APQA 1U3HA 5D1QA 5IK3B 5DRZB 3T3ME 3TPUB 4LFHD 1S5IL 3TYGH 8FABB 4ZTOL 5DJ6A 5H35A 3ARBA 3NGBC 4BZ2H 1QRND 3G6DH 1YQ2A 1IC7H 1YN7B 4PGJA 4YPGA 1M4KA 1I9IL 3U7WH 4HIIB 2BRQA 2ICWJ 1FJ1A 2DQJL 2J8UF 4LGPB 3OB0H 1CDUA 3IDYC 5FYJE 5D7IF 4OZHE 8CGTA 1EHNA 1FPTL 1UWEL 1JWMA 3NIFE 4IJ3B 2RCSL 3AVEA 3MRHA 1F6LL 3V2AR 1RV6X 3UO1H 2X7LA 3IFPA 2CRZA 1I1FB 5DQ9B 4I3GA 3T3MF 5FK9B 4NFBA 5I1LA 3SO3B 5DO2C 2BNRD 2XQYG 4ODXB 3QO1B 5ITBL 4XPTH 1BZ7B 5HBBA 4ZSOE 3JV6B 4HZAA 3BYYA 3VG9B 1INDL 2VWEE 5DDHB 1HSAA 3ZDXF 2ZNXA 3F7YB 4WGVB 4RGMB 4LLAA 4OZHF 2AJUL 4MMXC 2FDBP 1C5BL 1HHKB 3EJYC 3EJYD 4KKCC 4KKCD 4NQCB 3GMNB 4C55A 4LCYB 1A14H 1QRNA 5CAYB 4UIKL 1TZGL 1KPUB 4P4RA 2QKIB 2XWTA 3DVGB 5CUSH 4ONHB 5MENE 1I8IB 2EIZB 4G8IB 5F7NC 3V5DA 4NM4H 4URTB 4WW2F 1BECA 1P5VA 4U6HB 1AO7A 1E6JH 3GSWB 1E28A 1ETZA 4MA8H 5FUOL 4X7DC 1MWAL 1UKTA 1P2CA 2LQRA 4LGSB 1UYWL 3N1GC 3L3KA 4ETQA 3BUYB 4P2QB 2DBLL 4NQDB 1TJIL 3MJ8A 1NCWL 4I3RL 4XRCA 2BNRA 1Z6JT 3ECBA 5SWSD 5DJDA 1KLGA 4FFZL 5EU3B 1AXSA 1HQ4B 3WHE0 4WFED 4PD4J 2N7BA 3O4LD 5LGHH 2G60H 4FRWA 1KN4L 1MI5E 1Q9OA 3QXUA 5E9DE 4JZNB 5EZLA 3TBTB 3KNBA 1DQMH 2BXZA 5DHXB 3ILPB 4HXBL 4D94A 2R0KL 1DBKH 3UTTE 1V3LA 1Z0MA 4K2UH 2BVOB 2YBRA 3KLAA 4LEOA 4OFDA 4F3FA 2VL5B 2X4SA 1RUKL 4Y88A 1FQ9C 1CD1B 4P5TC 4P5TD 1NGPH 1SBSH 1XIWC 1XIWD 1KSRA 3PGFH 5DK3A 3CDCA 3ARQA 1FFPB 1J86A 4P99A 3VGAC 3LQZA 4XZUB 3MRBA 4OZ4B 3CLFL 3WXVH 2E7HA 3RWJB 3QNZA 4KUZH 1FFOB 5HHME 2F54B 4YDKH 4F7PA 2AJYL 3D9AH 4CBPA 3OXRB 4UB0L 5D1ZB 5SWSA 5JA9A 4NQEB 3L95A 4CW1B 4F9PA 1R0AL 1TQBC 5C07D 4K94L 4QHKJ 1NC2A 5HVHC 1XGQB 4HGKC 3O4LA 4NM8H 2VZUA 3GSRA 3WYRA 2VXQL 2IJ0C 2YC1B 3IFLL 4JZJA 1CGYA 3BISA 3T65A 2IANE 4HEPG 3RWCB 3V95A 3GMMB 2RR3A 4AM0A 3H2WA 5IEKA 1FE8L 4PRNA 3BI9X 1OP5H 2XN9E 5E99L 5GIRA 2L7UA 1Q9KB 3KYOB 3PWLB 4P5TA 1A6ZA 1XIWA 1JI1A 1VFAA 3W0WD 5I6XB 4G9FE 1MELA 3O2WL 3U9UB 1FHGA 1T1ZA 5I74C 1U2CA 1ZWIB 3PE9A 4MNHB 2HFEA 2X9WA 4IHOB 1OW0A 4NYLB 3VFNA 5DS8B 1I3VA 4WJ5B 2D7TL 3QO0B 1PQZB 4K3GA 4POUB 4PLKD 5BS0D 2DQDH 5C07A 1KJMB 3NCEB 4JVPA 3FONB 4JDTL 4LL9A 2ATPA 4O58H 3TVMB 1DEEA 5BJTA 1UZ8B 3E8UH 2XG4A 4U1IA 4WV1C 1H3PL 4XXDA 3S37H 1SJEB 3K4DA 2IAMC 2IAMD 4AQ1B 1KCRL 4FQIL 5FF6B 3TF7C 5C0CD 1FP5A 4JVUA 1G9MC 1ZSDB 4X6EA 4LEXL 3UTSB 3WEXA 3LEXA 5ESQB 4WTZA 1PYWB 2KBGA 3W0WA 2EDOA 2VERN 2AQ3A 2Y06H 5F7KC 1QVOA 2O5YL 4KROB 3T04D 3S37X 1GVIA 2HA1A 4MNGA 1G6RH 2VR5A 5JNYB 2XZAL 2XWJA 1QR4A 3PWJA 3G5VB 1CK0H 4M6OL 3RQ3A 3F7VB 2IQAB 3QDGB 2OL3L 1G6RA 3BPCB 3G9VA 1EAJA 5BS0A 1XCQA 4WTWA 5LVEA 3KXFE 1QR1A 4WY7H 5F3BB 4I4WB 3QPXL 2AEPL 2KL6A 1CU4H 2E7CA 4LKCB 1G9MH 5F9WC 1T5WB 2CD0A 4K8RL 4NJ9L 1MFCH 2C1PB 3QUMA 3TNMB 1S7WB 4ESKA 2IAMA 4EN3B 4YXHL 1T80A 2AJ3A 3MGAA 3BEVB 4YWGH 3CNKA 3WCYA 3WKMH 5C0CA 3WFEH 1NEUA 3RPIA 2CIKB 5KTEH 3EW3B 4TSAH 2YSSA 4U3HA 1BBJA 4RWHA 1I7TB 2QADB 3QZWB 2DLTA 4JANA 1JNHB 5DJXA 4YQXH 1T04A 3FO1B 1LMKA 4IIQA 1XGUA 3TFKC 1V05A 3TFKD 5BQ7B 5CSBA 1T83C 2VUOA 1WZMA 2F8OA 5ADOL 4BJLA 5J9PB 1YY9C 1YY9D 3HNSL 3RWHB 1T7WA 1NEZB 4LSQH 3WUZA 2ZWLT 4H8WL 4DW2L 1EA9C 4R9HA 2I26N 2HP4A 5DD1H 2V9QA 3VMOA 2XKNB 5I1DA 1S7XA 5DVNA 5CZVL 2FO4A 3GJFB 4JY4B 2ARJQ 5I15H 1EK3A 2FJHB 2OSLA 2Z92B 3QG6B 1R5IA 2AABL 5T1KB 1H0DA 1XF3A 3MV8E 2HVKB 2EDHA 3BD4A 1VPOH 3GGWA 1BJ1H 3I6LD 4ZXBC 4G43A 1D5BB 1A3RH 3KPNA 1VFOA 4MCYB 5E03A 5TPWH 5HPMA 7FABH 1CZ8H 1F45A 1ZHKB 5T33H 4CVXA 4Z7NE 3LKPB 3QWOB 1IGCH 1SY6H 2HFFA 3DIFB 3SOBL 2H26A 4M7ZC 4Y16B 1AHWB 1T83A 4QRRE 4W6YB 1H5BB 2VLRE 2XKSA 5MI0B 5IB4B 4S1QH 5AD0B 3PWNA 3WDJA 2IC2A 4PJFE 3P4MB 4PTUB 5E08H 3HI1A 2BXYA 1CD0A 25C8L 4Z0XA 4PBWD 4X9IA 1WBXB 2MHAB 2V7NA 3IDNA 2P5EB 3MJ9H 7CGTA 5I8KL 5CJBA 2EDYA 4PGDA 3O6KL 3SGKA 1KJ2L 2GW5A 3KJ6L 1Q0YH 2BC4B 3KPMB 4I18C 4YAQA 4ZS7H 4Z7NF 2Y4SA 1MRFL 3NZ8B 4LCIH 3MJ9A 3HFMH 3UBXI 3UTZB 5FO8B 1L7TH 3BIAX 1LO2L 1UZ6E 4KQ4L 3FN3A 1YEGL 1NDMA 2Q8AH 3LQAL 4PJ7E 4ZOCA 3CFKA 1JF1B 4JRYE 5KOMC 2V2WA 5C2BH 4UINL 5D7LD 4YJZL 4LCCC 4Z8FL 3EYFB 1MHEA 3GKWH 3GBNH 1CS6A 1UCTA 1QUNA 3W82A 4OAWA 4NRYB 1UZ6F 3QH3B 4LPYA 2VDKH 1LK3L 3OPZL 3QDJE 4WUUE 5DTFB 3AU1B 4U1JB 4Z7UE 4MD5B 2VISA 4KMLB 5F1KC 4L8SC 1RIHH 4ONFL 2PXYB 4ORGA 2GAZA 4PJ7F 2OR9L 1VADA 3KR3L 4HUVA 3C9NB 3O3DB 2ZOLB 1I7UA 1KCKA 1EEZA 3C6LD 4I18A 3ZE2E 2GYSA 2WV3A 5IHUL 3MROA 2F15A 4K23H 4ENED 4JY6A 1K8IA 1NCTA 2ESVD 4QXTA 5D93C 2V2TB 5DMIL 4MQTB 4N0YH 1ZHNA 2JLLA 4M5ZH 4M6MH 1N2RA 4KJQC 4KJQD 5C09D 3QCVL 5BCAA 1QO3B 1A1MA 4A6YL 2LVCA 4Z7UF 1DBML 3CXHJ 4UI2A 4YDVA 2OZ4L 4TTDC 1JHKH 4HC1H 1QSFE 5D7LA 2EE2A 4LCCA 5F6HJ 5DMKB 2HT3C 2HT3D 3CPLB 4MJ6B 2R1YA 1QRKA 1UB6A 1KCVH 3FOMB 4NJAH 3PUCA 1M71B 2BMKA 1FNSH 4HC1A 2AEQH 4L4TE 5JXEC 1IGFH 5DJ2A 4G6FD 5H2BB 1P7QB 1I1CA 2YK1L 4FS0A 3VW3L 5DFWH 4I8DA 4LF3A 5GGRB 3QIUB 1T2QL 5HGHB 1YPZB 5DRXA 3B8YA 3C6LA 1PZUB 5HYSB 2CJUH 1F6AA 4MJIE 4DVRH 5FYKE 4D3CH 4PJAE 4K71C 2G75B 2CDEB 3H42L 1EHXA 2ESVA 4U1KA 1OAKL 4CJ0A 1HHIA 3HMXA 1A7OH 4LLWB 4UAOB 5GHWL 3TIEA 5HHPA 4J3VA 3HE6B 3E3QE 3VXPA 2BOBB 4CJ1A 5C09A 4POZC 2VAAA 5DJYB 5IB1A 4PJIE 5TGBA 3L3DA 3N1QC 4PJGF 4OFKA 2HKFH 2ZJSH 3VXTA 3OX8B 5LXGL 3LB6C 3LB6D 3HPLB 3MGOB 5E8DL 4ODVH 3QUKB 4PJAF 3G08B 3DX8A 2W65B 3C2AL 3PWPE 3FO9A 4S1DD 2P45B 1QEWA 3PHSA 3GSQA 5HHXL 4P3DA 4DJMA 4WU5A 1DL7H 2GKIA 3DPBA 4ZFZA 2P8LA 4AQOA 3KPQA 3GEWB 3ISWA 3WE6B 4AZ8A 4F2MA 4AL8H 3HRPA 4NN6B 1B3JA 1IARB 4Z7VF 5J56B 2UY6A 5JLZA 5IFAH 1GGCL 1TZIA 4PJHE 3NCFB 1AKJB 1GGIH 1XMWA 3CFDA 5HGDB 2FB4L 2V17L 2VLKD 5DJ8B 3UDWC 4PJ8D 1PAMA 2MKWA 3PHOA 3MNVA 4PS4H 2FO1A 5DVLA 3QIWC 3QIWD 3CSGA 3BZDA 2AQ2A 4LASL 3LMJH 4KDTA 4KRNA 5SX4I 5I1CL 5C6WH 4AH2A 4FQHB 2YA0A 3C60D 1DP0A 4LLDA 3V6ZB 4LK4A 4HPOH 4J4PC 4J4PD 3ZT6A 1Z9SA 1IQDA 1ZTXL 1JF6A 2RFXB 4GUPB 4PJHF 4XVSL 5DFVC 5DUPL 4ALAH 1BGXH 4LSUH 3ARWA 5KS9F 1T3FB 4YO0A 3OR6B 1XH3A 3ZLQC 3SKMA 1CQYA 2O5ZH 4D0CA 1JUFA 1EAPA 4NBZB 5HVFB 4O5LH 4RBPH 5CHNB 1XR8B 3HG1E 4FQPA 2Q7YA 4TQEH 2XOTA 2VLKA 1YEFL 4PJ8A 4PGEA 1ERNA 1F42A 3HZYA 2AV7A 4JHWH 3QIWA 1BZQK 2VZSA 5E95B 1DBAL 2NW2B 4EI5D 4EI5C 1J0ZA 5J1AA 1XEDA 3PWVA 2VZTA 4DTGH 4PJ9B 3BMVA 4Y19B 5KANG 1OTUC 4YX2H 1OTUD 5IP4A 4OZGB 3GSNB 1KB5H 4K7FB 4JFPA 4JLRA 3GSOB 2OJEA 5MEQB 5DJAB 1QSEE 1NCDL 2YPLE 3K2MC 4XVTL 4J4PA 1QSZA 2AXFA 5DD6B 3E6FB 4MXQD 1CICD 4U3CA 1A2YB 1KB5A 1XGTA 3IU3B 2JKXA 2E27L 3CFIC 4G7VL 3VDAA 3T0AA 4HS3A 4MLSA 3DXAE 4HW6A 1U8NA 3HNVH 4O2CA 4N8VA 4QXUH 1U0QA 3DV4A 4MJ5A 2XZQH 3VXUE 2Y7QB 1CF8H 1XGYL 5E6IB 5K9QI 2QSCL 4PLJC 4PLJD 4EBQL 1RSFA 5FYLL 2ED7A 2NY1D 4QRPB 2J3SA 2CRYA 4H25B 2OYPA 5F70A 3SKNA 4RMVA 1AQDA 1P5UA 3UZEA 2AEIT 4FFYL 4EI5A 1AXTH 4OLUH 5F7LB 1WBYB 3PGCA 1YQVL 3G6JA 4XC1L 2WUCH 4FQ1L 2BRRL 5JHDE 5KG9A 1J1XL 3DTXB 3ROLA 2FR4B 4Q7DA 4B7IA 5A16A 5TFSL 4MDJA 3G5YA 3AM8C 3BQUB 2Q8BH 5T3ZE 4LVNC 1CICA 2H2SD 3UCRA 2N4IA 5FHBL 3ZSSA 2OTWB 4OD1L 1U8KB 2G5BB 3GZKA 3QEGH 4JDVA 3ULUL 2DLFH 3NZHL 2YZ8A 2HAZA 3EFFA 4KRMB 3V6OC 3QEUB 1NJ9A 1PLGL 4G3YH 3ZTJG 5C6PB 1B0GB 1IAKA 1OLLA 2FZ3B 3L9RB 2YMXH 3I3EA 4I0CC 1S7QA 1M05B 2VYRE 1CFTA 1S5HB 5DJCA 3H9SD 3OTTA 4ETYA 1YEDA 5IJKC 5JW4M 4R26H 2Z8WC 4MA1C 3QJFA 3FFDA 5CBEB 1MCKA 4Q74A 3DUUB 4UU9A 2ZG1A 3QPQC 3BE1L 3QPQD 2D0GA 1JK8B 1NBVH 4I0PC 1NGXB 5KSAB 1I3RB 4ODWB 5CILH 3AM8A 1N3NA 5FYJU 1ND0A 3TP4A 4N9OB 4XBEL 1FZOB 4NC2B 3NIGE 5I17B 4M62L 1JE6A 2IQ9H 1C08A 5B3JF 1BZ9B 2B8OT 4Y5YB 3SQOL 1T6WA 2APWA 3V8CA 3QHFL 4X7SL 1FBIL 5GGTH 1X5IA 3FAXA 4JPKH 1BVLB 2BSRB 1ZGLP 1Q9WB 3JV0A 1XF2A 2NY6B 4HAGA 5GGTA 3H9SA 1W72H 5I9QB 2DJSA 3QXDB 4ZUUB 3GSVA 2C9AA 5IJKA 3D0LA 2VQUA 3O6FB 4PLOB 1P7KB 5FYJL 4PGCB 2H2PD 3B8SA 1NUGA 5IT2H 1MJUH 5EDXA 3KG5A 3P9MA 3S35L 5FUZL 1UXWB 3FB6A 4OCRH 4E42A 2GQHA 3DX9B 4U1NB 5MEOB 2D7PA 3SKOB 2XFXB 4YIQA 4U1LA 4JR9H 4MAUH 2P47B 2PW2A 1A7RL 4MSWA 2P48B 3IXAB 3F7RA 4NKMA 4N9GA 1U93A 3T77B 3TYFA 4D2NA 2B0SL 1DQDH 1T0MA 4BSWA 3I75B 1BJ8A 5IW6B 1WFOA 3V52H 5ID0B 2HRLA 3ZHKA 1KEGL 5I2IB 1WAAA 4PB9L 1QLEL 3S34L 3CSPA 4QKXB 5DEFA 3BJLA 1U3YA 5A3IC 5A3ID 1QRNE 4PY8J 1HHGB 4RGOL 4QRTA 4FG6C 5D96C 4FG6D 1KG0B 5C0BB 1CGTA 1AO7E 2GTWB 1R3LA 1NDGA 1A7PL 3P40A 1FC1A 3DURA 5D72L 3BZ4B 2BVQA 4HQQH 4NZDA 2L0DA 2EYTA 5J7CC 5H37H 5TE6H 5KJRH 2BNRE 2GHWB 3QWRD 4FABL 2ICES 3OGCA 1KJ3H 4TUJB 4CN4A 1HZHL 2VDPL 4HK0B 1DANT 4GBXC 5KVEH 3ZKMD 2EH8H 4L8BB 3MLTB 1I9JL 1AGCB 5J57B 4WHYH 4M48L 1B0WA 2AJXH 3ZT5A 4Q6IA 4WHDA 1T7ZA 4PB0H 4YC2B 4UV4H 1KF9B 2ZUQB 3V4VH 1JGLL 2X4UA 4X7EC 3K80A 1MHCA 3F5WB 5IUSA 2A6DA 2HYMA 1G1CA 2X70A 4WUKH 2Y36H 4PJCE 3M07A 4IRZL 3QUZC 3QUZD 3FQWB 3W9EB 4LQ1A 4ACPA 1I7RB 5C0ND 3EFDL 3VXSB 2BDNL 1K5NB 5DQDL 4R90H 2W0PA 4PRHD 3QWRA 1IGJA 1FZKB 5SWSE 4XBPA 2JB6A 1FO0B 3MRFB 4WFEE 2CDGA 3O4LE 4KZDL 4UT6H 4UV7L 2PW1B 2GK0B 5DQJA 4H26A 3KPPB 2XQBH 2OQJA 2MPAH 4JG1L 3RY4A 1ULVA 1ZXQA 1HXMA 2QR0A 1LEKB 3TJEH 3LN9A 2DQCL 4BKLB 3PGDA 4WNQB 4PJCF 2BCKA 1WEJL 3DUSA 1CCZA 4BFIB 1FZJA 2NX5B 4XP1H 4QEGA 3KPOB 1VA9A 4LOUC 2FJGA 4LVOB 1KNOB 3VRIA 4X4YB 3TZVB 4FXKB 3WL9B 2EDBA 4Y4KB 4WW2B 4JG0L 4QYOA 5K33A 4PV9A 1BFOB 2A6JB 3QUZA 4JN2B 3MBEB 3KS0H 1GAFH 5E2TH 3EDFA 1XZ0A 4ZUTA 3EOAB 5KSUB 3E0GA 4OIAA 4PRHA 1ZLUH 3UC0L 1B9ZA 5C07E 1BAFL 2BOCB 2D4DA 1DBJL 1BQHA 2WP3O 4CADB 3SO3C 2ZPKH 1J1PL 1OAQH 4X6DA 1XCTA 3CCHA 2CLVA 2EYSA 4P5MB 4MQSB 4E5XB 4J8RA 5JO5A 5I73B 3CX2A 4UQ3B 2P24B 4LSVL 3GBML 3OZ9H 3HCVA 3UMTA 3ZL4H 5IK3A 4XP4L 5DRZA 4G7YL 1IGTA 1TQCB 1X5JA 3TPUA 1U8OB 4YHYC 8FABA 3W0WE 4NQCD 1C5CH 2JJTC 4ZFGL 2XG5A 1T21A 1YN7A 1L0XA 1TJHH 3QUXB 4HIIA 5ETUB 1LGVA 4MNGE 4Q58C 1UKQA 2ADFH 4OCWH 2WQRA 1NBZB 1Q72H 4YHLH 1KXVC 3TO4C 2VQ1A 3TO4D 4XCCH 4ZNEA 4MMZC 5E9DB 4YLQT 3C5JB 5DJZB 3MBXL 3VD3A 3MLSL 4DCQB 1MQ8A 2GJZB 5MP6H 1RUPH 1IM3B 4JRXB 4PBVC 5JUEH 5E2VH 1NAKL 5BS0E 1F2QA 4P2QD 3K2UL 4WI3A 1I1FA 5DQ9A 4NQDD 5FK9A 3PABA 1I1AB 2AV1B 4ODXA 3QO1A 1FLTX 1BZ7A 1YEIH 2DBJA 3JV6A 1RZFH 5DDHA 2C3HA 3RDTC 1LDPH 3F7YA 3IRZA 3H8NA 3KVQA 1DQLH 1I8LC 3O6LH 5E6YA 3MO1B 4KFZC 1YC8A 5C0CE 3BIKB 5BW7C 5IW3A 1ZGLM 1HHKA 1CXEA 1J0KA 4BH8B 4V2BA 5HSFA 3IDJB 5AYUL 4NQCA 3GMNA 4R4BB 4LCYA 5KOVC 1WIOA 2JJTA 1MCLA 5C0AB 1KPUA 1B2WH 4OLVL 2QKIA 3DVGA 1P4LA 1TNNA 2BP3A 4ONHA 4P46B 1UWGH 2Q3AA 1I8IA 2EIZA 4G8IA 1CQKA 3TO4A 4O9HL 4U6HA 3VGFA 3QAZC 2H9GB 2W07A 5IMKB 3EHBD 2HN7B 3ULVC 3HC4L 2UUDK 1EO8L 1I4FB 1T0PB 3D3VB 1KIQB 3BUYA 4P2QA 2F54D 2DDQH 4NQDA 1GOFA 3R1GL 1BF8A 1AGEB 5F89B 1WWCA 4F15B 1B0RB 5D1ZC 3A6BH 5D1ZD 5I1IL 4NQED 3BD5A 5EU6B 1RUQH 1B4JH 2CKBB 4UT9H 3ZE1E 2JE8A 4RFNB 5EU3A 1BFTA 5J11B 1HQ4A 4EXKA 4NWUL 2XWBB 2I60H 2J7LA 3TBTA 4JZNA 5MHSD 5FCUH 3QISA 3I9GL 5BW7A 3LIZH 3KLHC 4BFEA 3ILPA 2HJKB 4J3WA 3O2VH 1RK1B 2BVOA 1BIIA 4EOWH 5L8LB 1BEYL 2AJVH 2VL5A 5A40E 3RNKB 1NUFA 5BO1H 1T1YA 3GMPB 1CD1A 3IRPX 4Z5RB 3RVTC 1MIMH 3RVTD 2MTPA 3CH1B 5I6XC 4DGIH 4IDJL 3ZE1F 3T1FB 4HUNB 3DYMA 4FXLA 2VXUH 1FFPA 5TE4H 4XZUA 1DFBL 4HH9A 4OZ4A 2KKQA 1DQJB 1IAOB 4IS6B 3RWJA 1NMBH 1FFOA 2P8MB 3N9GL 3T0XA 2F54A 5J8OA 5B39G 1WV7T 3A67L 2IH3B 1AGBB 2RCSH 3BUTA 2LAGB 3OXRA 1NQBA 1KN2H 5D1ZA 5F96H 4NQEA 4CW1A 4YZFE 5EWIL 2ZOKB 3IU4L 1RMFH 2Z91B 2QQLH 1XGQA 1NCCL 4PD4K 1KOAA 1I8MB 5E7FA 3IFNL 3TVMD 5D2NC 1KPRA 3C87A 4NUGL 2G2RB 2APTA 2YC1A 3TNNB 1JF5A 1RIVL 3S36H 1HI6B 3I6LE 2DQUL 3RWCA 3GMMA 4KWUA 1VFUA 1BBDH 5C0GB 4HF5H 3MRRB 4NN7B 3WHE1 1OP9A 3O9WC 3O9WD 1HCVA 1Q9KA 3KYOA 4P2RB 3MLRL 4OV6F 1GL4B 4YZFF 4KK5C 4KK5D 3L3IB 4RMRA 3TT3L 1P6FA 5I1AB 4G8GB 3OAUL 4KROD 3S36X 4AEIL 3U9UA 4C83A 5LGJB 2QSVA 4TSBH 4IMLB 3ARDB 2ZUXA 1CGVA 1ZWIA 4MNHA 3RVWD 4LPUA 4IHOA 4NYLA 4BH7B 3FN9A 5DS8A 2X1WL 1KTLB 1OY3B 1ZT7B 2ARWA 3BW9B 3QO0A 4WJ5A 3E6HA 1PQZA 1NAMB 3QDGD 4WFGD 1J10A 2NY2B 4FNLH 3V5HB 1KJMA 4UIMB 2F58L 3ARUA 3BMWA 3FONA 3RJQB 1YEJL 1YMHB 3TVMA 3SGEH 2VTFA 1UZ8A 3Q0HA 2DJUA 4YDLB 1H3GA 1MVUB 4P9HC 4YXLH 1SJEA 5TJWK 4CMHB 4EN3C 4EN3D 3B4NA 4HXAL 5KVFL 2B1HH 1YJDC 1E4XI 2WAHA 5FF6A 4AG4L 2ZCKH 3BSZH 2ADJB 3O9WA 4Y5XB 3ARZA 5GRJH 1PYWA 3EAKA 3H3KA 5B39B 1IGYB 4ZODA 1CGWA 4OJFL 4X98B 2QADD 1S8DB 1CLOH 3LEYL 3UJJH 2CK0H 1MVFA 2F9BT 4BZYA 5D7LE 4KHXH 3EYSL 4CVWA 4GH7B 5JNYA 1N6UA 4JJ5B 4WU7B 5IMOA 2CIIB 2UVFA 3G5VA 4OGXH 3VFGL 3DETC 3DETD 4OLZL 3IXTB 2UV3A 2IQAA 2VITB 3F7VA 3LDBB 2H32B 3QDGA 4HUWB 1A6UH 3BPCA 1V7NL 1N4XH 3QDAA 4Z6AT 1QFPA 3NTCL 4RQQB 2X4QA 2X10A 3RX5A 5F3BA 3I02B 4I4WA 3X3GL 3S6CA 1LO5B 1G7HA 4LKCA 1T5WA 4LSSH 4HT1H 2C1PA 2LTQC 3U0WL 1S7WA 2ESVE 4EN3A 4CDHA 1JJUA 4A2LA 4CAGA 5L8KB 3BEVA 1HH9B 1ORQA 5T1KD 2CIKA 5FYKL 5C09E 5T5FL 3ARFB 3KHQA 1JHLL 1FZMB 3QZWA 4I0KA 1A3QA 3CMGA 1JNHA 2X4RB 4R96B 4QY8B 1IFHH 1MIEL 1OD9A 3FO1A 1BQLL 4FFWD 1OD7A 2GI7A 4Z7OE 2A38A 5A2LH 4ODUB 4YGAB 5BQ7A 1AHWC 4Y16D 3BKCH 1NMAH 1H5BC 4RIRB 2X4TB 2UYLB 5MI0C 4P57B 2R2EB 4JFHD 3GJFH 4RWYL 5J9PA 5D1XB 4LMQE 1XF5B 3RWHA 4FZ8L 5HYIA 4M4PA 1NEZA 4XB8A 1MCRA 2IPKB 3U46B 1X5LA 1UC6A 4GOSA 2XKNA 4PP1D 1RU9L 4IMKC 3GJFA 1A02N 4IRSB 2YUVA 3CU7A 4JY4A 4KI5C 4OKDA 1MOEA 4JHAL 2FJHA 2IPUG 2Z92A 2NLJB 3QG6A 3SE9H 4OV5B 1MCWW 4LCWB 3THML 5T1KA 3UJTH 2HVKA 3GI8L 1EHLL 4KK6D 1X5GA 1CBVL 2ZUSA 4MVBC 1D5BA 2AQ1A 1KIUA 3N06B 4DKAA 1INQB 2IFFL 3AB0B 4MCYA 4Z7UB 1YUHB 1MFEH 2A9NL 4LRIC 1GOHA 1ZHKA 4JJHA 1GJIA 3A6CL 4QCIB 3G04B 5ERWB 3LKPA 2YS4A 2GTZB 4OM0L 3QWOA 3DIFA 3MODH 4Y16A 2MNUA 1AHWA 4WWKC 1H5BA 4R8WH 4HWNA 3TH3T 4L1DA 2DWDB 1JGEB 3REWB 2X4OB 4WENB 1D5XB 4HWBH 5IB4A 3MCG1 5AD0A 3P4MA 2O5XH 4PTUA 5IHLB 4WTXA 4U6YB 1U9KA 2SEBA 4X6BB 4X4XB 2QQQA 3TV3L 1WBXA 2MHAA 1A4KB 5EPMB 4HWBA 4IMKA 1CI5A 2PXYD 4GAFB 2BC4A 1RZKH 3KPMA 5JR1L 3NZ8A 4KTEH 1C1EH 4QRSB 1ZT4B 2VLKE 2ICWI 3OR7B 1BMGA 4N0RA 3UTZA 5FO8A 5JW3L 4XNUL 1QKZH 1VGKB 1VGEH 3BWAB 1X44A 1N6QL 1LDSA 5EIQA 1WFTA 4PJGB 2RBLA 4O4YL 3SDCC 1MJ8L 4P23B 1MCOH 3EYUL 3S88H 1PJ9A 4MJIB 2KZ1B 4WWKA 4ZS6C 3F12B 4ZS6D 3LKQA 1CFBA 3OGOE 2J6EH 3EYFA 3QXTA 4PJAB 3VRLE 1AP2B 3VFTB 4PRIB 1KJVB 5B22A 1M1SA 3PP3K 4NRYA 2FH6A 2NXYB 1D5ZB 3QH3A 5DTFA 3AU1A 4M1GL 1AD0B 1RULH 2J6EA 3IDIB 1P7QD 4MD5A 5T5NG 3QP3A 2PXYA 3QIUD 4UOW0 5ISZB 3C9NA 3O3DA 2ZOLA 3R8BB 1GGBL 4Z7VB 4YHZH 5DD3L 3ESVF 4IOIB 3VH8G 1DTUA 3T0EB 5HDQL 2ICEB 1TPXB 2V2TA 3HMWL 3DYOA 1TJGH 1P69B 3G6JE 3HE6D 4KMTL 4O2FB 1UT9A 5ACMA 1W8OA 1QO3A 3D0VB 3LS4H 5C0RL