4GBXB

Crystal structure of an immune complex at ph 6.5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
189
Chain Sequence
VLFQGPGDTRPRFLWQLKFECHFFNGTERVRLLERSIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DM alpha chain
publication title Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 189
sequence length 196
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gbxB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gbxB01
2EDKA 2AERT 3IDIB 3BPNC 1A6TA 3QQ4A 1CG9A 4MJIA 5IMOA 4FQQA 1JZ5A 2VSDA 3V6ZB 1RAMA 4PTTB 3SBWA 4JFEA 2Q7YB 2EYTA 4MXQC 1Q94A 25C8L 1CN4A 1UA6L 4K7PY 4EUPB 1N7MH 1U8IA 1FE8H 4PB9H 3SN6N 2D0HA 5ELIA 2D7TL 4QHLA 5DDHA 3LV3B 4Y4FA 2Z92A 4X7SH 4ZO7A 1MRDH 1IFHH 3RWEB 4PRIE 1LEIA 4WV1A 4NJ9L 3GGWB 3ARUA 5FKPB 1FRGL 1TMCB 1YPZE 4KVNL 2QJDA 5FHAH 5EUKB 2QR0A 4W6YB 2NY4C 5CEZH 4LAQL 1OHQA 5J3HD 1U3HD 4TUJA 4X6BA 4Y4HD 5JMOC 3K4AA 4P4KD 4RFNB 1I8KA 1B4RA 3GKZA 4I77L 2X5PA 4PB0L 3VDBA 2YN5A 1KPVB 1NGZB 5IFHL 5HYQA 3NTCH 1JIBA 4JFPA 2F58L 2W59A 3GMQA 4GKSA 3SKOA 3B9KD 2OBGA 4OKVB 4OLZL 1E4KA 1A1MA 3ZSTA 4AG4L 3PP3K 4OFVA 3HZKA 1J86A 1FL5B 5FFLA 2P5WA 1NBZA 5F7MC 1W72B 1M7XA 5EORL 1UKQA 2PW1B 4WI2A 3BP6B 1ZT4A 4A2LA 1RZIB 1N8ZA 2BCKB 3SE3A 2NYYC 2E5EA 3DX8B 3ULVL 3QQ3A 4QOKE 3HR5B 4PJHA 4O2EB 3DETD 1G1CA 2IAMA 3PG2A 1K5NB 4XNZC 1PZ5A 3H9HB 4HEME 4LEXL 4ZPVA 4Y89A 1YY8A 3QEQA 3WLBA 1QP1A 5I71B 2KH2B 4LSQH 1YYML 5A16A 1F42A 4WU7B 2EXWC 3MO1B 1NCBH 1LO5B 3T3PF 4QRQB 1UZ6E 1ZMYA 3RTQA 4R7DB 1C16B 1KELH 5MEQA 3DYPA 4L8BA 4HKXB 1BFOB 4LAJH 4FFVD 4XPBH 5K9KA 3X13B 2N7AA 4Q6IC 3QRGH 1I3UA 1MWAH 2F19L 4U1JB 2VLKE 1CICB 1H5BA 3JWOL 3ET9F 5IROC 4MHHG 1OTUC 1DLHA 1JUFA 5IBTH 3W9DB 3CSBA 3KXFB 3O4OB 4S1SH 1HSAB 4XNYL 5DMGC 4PLNC 4MB3A 1I9IH 4XRCA 2HT2D 3TNNB 4LKCB 3SGKC 5C92A 5IB5B 4H20H 5JQ6L 1UM4H 4LMQE 5I18H 3FJTA 5EU3A 3HB3D 1NAMB 5CFHA 4GAGL 3G08B 3UJTL 3BZ4B 3L3KB 3CFJB 3IFLH 4H88L 2CLVB 1T2QH 4TVPL 4X8JB 2PO6B 4ETQB 3EYVA 3HNTH 2V5MA 4Z95L 4AL8L 3FOMA 3MGTB 5B8CA 2MHAA 5E95B 1FL3B 2Y1VA 1GHFH 1BJMA 3R4DA 3O6FC 2OR7A 3WMSA 4RNRA 4L8DA 4M1GH 3F12A 4UT7H 3ZMRA 2X1OA 1T4KB 3SOBH 5IJKA 4PJ8C 5INDB 2YKLH 4NC1C 4NM4L 15C8L 2AGJH 3ULUH 4Y4KD 5KANG 5JIIA 4PLJC 5IMLA 3KYOA 1GGCL 5D7IF 2BVEA 1U3ZA 3BPOB 2VLJA 1SMOA 1K4CB 4L4TA 1U42A 2ZUTA 3MV8A 2WBJA 4TNVK 4WIQA 1MVUA 5FYKE 1FZKB 3BN9D 5JHDE 2ORBL 3FB5B 4MJ6B 5D93C 3STLA 5IHLB 5GRVL 1EA9C 3MNWA 4Q2ZA 5TE6L 3DUHA 5DS8A 4IOSD 1BZ9A 1UJ3B 5F88A 1QLFA 3NFNB 1WZ1H 3QDGB 3BW9B 3QEHA 5EIQA 3ROOA 1DN2A 4ODHH 5EOTB 2Y25A 2FL5B 1WBZA 4X9IA 1XFPA 2ZJSL 3MLRL 5IM7B 1P4BL 3IETA 1TJIH 2PYFA 4HH9A 3FAXA 2X9WA 4MAYA 4Y4HC 5DFVD 3GHBH 3CLFH 3ZE0E 3Q3GA 2OL3A 1HQ4A 3CFDB 3I2CH 5FGCE 1GJIA 4CADA 4JGMA 1JK8A 3QUXA 1CR9L 1PW3A 2Z8RA 4GBXD 5JOFB 3DV4B 5IHZA 3RGVB 1EO7A 2QSVA 4GXUM 2YWZA 2QQLH 1N0LA 4RZCB 1HHKA 3KG5A 3KPRE 4XP5H 3QEGH 4OI8A 5TF0A 4BZ2H 4P59H 1QFPA 5CSZA 4YHOH 3TCXA 4H1LH 4XAWH 2YD7A 3IFOB 4FQIH 1OCWL 2R56H 3KDMA 5T3ZE 3TH2T 4HKZA 5C0RL 5IW6B 5TF1L 4GQ9H 3DETC 3DV6B 1EMTH 3K4ZA 4LVOC 1D5ZB 4E5XB 1NGPH 4L4VB 3T09A 2R2EB 1J1OL 2A1WH 5F7HA 4N9OB 2AK1H 2VRAA 3KJ6H 3BKYL 1KBGH 4W81A 4KKBD 3SE8H 3EFDH 4PJ5B 5DHVH 3A6OA 4RRPA 1J0YA 1I8IB 5B21A 5DYOA 4X6DA 1X5XA 3B2VH 1O0VA 2NPLX 4JPWL 1AE6L 4KHTL 3QUYD 5E9DB 3FOLA 5EBWB 4J3XA 3O0RH 3QUZC 2Z93A 5K9OB 3QAZC 3JTTB 1D5MA 2FBJH 1ZGLA 1U6AH 1E4XI 3QDJB 4Z7UB 3RKDC 4U1SA 4DTGL 4R4NC 3HUJA 1JWUB 5I8EB 3FRPG 2NX5D 3MRBB 4GG6B 1UWGL 4UB0H 5BRZB 4FNLH 2HJFB 4P2QE 3C5SB 2APBA 1A47A 5IQ9A 3TO4B 5JNYA 2HT2C 4YIQA 3C5ZC 2G75B 2GTWA 1I85A 4JPIA 1YY9D 4YDIH 3VFNB 4PS4H 4OCXL 3WXWL 5IR1A 2H9GA 5KSVB 2HJKA 4R26H 4X7FC 2JJTA 3FO0H 5IHUH 5CILL 4NZJA 5IBUB 5I1DB 4LCIH 4KJYB 4KZDH 3QZWB 4LVHC 3RAJH 4KTYA 4WI4A 2CK0L 5CZXD 1ZT7B 1CGSL 2Y07H 2VZ3A 3GSVA 4F3FB 3VXMD 3TO2B 3U48A 5LBSH 3KLAB 3K8KA 5D96C 4AIXA 2R29H 3LRHA 5FUZH 5C0IA 1N64L 5JLZB 4ODWA 1HK6A 5FO8A 3GKWL 4MXVF 4OZGB 1B9ZA 5GGRB 3O9WD 1WWBX 3H0TB 3D6GA 4I2XA 4TOYL 4OV5A 1OAUH 2DICA 3PWVA 3RWDA 3U6RB 2IQ9L 3TH3T 3S88H 3IDYC 4Y1AE 3VXNA 4LASH 2VLRA 4YX2L 1LMKA 1YNLH 5E4IA 4JDTL 3UO1H 5C7XL 2E8ZA 5CEXB 1LEKB 5D1XC 3T1FA 5L0QC 3JWDH 5FYKH 5F6IC 5C09E 3SJVB 3UAJD 3EAKA 3TBVB 5CZKA 2EIDA 1KJVB 4F7CB 4XHJD 2RB8A 2X1QA 1MFEL 3BKML 2DQFB 5C0AB 2Y06L 4OFIA 5HDOA 5DQDH 5DD0L 5AYQA 4QLRA 3SDYL 4LU5H 2J2ZA 2UVEA 1GOFA 5F6HI 5IKCB 2GAZA 1TQBC 4XC1L 2X44D 4ZFOL 3HE7B 5BZWA 5E6ZA 4GOSA 3TA3D 5DFVC 2NY6D 3GK8L 8FABA 1KB5L 1S5IH 1G9EA 2DYPA 2CKBL 3LSOB 4MDIA 1YMME 4H0HB 5BO1H 4X6CB 4PGZA 4D9LH 2YD2A 2WMPA 5ADOH 4LSVH 4KHXL 2IQAA 1KV3A 5CJOL 1SJEA 4UDUB 5I1IH 2OP4L 4XMLH 5DEFA 3CIQA 3M17A 4PJDE 4PJEE 4YHML 2PNDA 3LS5L 4Y16B 5EO1B 1HQRA 1RFDL 2EDFA 2ZOLB 2Q76A 4LRIA 5ALBH 4D9QD 2VL5A 4P9ML 5B39B 1ZHLA 2W9DH 2Q8AL 3IF1B 1AXSA 5E4EC 3Q5YA 1YJDL 4M62H 4UTBL 1UZ8A 5EH1A 3BN3B 3SKJH 3PL6C 3VRIB 1Y0LA 4LEOB 5T3ZH 4JO2H 4UDTA 3OKDA 4PJXB 5JDSA 4X7DC 2H26A 4CVZB 2N4IA 2VDRL 5GZND 1WBXA 4MQTB 1GAFL 5EU5B 4CAGA 2HFGH 5SWSB 3ARPA 4UILH 1CI5A 1S9XA 2E6QA 4XVJH 1V5JA 2BOCA 3ZL4L 4LBEB 5BXFA 4Q9RL 5INCA 3QUYC 5J06A 5KS9F 1RMFH 1ZK9A 1GGIL 1R24A 3W0WA 4HW6A 5I1EL 1VPOH 3TVMD 4JZOA 1RV6X 4ZSOB 5I1CL 1LP9F 4BJLA 5CEZD 3BP7A 1FVCB 43C9B 1NDGA 3MUGA 2V2TB 2PUQT 2CMRH 3MR9B 3PWPD 4RMSA 5GISH 5CJ5A 2XWBB 2AQ1A 1A6AA 3MUJA 3QIBA 4HC1H 5KVEH 2DQHH 4YWGH 3S35X 5D70L 3RNKA 3U7WL 2EDJA 4KAQH 4OGAD 5IGXH 1FG2B 1Q0YL 1IAIM 5J6HB 1G7QB 4NGHL 2XN9A 1RZKC 4KDTC 1Q9KB 3ZE2F 4OZIF 1ADQL 4PTUB 4EXPX 4LCCC 5GIRB 2HN7A 3HZMB 4ODVL 3VXQA 1PG7H 1I1AB 4FTVD 4CMHC 5I73B 3EHBC 4LDLB 4YO0A 1P53A 3HZYB 4Y2DB 1MI5B 2YN3A 2DS4A 3U0PA 2FWOA 1S9YB 1AGEA 2QKIB 4MQSB 1MEXH 4XBGB 1E28A 1NGQL 2A9ML 4WFHD 1I8MA 3GUTB 2R0WL 3ULVC 1AO7A 1Y6KR 1ORQB 5BS0B 5D1ZB 1ZV5A 4LF3A 1PYWB 3C8HA 4LCWE 3LIZL 4TTDD 1AGFA 2MMXA 3MUHL 5HGDB 1NCDL 2FLBT 2VZSA 4IOIB 2AK4B 5LVEA 3C6LC 3O9WC 1MCLA 4OV6F 3PQYE 2OTPA 4LL9A 3CDGA 3QH3B 4QY8A 2DD8H 1CE1L 3UPRA 2A77L 4JO3L 1LO3H 4OZHB 2QHLA 4M8QA 3GJFA 4HJGB 1JGLH 4JPKH 4NN5B 2VE6B 4JRYE 3V7AE 5IQ7L 5H37G 1FZOA 3LKQB 3BDBA 4XGZB 2MFNA 1I9RH 1MCBA 4X4ZA 4FQ2L 1HDMA 1UWEH 1MFCH 2YR3A 5J13C 5BV7H 3P9LA 1M6OB 2NY5H 1U8MB 4N5ED 2VUYA 1MCWM 3HNVL 3WIIH 1JHKH 3RVWD 2R8SH 4CJ1A 3JWOC 2FSEB 1WWWX 1FG9C 2R2HB 4WO4C 3VMNA 4XNMA 4JY5H 5AYUL 3TLRA 2DQDH 1TJHL 3MRKA 4Z0BL 1I7TA 4I5BB 3K81A 5KSBB 3HZVA 1J8HD 2DWEA 4ELKB 4MNGB 2VC2H 5GS2H 4KGLA 4KQ4L 3MJ8A 5HHOD 5EULV 3O6LH 1CFVL 4LLMA 3G5VB 3LVEA 4HGWB 4RFOL 5F9DC 3T1WA 3DBXB 3TC9A 1KB9J 1R0AH 3H9SB 2DWDB 4HGKC 4ELME 3RFZC 3WJLA 5IJVA 4WW2B 4NUGH 4GAYB 4P46D 3TJEL 1ZLUH 1C1EH 4JJ5B 3VXOB 1CK0L 3OV6A 1VFMA 5IG7B 3NA4A 4Z6AT 4LSRL 1XF3B 1JZ3A 2GJ6E 2DLFL 2YSSB 5LWYH 3H2WA 3T77A 3KPMB 1KN2H 1AR2A 5EN2A 2EKSB 2Q6WA 2GTZB 3U0WH 5GRJH 3D9AL 3QNXA 4HF5L 1P84J 4U1NA 4MWFB 2DQCL 3SDAD 2D31B 4URTB 1CS6A 1CZ8H 4OF0A 1UXWA 2AEQL 5A2JH 1AKJB 4UQ3B 1LHZA 1SYSA 2EZ0D 1LK3H 3E2HC 3DMMD 3VXSB 2OI9C 3DNKA 4X6EB 4EVNA 3OKMA 5TH2B 5F7EL 1ZWIB 3CMOL 1S78C 3HAEA 4OFYA 5B38G 4U2ZA 1K9TA 4CJ0A 1JVKA 4YC2B 2ENYA 5DK3A 2AV1A 5I1KL 4O00A 2E3VA 4IMLA 5E2UL 1T1YA 2OTWB 5BVJB 4PRID 4OB5H 1YA5A 5KN5B 5BVPH 1RJLA 4CU8A 3KPSB 2OZ4H 1NBVH 2V5RA 4N0FA 4M1DL 4JY4A 3KLSA 2AXJA 1A2YB 3QPXL 4G6FD 4JZJA 4UUJB 4L29A 3EDEA 4DQOL 4FQXA 3IU4L 1HYSD 1JNHA 1I1FA 2YMXH 2P7TA 4Y5YA 5DZNA 3ARRA 4CVWA 3MLVL 4GQPH 1WLHA 4OGAC 1FZJB 1HINH 4OZFH 5DHYA 3S35H 4JR9H 4KTEL 2E27L 4G7VH 4H8WL 4MNQE 5DUMH 1F90H 3FB6A 3C60D 2E7BA 4BSWB 5DK2B 3TBWA 3SE4C 4PBWD 1F4YL 3W11D 1R5WB 3EZ8A 5C8JA 5MP6L 5EC2A 4HT1L 5EIIA 4C58B 3LKOB 2Y7QB 4QOKD 4DGYH 5IB2A 4LLVB 1PKQE 3S8WA 4ODSH 4KJPC 4IRJA 1XCQA 4ZUSB 4JKPL 1E4WH 3ZDZF 2XICA 2EDLA 4X0KA 4LKXB 1PAMA 4A6YH 3B6SA 3EBAA 5JO5B 4YDJA 2R1YA 1KOAA 4NZRH 3MRQA 2D7OA 2Y23A 3EIFA 4KROC 4UBDC 3HE6A 3P73A 5T1LB 1U3JA 1T6WA 5IVXB 1NKOA 1VEPA 2ZG1A 3OGOE 4K3DL 4XXCC 4L3EE 5EU6E 1XGUB 4PJAA 3ARBB 4K3HA 3C8DA 3Q0HA 1A7QL 2R4RL 4IJ3B 4KMTH 3MZGB 4MB5A 1N4XL 3RX7A 1JHLL 4KWUA 1FHGA 4YK4C 2H2PC 5IMOB 2VLKD 2YPLB 1JWMB 4JM2D 1J0HA 2NY4B 3RL2B 1BVLB 2EYTB 3HNSH 3PWUA 5CKGA 2CLZB 2P8PA 1KCRL 4G8IB 2OQJA 4FA8A 2I27N 3L3IB 1RSFA 4TSCL 2AJVL 4WWKC 3WFZA 4OF5A 2Z92B 5I8OH 5C08E 4HULB 4QXTB 2LAGB 4IIQA 2OJZL 1JNJA 4P2RD 5GRZA 3WJJC 4G6AD 1JHTA 5SWZB 3BQUA 3DXAE 4ZFFA 2AJ3A 1KCUL 5CINH 5E8NA 2EEAA 4LHUB 4PIRF 5IWLA 4MJIE 3CH8A 4FXKA 2XZAH 2VB5A 1I8KB 4P46C 3X12B 4BSVA 1E4JA 4OFPA 1DEEA 2CJUH 4PRBA 3Q5TA 5EBLA 4OCSL 1J1PL 2HRPH 2YUXA 5FIEA 4AENB 4P2CG 2IPKB 2IADB 2X1PA 2ICWB 3U46B 4PJGE 5TGBA 3GRWL 2W9LA 4NQCE 4U1LB 4NO0D 1ZLWK 4O2CA 4DVRL 5D6DA 1T0PB 1HN1A 3VWJA 1ZT4B 5D71H 4G7YH 4NSKA 1W0WA 1MNUH 1QA9A 3O45B 1IQWL 3PWLA 1UM5H 4OM1H 3RNQA 4LVNC 1F3JB 3AM8A 2ICWI 3DMMC 1BZ7A 4GW4A 1LP9B 1WCBA 1GOHA 3T2OA 3GNMH 5FYKD 4D94A 5JHDD 1XF4A 1J0JA 2WWKO 4X6FB 5GSRA 3DX7B 4LLYA 1BAFH 2R0LH 1A6VH 5FUOL 3UTQB 4EI5A 3FFDB 1C12A 4LQ1A 3PWNB 2P5WE 1J1XH 4PG9B 5A16B 5D5MB 3X3GH 3D0LA 4ONOA 1OF2A 2VTFA 1RZGA 3NA9L 2HT3D 1JV5B 1DANT 1FL6B 3U1SH 5DD6A 3JUYA 5IOPA 4HZAA 2NTFB 1YYLL 3QULB 4IM8A 2ZNWA 1J18A 4AMKH 2HLAA 4UIMB 3ESVF 2EIZA 4HAFA 4HUKB 2VH5L 4U6XB 5HYIA 4ALAH 2VDNH 1YEGH 1V8HA 4MCYA 3EYUH 1IMHC 1DLHB 1CL7H 1E6JL 1CTOA 4KMQA 3O6FB 1CDJA 4XRCB 1L9NA 4PLKD 4JY6A 3QEQE 3P4NB 1XIWD 3ARDA 1IM9D 5JOEA 3KPRD 3RKPA 5GGTL 4J12A 4OUUA 4DGIH 5DJYA 3CNKA 5F70A 2A74B 3WKMH 1RQ5A 3L9RB 4FXLA 4Y5VA 3GSOA 4HDIA 4K3GA 4R4BA 5T3ZD 2NXYD 1ZHNA 1YJDC 3F6LA 3MLYH 4PJBF 4BQBA 1HEZA 1NC4D 3ULVF 1B4JH 4JHBA 4YE4H 5I0ZA 2BHUA 1I3GL 2J4WL 5LQBH 1X5JA 3OKKA 3PABB 1XT5A 4RNRB 2DLEA 4GAJL 3MJ9A 1CQYA 1MFDH 5KBNC 1NAKH 5D93B 3GI8L 3J7HA 1V7NL 2PR4H 4M8VA 4B7LA 5EO9B 3F62A 4NWUH 5JXEA 1G6RB 3BISA 3QI9D 4OIAA 4Q6YA 3GHEL 4BK4A 1JGEB 3JV5A 3UTSB 1AIFA 3H3KA 3LRGA 2ENSA 4I0PB 1OSZA 1WZLA 1Z9LA 4JM2C 1RUMH 1FNFA 2Q20A 3Q6GL 1IE5A 5GGUA 1UACL 4P2QD 4WCYL 1A21A 4NQXA 1D6EB 5ANMA 5KVGH 5DS8B 2JF1A 4W6XB 4OTXH 5F88B 2I9LA 2JK5A 2IFGA 4QRPB 3S3PA 4HD9A 7FABL 5DD5L 3VFMB 3ROOB 4X83A 1ULVA 3PXJA 3HFML 2B4CH 3KHOA 4XZUA 1KLFA 3ZSSA 3NOIA 4FFYL 4NUJA 5EZOH 4JFDA 2PYFB 4KKLC 4HH9B 4MAYB 1EVTC 3RY6C 4NQSA 3TGXA 5EO0A 3G5YA 4XP6L 1CGYA 2D9CA 3HC0B 3I9GH 1L9MA 2H3NB 1DBKL 3FRPA 4V1DA 3BVNA 1YC8A 1GPOL 4CRPA 3BEVA 1K8IB 1YEEH 4ZOBA 4ZD3H 1T89A 3MRGA 3MRIA 1U8NB 3QUXB 4HUVA 1CVRA 4HKJA 5ERWB 3TZVA 3MQIA 4NIKB 1T1XB 3P9WB 4HWEL 4L1HA 2EEDA 1HHKB 3MRMB 3BXNB 4NFBA 2FX9L 3V4VL 1IKFL 3CDCA 4O58L 4R0LA 3NIDE 2VDMH 4HKZB 4M6AA 4PJCE 3VWKD 1IZJA 1OGAB 5HGAB 1A0QL 3JV6A 2PKDA 4PV9A 3AAZA 1EIBA 4LLWB 5C09D 2APTA 4K8RL 1SJHA 1I1CA 4BH7B 3NAAH 1IGFH 2UWEE 3T0EE 1OPGH 1A6UL 1UVQA 4OGXL 2YZ1A 2H6PA 5GS2D 3O2DL 4YUEL 2NY1B 2H1PL 1L0YA 1JE6A 1QSFB 1ES0A 1R3JA 4OFKA 5AZ2H 5A2FA 2UUDK 2XZQL 2DQUL 3UYRL 1QUNA 3QHFL 1T21A 4QT5A 1NCNA 3U30B 3ILPB 1KT2B 4OLUL 3MCKB 5KW9L 4P23D 1BQHG 1YMMD 4U1SB 1M05A 2KL6A 5I74C 3T04D 3PNWA 1LNUB 1IAII 4OQTH 1MLBA 2I5YH 3OAZK 1X5KA 1HXYA 4YIQB 4PLKC 2GTWB 4GLRH 4HS6B 1JRHL 1XIWC 4UAOB 1IILE 2VJXA 5DJ8A 5HY9A 1HOCA 5CJXA 4XP1L 2VXQL 2WP3T 3DURA 3CX5K 5E8DL 4M7JL 5ADPH 1ACYH 5HPOA 5MI0C 3HRZB 4GRWF 2X70B 2F9BT 2WWMD 4CW1A 5MEPA 1JNLH 5DVLA 5KZCB 3GSVB 2LQRA 4OD2A 4PP2B 1SBBA 2CRIA 3S37X 1RPQA 1X5IA 3MRNB 3RPIB 3HUJE 4PGEA 4YHLH 2Q86B 3T2NH 1KNOA 1KXVC 4NKOB 5BQ7A 3SKMA 1S7SA 5KS9A 5C0IB 5H94A 4ONHB 4ODWB 2NY0C 4C57C 4ENED 1ONQA 2BRRL 4KKCC 5GGQH 4YJZL 1SYVA 1QFWI 2HRLA 4Q6IA 1L6XA 4KY1L 2FDBP 3QI9C 4PJ9D 1S7QB 3EOAA 2X4SA 5IROA 2OSLA 2ADFH 3TIDB 1BWMA 1FSKB 1Q9LA 3U4EB 5GS3A 4PJFF 1P6AB 4LHJB 4XPTL 3GBML 1TQBB 1VA9A 2EIEA 3QEUB 4EDWL 1RULL 4F58L 3CU1A 1HKFA 4X8XA 4OZIA 1FNSL 3T1FB 4CVXA 1H3XA 1V3KA 4Z7NE 5MEOB 2R1WB 3FQTA 1HHIB 1OAQH 4K71B 5D2NA 4KKAD 1VGEL 1U8JB 5D1QC 2F5AH 5ILTH 5L88L 1ZVYA 4H8WC 4HMCA 5GJTL 3BIBX 3DVNA 3T3MF 3MPCA 3IU3B 1NCWH 1NANH 4GG8B 3VFRA 4I2XE 1E6OH 2OXHA 5C0FA 1FLTX 1QSEA 1ZVHA 1BWWA 1DQDL 4Z77A 5JR1L 1BREA 3CAFA 5KVFL 3ECBA 8FABB 4JLRB 3BIKA 4WI7A 4DZ8A 1EK3A 4U6YB 3UTTA 3RIAK 4PJ8A 5C2BL 3AXLA 4Z7OF 4KTDL 3QUML 5IP4A 3WHE0 2EH7L 2WWKT 1UENA 4LCWD 2DBJA 4IRSD 3I6GA 4PGCA 5HHVH 1G7HA 3M17B 3MV9B 4ZUVB 2CH8A 1RZ7H 3FQWB 1F8TH 2PCPA 3PQYD 1HQRB 2CDEB 6CGTA 1UADC 1MSPA 2ZUWA 1MREH 5DTFA 2Q76B 2VL5B 4UTAH 3IXTA 4OIBA 1AXSB 3AU1B 4KXZH 4JRYD 5BV7C 3MREB 2NY5C 3RVVD 1A3QA 3MACH 1T2XA 2XY2A 5C70A 5LGKA 5F9WC 2EDTA 3FHAA 5J7CC 5IESH 3P77A 4ZYKB 4LSSL 4DKEH 4U6VH 1U8QA 3N1PC 3O4LB 2V7HB 1S9XB 3VRLE 3RWCA 2CLRB 4JO4H 4TYUA 1A6ZB 1U3HA 3P4MB 5IB4B 3UP1A 4Y4HA 2YOCA 4P4KA 1N2RB 1FO0H 4WFGE 3W0WB 1KEML 1IKNC 1LK2B 1XGYH 3IRZA 1WAAA 4LCCB 3KVQA 1S8DA 5E08H 5JXAL 3TBSA 5ICZB 3B9KA 1BGXL 4P23C 5I6XB 3QO1A 4POZC 2O5YL 1OM3H 2WQRA 2WINB 5JZ7D 2GFBA 2IBZY 4JN1L 4Z5RA 4I4WB 1KJ2A 2F53B 1WEJH 1T83C 2GJ6D 4ZDHB 4G6ML 3DSFH 1R3HA 3RIFK 5J1TC 3FHQA 5D2LB 4YHIA 3WO4B 5F3HA 3U83A 3JVGC 1MCPH 3BGFC 3QQ9D 1JPSH 1HZHL 2DLGA 2W0KA 1UKSA 4ZS6C 4EUPH 3MCLH 2X42A 4OCLC 1K6QH 1I8MB 4M7ZC 1IGMH 4HWUA 3SDDB 5CWSA 2R9HD 4DN4L 3OXSA 4G8GB 1HILB 1MCKA 4JKKA 3S37H 5D9SA 1ED3B 3ELAT 5IW1A 3S3JA 4FABL 5HVFB 4MA3B 2FEEI 12E8L 3WV0A 2L4OA 2L0DA 1NCUA 3W39B 2PETA 1MAMH 1NMAL 2B39A 4JVUA 1UZ6F 4WO4B 4WJ5A 5GS1C 2GCYB 3UJIL 5GGSA 4Z7VA 1KFAL 4X80H 3FRUB 5IT2H 1ZE3C 4XX1E 3QG7L 3O2VH 3O3AA 4NQEA 1A4JB 1L0XA 5GQBA 1RZJL 3WIHH 2L7UA 3C5ZA 2O61A 5DD1H 5I66A 1FFOA 4JM2F 1I75A 4NQDB 4XPBL 3P9LB 4NKMA 1A6PA 1QACA 3T0WA 2FJFA 3WKNA 2K9UA 5JUEH 2WUBL 4WUUB 3PGFL 3P40A 2F74A 4MNQD 5IMMB 1DL7H 4PRDA 3OB0K 1OWRM 5J0BA 4Z8FH 1AFVH 4LLUB 4RBPK 3F7VB 4L4VE 4CDGC 4YDVB 4R2GB 1X4YA 1BOYA 4S1DD 1AI1H 4P5TD 3F5WB 4FZ8L 2DRUA 2GSIB 5IB3A 3HI1B 2PW2A 1CFNA 4R96A 3MBEC 3V5DA 1WJ3A 5E9DE 1QNZL 3OAUH 1XR8A 2HAZA 4HIEB 35C8L 2HTKC 4L3CA 1TENA 2OI9B 1NDMB 5BW7C 1GGUA 2Y5TA 3QDJE 3SDCD 4Z7UE 3T77B 3SOBL 1CD1B 5CBAA 4EQ2A 3CPLB 4GG6E 1GL4B 1IGJB 5BRZE 4L3ED 3ULUL 1DSFL 4JRWA 5EU6D 1IT9H 1W8NA 1T7YA 3U7YH 5D1XA 1SJXA 4KI5E 1Q0XH 3RZWA 5ISZB 4WHCA 5CHNB 4W70A 1CLOL 3F7RA 5C07B 1EGJA 4L3AA 4O51A 1LEGA 5D7SL 2NY3D 1Q9WA 3GMPB 5I76B 4LFHD 2XPGA 3CFCL 2J8UB 5D7JB 5HYJB 4MA7L 1T6VN 1IC4H 1WBYA 1AHWC 4ZAKB 3VGAC 2P24A 3CFIC 1R3LA 1D5IH 4OD1H 5C08D 3WHXA 1SY6A 1WZ1L 3Q1SL 4JM4H 1SEBA 4N8PA 3DXAD 3ZO0A 1IL1A 1A3RH 4Z7WB 4OZGE 2CK2A 1SVCP 1TJIL 2LTQC 4MJID 4C59B 4J1UA 4AEIH 5TJWK 2HKFL 1I1FB 1JNHB 5JZ7C 2B20A 3I85A 4QF1A 3VFGH 4ETYA 4X4YA 4NDMB 1TZHA 3K1KC 4LSDA 1A6WH 4UI2A 1LO0H 3G6JB 2PTTA 2DQGH 1VDGA 2O5ZH 4LRNL 1ITBB 4ZUUB 3NCYS 1YEFL 4AY0A 4DFIA 2EECA 5DHYB 1NMBH 1U8PA 1UH4A 4HFUL 4JVWA 4Q9QH 4IBLT 4NQCD 1AQKH 1II4E 1RK1B 4KK9C 4Y4FD 3DWTA 6FABL 3SPVA 2QQLL 4X99A 3L7EA 2B1AL 1RU9H 4OLWH 1RD6A 4QTHA 1BQHB 4P2OC 1X4XA 1TVDA 5EA0H 2JELL 3WN5A 4K7PH 1JF1A 1MCNA 3A6CH 5DJZB 3REVA 2AJZA 1TZIA 4XAWL 3TF7C 2BC4A 2XZCH 4FQIL 3S98A 5M7QA 4OCRL 3X3FH 1PQZA 2R9HC 4IRJB 4M6NL 4N0UB 2EDHA 3QCTH 1EMTL 4CBPA 4EEEA 3Q6FB 1G9NH 2C1OA 3QUYA 4H0IA 4D8PA 4OCYL 4NCDA 4X0KB 3JV4A 4JO1H 4PR5B 5AG9A 4PGDA 4K8RC 5JTWA 2GSGA 2H41A 2P5WD 4X6CE 2C9AA 4HV8A 3OJ2C 3RL1A 3P30L 3S5LB 2NX5A 4JFHE 1FJ1A 2Y5EA 3GSNA 4PJAB 1P7KA 5KSAD 1NGWA 1W72L 1VKXB 2RGSA 4XWOD 4NKIH 1IAOA 3NH7L 1NKRA 1MCEA 2VAJA 2CDGA 1FNEB 4DKFH 4MNHB 4PY8I 1MHPL 1KYOK 2BVOA 1ORSB 4XTRD 5AWNH 1IGCL 2IAMD 4XCCL 3DUUB 1O7SA 2OTUA 3NZ8B 3V6FA 1ZS8B 3MGOB 2C1PA 1VGKA 1NUNB 1VCAA 3VRJA 2NY7H 1U36A 3VXRB 3T3PE 2OJEA 4J6RL 4R9HA 4XBEL 3QEQD 2OQJB 3H3PL 4XI5D 3RZCD 1QVOB 2VXUH 3V0AC 1F02I 3VXMA 4Y5XA 1HIMH 4PJBA 5KJRH 4HKBA 4ODTH 2KQMA 3RTQD 1P9MC 1KACB 4X9HA 2NZ9D 5EOCH 4FQJL 1E4XH 3BEWB 4XP9H 4I18B 2FJHA 4H25A 4K9EH 1KTDA 4RIRB 5HYSB 4O5LL 3CFBA 2KDGA 4LVNB 3QXUA 3QCUH 3C6LA 1CGWA 3NABH 3O9WA 3ZYOA 1BBDL 1ZHBA 4CUCA 5JHLL 1U92A 5BJTB 1IC5L 3RJDA 2VIRA 3DUSA 2HMID 2VXSH 3VG0H 2DQJH 4XPHH 4U33A 1MCWW 4HS3A 5IEKA 4GRMA 1XF5A 2CUMA 2AI0H 1DE4B 3OXRB 4XCYB 2BOBB 1OY3B 4XXDA 3RVTD 1VFAA 4NM8L 4WY7H 5C0BA 1HH6A 4E42B 1NAML 3I50H 3UZEA 1JPGB 4H26B 3D39B 1RZ8B 3LH2L 3UO1L 1XF4B 4ZFOB 2KKQA 4NRZA 3T4YB 1S7WA 2J7LA 4BFEA 4M7LH 1IM3A 4UT6L 2HTLC 1KB5B 3JWDL 5DR5L 1AQDB 2CKBB 3GIVB 5EPMB 4EI5B 1CBVL 4K3JL 2B2XH 1RIUH 3B5HA 3N85L 5D7IE 3WFEH 1EHAA 5TFSH 1U58A 3LPWA 5BS0E 2QADC 3LKNB 5C0EB 4OAWA 4JG0L 1TDQA 4R7NA 1RZGB 4UT9H 5E2TL 5A2KH 3VD9A 4YNYB 4HCRL 5F1NB 4X5LA 3EOTH 2ATKA 3D3VB 1TZGH 3RI5K 5HI3C 4RISH 1D5XB 4UQ2B 5E99H 4R97C 2WBJD 3LQAH 1RIVL 4OZHE 5CGYD 2VNCA 3JBG7 2EIZB 3TBTB 2V9RA 1MF2H 1G7LA 4MD0A 2AXFA 1Z0NA 3P0GB 1K3ZA 5IFAH 1JWSA 1QKZL 3HAEH 3DRTA 5C9JB 2JCCB 3QIWD 3WE6A 4JY6B 4F8QA 4O9HH 3OAYH 4G6JL 3K7UA 1WZKA 4RGNB 1DVFC 4HPYH 1CU4H 2J88H 2YD3A 5ALBL 1EEZA 1R5IA 4OZFG 4TNWK 1EHNA 5DRWB 3FB7B 4MX7B 4HDIB 4TNVF 1S9WA 4G8EA 3FO9A 1ZHNB 1NCAL 1PSKL 4KK6C 3TWCL 2BNQB 3TJHD 5KSBE 4HQQH 5ICXA 1C8PA 2HKHH 2ZPKH 4MNGE 1D5BA 4JO2L 1UYWL 3WNKA 4I1NB 4JQXA 2WANA 1CGTA 5DGQA 1WQVT 3MRFA 1MH5B 3TVMA 5IBLD 3PHSA 3T0ED 4UILL 1HHHB 5FCUH 3H9SE 4TSAH 5EWIL 5D7LB 3PF2A 1ZEAL 2FH6A 1AP2B 4OT1H 3PWPA 2BJML 4XMKL 1AD0B 1BF2A 2X4UB 4I8DA 2YD1A 5AUMA 1P4IH 2H2SC 1VPOL 4WEBH 3QFJB 3DO3A 3FZUC 4APQD 3E8UL 2A6KB 3RQ3A 5IIEB 5EG6C 1LGVA 4NP4H 2XT1B 4GRLB 2C7UB 1ZT1B 4OZ4A 3G6AA 5C3LD 3ULSA 3R0MA 4X9BA 2XG4A 2DBLL 1DTUA 1F3DJ 3SE4A 5DWUH 4DGVL 2CXGA 3AS3A 4U1GC 4FTVA 3QJFA 4HZLB 4TUOA 3EO1A 3V7AG 5FDWA 4KV5E 5L2KA 5EZLB 4XI5C 3RZCC 2FX8H 4GXUN 4DEPB 3VXSE 3T0BA 3OBAA 1BJ8A 1OGTB 4PGBA 1AGDB 3KAAA 1KULA 4QRUA 1FV1B 2BXYA 1T3FB 2FR4A 1MCFA 1A1OA 2H8PA 3SY0B 2NZ9C 5C6PB 1FN4A 5IB1A 4OGZA 3EYOB 4ZUWB 3I02B 2IBBA 2GW5A 5SV3A 3H42L 2CRZA 2VXTH 3V6OA 1MCRA 3RWHA 3KPSE 5DRXA 3EYSH 3BVNB 1OVZA 2AJXH 5I15L 3L95B 3BEVB 4XXCA 5ANME 4YR6A 3MRIB 1I7UA 4MSWA 3UDWA 3KYKL 4WDIA 3VU2A 3QG6A 5BZDB 3P3YA 2HA1A 4PJFA 4YHKL 2C3XA 2E7HA 3WNPA 4AZ8A 3TN0B 4U0QB 2FB4L 4HFWA 3AB0C 1LO3L 1N59B 3VGBA 2ZUXA 3OKNA 5FM8A 2NY2B 1MFAH 4LK4A 1UM6L 1TQCC 4X98B 5JIHA 5EBMA 2P8MB 1I9RL 3LHPL 5DUBA 4DK3A 5K9JL 1RZJC 4F37K 3GI9L 4CDHA 1CE6A 2J8HA 3V4PL 2ZKHH 4MXVE 4NO5B 4WWKA 3ZHKA 1J8HA 1B0GB 3RU8H 1BVKA 1ZVSB 2PXYC 2MPAL 4AEEA 1XZ0B 1YEIH 5I74B 5HHOA 1VADA 1NGYB 1UVQB 4OCMC 5CEYB 1DQJB 3T65A 1C7SA 1FFRA 1QPPA 3AGVA 4O4YH 3GM8A 3HI5L 4JGUA 4P46A 3R8QA 5I8CB 4PG2A 5A3IC 1AY1H 4PRHA 1D3CA 4N1CA 5JW3L 4NKDA 1MIML 2NMSA 2VC2L 5TDOB 2R2CA 2VZTA 1F13A 3ARFC 4ELMF 3OG4B 2O93L 3VFUB 3QCVH 5MI0B 1CDHA 2FEDC 5IVXE 3NN8A 5FF6A 5CGYC 1R0AL 3KYMA 5A43C 2UYLA 4HIXH 3OJMB 1N0XH 3C8KA 1CYGA 3KPOA 4NUGL 4LNRA 4U3CA 3D5OF 5F7KC 3VDAA 3ARQA 3HG1B 3KR3L 4EN3C 1HXYB 2VN7A 5I1JH 3SDAA 4ZTOH 3RY5A 2V7NB 3GMMB 2YPLE 1CICD 5GHWL 1FDLL 3HC3L 4BZ1L 2NY0B 3DMMA 4ZXBC 4YEFA 2A6JA 5HHQA 3DURB 5AG8A 5D6CA 3QP3A 2JJVA 1CFTB 4CW1B 3EO0A 5FYJL 5KG9B 4TUKH 3B3IA 4AH2B 4R4FH 2DYPD 3IGAA 1HH9B 1UKTA 3X14A 3OJDA 1KNOB 2HWZL 5SWZE 3EO9H 4PRIA 2P5EE 2KPNA 1S7SB 1MIEH 3V52H 2PYEB 5EU4B 5AD0A 1YPZA 3H7LA 5D8JL 5HSFA 1DANU 3T0EC 5FO7A 4HWBH 3IXAA 3EFFA 3WDIA 3OPZL 1MJUL 4P48A 1NH6A 1FC1A 3MBXL 4JFYB 1V05A 3MRJA 1AD9A 2HFFB 2ATPB 5IV2B 3N06B 3L5XL 4WFGD 2ERJB 1T03L 3BH9B 4YFDB 3C08H 4M61B 4HEPG 4IDJH 1QLRA 3EOAB 3QNZA 3ALWA 5ID0A 5J8OA 4F33B 4M6ML 1XGRA 4OF6A 1H8SA 4PUBL 1DQML 3T0DA 5DA4A 3RVXC 5IMKB 2APXA 3UROR 3T0VA 2VDPL 2FHBA 3X11B 1MHCA 3IDMB 2F8VA 1LP9E 5DUML 1KUMA 3L5IA 4QOKA 3GBNL 4KU1A 4LPTA 5E1AA 1K85A 2W65B 1ZLSH 4GW5A 1FVEA 1XR9B 1I4FA 1DQQA 5FXCH 5FOJA 1HHJB 1A7RH 2W0LA 4J8RB 2NW2B 1I9JH 2V2XB 4Z77B 5FYJU 1HKLH 3BIKB 5F9AC 3OKEB 5D5ME 1FYTB 1N3NB 4UV7H 3C2AL 5DD3H 1DN0A 3QIBD 1D6VH 3ZE2E 4ZFGL 4QXUH 4OZIE 2AKRB 5CJ8A 5DQJB 3FFCA 1PX3A 1H15A 1G7HB 4RFNC 1IC7H 3P0YL 5HJ3B 5ITBL 4ZTPH 3EGSB 4JDZA 2FYYB 5ACZB 1MJ8H 3QXDB 2BNUB 2VLKA 5IK3A 5IFJA 2GEEA 4JM2A 2YK1L 3IXTB 3GMLA 3MODL 3ZT6A 1HXMA 3AY4C 1GIGL 5FK9A 3WUWG 3RGVD 3SQOH 1U8KA 2X1XR 4N0YH 2EXYC 1D7FA 1IGTB 1DBJH 1BZQK 1KF9B 3BWUC 4M43H 1SQ2N 2BVPA 2I07B 1TJGH 1QFHA 3MRCB 1A22B 3BD3A 2ZCKH 4F57H 1GGBH 4J4PD 4NZTH 4QNPF 4X4XA 1U95B 1OARH 3HNSL 1DLFL 4M9OA 2GI7A 3CUPB 3CK0L 3RWCB 2YPVH 3D0VB 3GSXB 4L4VD 1OAZH 3SE9H 4YXLL 4W4NA 2IPTH 4P4KB 1NBYB 1UH2A 3MUY1 4R3SA 5JOPE 2Z31C 2WZPD 4YAQA 5MENB 5F44A 3UJJL 2YRPA 3MTRA 2NXZC 1I8LC 3BGFB 1TVBB 1JJUA 3QO1B 5E9DD 2UZIL 4S1QH 5DUPH 3SKNA 1OTTD 5E6YA 3S4SG 3CSYB 3U0TB 5FKAB 1KJ2B 1LWRA 5C0GB 5D72L 4ZPTB 4M7ZB 4XCFH 2W91A 5SX5K 2VUOA 4PJGF 1PY9A 3QDJD 4NCC2 4D0BA 3SCMD 4Y19E 1CICC 4DZBB 2IMMA 5BRZD 2EYSA 2XQBH 3A67H 3AMKA 4NPYB 4CN1A 1JZ2A 4OIIH 3O4OC 5FGBC 5JHDA 5F1OB 3AS2A 3TO4D 3G5ZB 4KI5D 5H35A 4RGMB 5GS1B 5T1MB 1J5OH 3CC5A 3MA9L 4LPUA 4QRPE 1ZHKB 2ESVB 1U91A 5EU7E 2FATH 4JFZL 4BKLB 1T7WA 5ETUA 5FM5O 3BGMA 3MRRA 3IDXL 4CN6A 3UZVB 3B9VA 4U1HA 1YEHH 3TP4A 2PO6C 1FP5A 3KPLB 3GNML 3IFNH 4HJJL 2RCSH 2CR6A 4A2MA 5HD8C 1A7PL 3QDMB 1PLGL 3LCYA 4FQHB 1T20B 3O6MH 4G6KL 2QQQA 1NFDB 3MOAH 1A7NL 1NCCH 4CL7A 5ALCH 5GGSB 4JHWL 1P7HL 4Z7VB 4FZEL 5HHXH 1P6FA 1P1ZA 1S7TA 4LCYA 3BKJH 3QO0A 3N1QC 4MJ5B 2G5BA 2RR3A 3KPQA 4F7EA 1LE9A 2X4PB 4DCQA 5LXGL 3O3AB 4MD5B 1AR1C 1X5GA 3QXAB 1KIRA 3UTOA 2EH8H 4W6WB 1JF5A 1FFOB 4CN4A 4AMKL 1XIWA 5CCKL 1IM9A 3BPOC 1F00I 3KPRA 1WCQA 2A73B 5T1KB 2Z8SA 4PRAA 2F74B 5H8DA 3ARXA 2ZG2A 2R69H 3GMOA 1K2DA 1OGAE 4X7TB 2VO5A 1OW0C 1NC4A 3L3DB 5IEHB 3CZFA 1FC2D 2EDEA 4U6HB 1EO8H 1UJ3C 3LQZB 3UX9B 2PW2B 4R96B 1CFNB 2EDNA 4NQEE 4ODBD 3WL9A 4N9GB 4K94L 5FA3B 5DO2D 1G9NC 3V5DB 3MNZB 5K9QG 2AEWA 1FAIL 3BAEH 4GS7B 4QO1A 3ZDYE 1QSFE 4Y4KB 1B4JL 3GJFK 4L3CB 5F7UA 3M07A 3QI9A 4U4BA 1JPTL 2Y5TB 1T66D 3P0VL 3MZTA 2YD4A 3LN5A 1JFQH 4HC1A 1PEWA 3M1BB 1WUNT 4JFHD 5IHBA 1QLEL 1I3RA 5EUOF 4S11A 5KSUA 4P2QA 4M1CC 3B9EA 3LZFL 2YA1A 4Y16D 1H3PL 5T3XE 3VH8B 2PTVA 5D1QA 3LAFA 3KYNA 3DI3B 1FFPA 1S7RA 3MUZ1 5I30H 1QQDA 1CT8B 2LTQB 3BDYH 4JANB 4PV8B 1AH1A 1JGDB 3KPPA 3H6JA 3O8XB 3MLPA 1FH5L 2Z4QB 1T0NB 4S0SD 2P24B 4O2FB 1BX2A 3PIQB 1INQA 3SO5A 3DOSA 2Z35A 3HE6D 3FB8A 3HS0B 4BFIA 3NFSH 4CMMB 4AIZB 1NGXA 1HSBA 1UB5B 2J6EA 2YA2A 1INDL 1TVHA 4FFZH 5F1SA 3MV7B 3DGGA 4PBXA 3C5JA 3P9MA 1R3IL 4P2OB 4UOW1 3VXTA 1UG9A 5F96L 2B1HH 5HI5D 1L7TH 2OYPA 4GBXB 4U31A 4JFQB 1FLRL 4KPHL 4QF1B 4X4YB 2YRZA 1G6RH 1RZFL 1QFUL 1UC6A 1QG3A 1TZHB 3CLEH 4LGPB 5FHBL 4O02L 1I7ZA 3LKPA 5L8KB 3V8CA 1HNFA 5F3BA 1MPAL 3S34L 1IARB 2D03H 4PJ7B 5HBBA 4JFOB 4Y1AA 1DEDA 1U8PB 2WUCH 4LIQL 1G7JB 3MXVL 5DMKB 2P44B 3BZDA 2WSKA 3VWKA 5EZIH 4X99B 4HXBL 2NW3B 2DM2A 1CLZL 3ALPA 3DX9B 3MLZL 4KI5C 3NIDF 1C5BH 1PX4A 1ZXQA 3BQUD 5C09A 2I24N 1NLBL 3T0XA 1DBAH 4PJCF 5TQ2L 1ZA3A 2ZOKA 3ZHDA 2X09A 3CVIH 2I9TB 2YUZA 1B88A 5E5UB 3GMRB 1OAXL 4NC0B 1RK0B 1I1AD 3LOWA 1QR1A 3UCRA 1KPUB 2VABB 4OLVL 4UIKL 1R5VB 5E5MB 2VR4A 4C55A 4EUPG 4IOFD 5F7DA 2Q3ZA 2X7LA 5EFIA 2UWEF 1G7PA 3LKRA 2SEBA 5SX4I 3KYAA 1QRKA 5BS0D 5D1ZD 4LSTH 1Q9OA 4P23A 5GRUL 2CGRL 1MHHA 3GO1H 2D7PA 1QRNB 1KPRB 5L7XL 1P7KB 5CP7B 1FNAA 3MV9E 4L8SB 3V0WH 1HI6A 1EAJA 2KQNA 1B2WL 4F7PA 5JW4M 1T83A 1DR9A 4PJEA 1IAOB 4JCMA 1T1ZB 5DC9B 1T5WA 1CXIA 3HMWH 3W9EA 3VFWB 3G5XA 1T1WA 1FNGB 2BVOB 4FN0A 3VD3A 3LRSA 3WSQH 2FH8A 1S7VB 4YHPB 1RHHB 2CKNA 2IEPA 4KK5D 5DJ2A 2ZSVA 1B90A 1VGKB 2DMBA 4JPVH 4M5ZH 2OR9H 3JVGA 3PJSB 4P5MA 5DJAB 2XXMB 1KJ3H 1KCSH 3VCLA 5T33H 2HFEA 4G5ZH 2RIKA 4XNXH 3WS3B 2BY2A 3JSSA 5C0DB 4WUKL 1KIQA 3DVFA 3L5JA 4EI6A 3O4LE 4RX4D 5EOQL 5JPNA 3BJLA 1MY5A 3FQUA 1N6QL 5SWQB 3WEXA 1MLCB 4NYLA 43CAA 5DMJB 2FJHB 1FGNL 4X9FA 4N8CH 4DW2H 3CFBB 1ZSDB 3CFKB 3IFPA 2CIKA 3C6SA 1DBMH 4KUZL 1KG0B 2HVKA 3P11L 1P4LA 2HVJB 3HE7C 4S1RL 1U92B 3LMJL 3DO7A 1IAIH 2VIRB 1C08A 1H0DA 3VJ6B 4M6OL 2YC1A 1OSPL 3H9SD 5FO9A 5ECJE 4EXKA 1XF5B 2XQYK 3OB8A 3AFLA 1LO2H 2IJ0C 1TTUA 5KVDH 2VXVH 3ULVE 4LPYA 4OZFA 2YEZB 4C56E 2GK0A 2VR9A 4Y16C 5HGGS 2GITB 1PDKA 3G9VA 5FDYA 4JHAH 2B5IC 3MJGX 2L7JA 5I1GL 5D2LE 4PP1C 5T3XH 5DMIH 2V2WB 3TPKA 2ARJQ 4LHQB 3LDBB 4QWWD 5LAXA 3IJSB 2YD8A 4M7KL 1DQLH 3TBYA 1AKJD 3L3OB 4GO6B 3MJ6A 1ZTXH 3D85A 1GZPA 4F2MB 1NSNH 3VXSD 3MXWL 3TA3B 1U58B 2NY6B 3KJ4B 5D4QA 4OD3H 4MXWH 4NNYA 1QFWH 4G8GE 5JXED 3UTZB 1FIGL 5FM4A 1GZQA 4JN2B 2R39A 1NCWL 1J7VR 1CD9B 1WC7A 3FL7A 1F11A 4JDVA 2AV7A 4LCWA 5I8KH 5E2WH 5C0BE 2QSCL 1M71B 1S5HA 5HI5C 2ITCA 5ID1A 1MFNA 3PQYA 3KPSD 5CD3B 4NT6A 2AXFB 3VFPB 3MRPB 4AEHL 1KTLA 3BRGC 1OOAA 1KLUA 1JWSB 4JRYA 5JQHC 3T0AA 4QRTA 5HDQL 4ERSH 3PWJA 1RUQL 3WFCH 1JL8A 4TVPE 3IJYA 1MREL 2G60L 4NNXA 2AEPL 1EEZB 4OUOA 1MAJA 3DIFB 3VD5A 3OHXB 2JJSA 3O3BB 2YXMA 5HHPB 3GZKA 4XMPL 1XMWA 3BUYB 1I1AC 1IEAA 4LOUD 1AHWA 3O6KH 4DAGL 2W92A 2J12B 1BOGA 3ZHLA 3PDGA 1NUDA 4Y2DC 1IEBB 5E8EA 1YQVL 4PRNA 2EDWA 4DKEL 4TQEL 4F7MB 2OL3L 1UCBH 3QXVA 4OF8A 3M8OL 3CVHA 4WW1A 3RP1A 2VR5A 3DROA 3RHWK 1C5CH 2CUIA 2C4XA 5D1ZC 1FGVH 4ELMA 3PWPB 4RAVA 3LPFA 3MRLB 1FPTL 4QGYA 4MXQD 2X4NA 2B8OT 2BSTB 2GJ6A 3QUKA 4GT7A 1VESA 5ESVB 3QXTA 3FQXB 1UH3A 3V5KA 3U36A 1J10A 3QA3B 3BPCA 4FP8L 25C8H 4NN5C 3FQRA 4G9FB 5J11B 1BMGA 5ISZE 1T22A 5HPMA 1WEJL 4WI3A 2R0KH 2D7TH 5C07E 5C6WH 2AJSH 1NJ9B 2YPLD 5HTSA 4IHOA 4Q0XL 5JORB 2X10A 2NY4D 3OTTA 1F4XL 2HT4D 2IH3A 4NJ9H 1FRGH 1YDPA 4KVNH 1TCMA 4N0CC 4N68A 5C0JB 2DM3A 3I84A 1YN7A 5EC1A 4NN6B 2J8UE 2YZ8A 4HWZB 1BM3L 1CXKA 1MCSA 4LAQH 3R06A 2A6IB 2O5XL 2JE8A 5E6IB 1FN4B 4E41B 3NFPA 2X9YA 3TPUB 3RDTC 1B6UA 4I77H 4PB0H 2WK2A 3MNVB 1RJYA 1AXTL 1KN4H 3UMTA 5IFHH 3RWHB 1A9BA 1XGPB 3GMNA 1JP5A 5SWZD 2P5ED 3WS6C 5CBEB 2F58H 1MRFL 1RZKH 32C2B 4OLZH 5JPMA 1NFIB 1WWAX 4Z7WE 4AG4H 4B50A 1QZ1A 3PP4L 5MHSE 2FO1A 4D0DA 4LHUD 3KPNA 2IBZX 4WW2C 4MSWB 5L2KE 4NQVB 1XGQA 4LLDB 4ZNEA 5EORH 2NYYD 1MWAB 1IGYA 2ADGB 3ARSA 3HCVB 5C0CB 1MAML 3ES6A 3G6JE 1A14L 4HXAL 5F89B 4RWYL 2ED9A 2G9HA 4U0RB 3SDXF 4XCEB 1XEDA 1P7QB 3QPQC 3UBXB 3ULVH 5A40E 3E6HA 3OKNB 4HIIB 3O2VL 3FKUS 5CAYB 4MNQA 3IDNA 4NRXB 1VEOA 4JRXA 4JAMB 3ZDXE 3ARFB 3MJ7A 2BY1A 3MA7B 1BQLH 1MCCA 1P5UA 4LEXH 2EXWD 1BVKB 3QHTC 2Y36L 1T0MA 4E9LA 2D7MA 3QJHB 3UBXI 1YYMH 3QB7C 1A1NA 5F8RC 2MSPA 3QFDB 3U9UB 4N0UE 3T65B 1PKQA 3BPLB 4EN3B 4JQVA 4E0RA 2F15A 3MRDB 4PJFE 3BDXA 5IBUG 1MRCL 3WHE1 3QZWG 4GW1A 5ESQB 4ZXBB 4XNQB 2I26N 1XGTA 2F19H 4ZUTB 3SDCA 1DDHA 2MTPA 3W2DL 4GKNB 4LLQA 4IMKC 3FONB 3JWOH 5FEBA 3TCLB 4ZFZA 4K94C 5MERA 4LQFL 2UYLB 3WXVL 1U2CA 1V3LA 1YUHA 4XNYH 2XWTA 4L3EA 5BMFL 1I1YA 5EU6A 3T3ME 4RMUA 4EIZC 1K4DB 4Z7UF 1HCVA 3SDAB 1X5FA 2BFVL 4GG6F 5DZLA 1Z9MA 2GKIA 4GAGH 2DLHA 1NL0L 4LPCA 2EO1A 3RPKA 4H88H 2A6JB 5HHQB 4TVPH 3PE9A 1RJZB 4KI5F 1KB9K 3NZHL 3O6FD 4Z95H 3VXRE 4PRHE 4AL8H 2EYRA 4GUPB 2JB6B 1TETL 4HBCH 2FD6L 4HHAA 3T8XA 1BQSA 1N5AA 1CTNA 4KZEL 3GSQA 1YEDB 3X14B 4PLJD 1JZ4A 2OK0L 4GH7B 4GMTL 5FO7B 5GGVL 5CUSL 2QTEA 3PDOA 4NM4H 15C8H 2A38A 4BH8B 3WNMA 2ADJB 3THML 3GIZL 3LEXB 3MRJB 1VFBB 1A4KB 3GJEA 1GGCH 5I75B 4P3DA 5JOPD 3EOBA 4UV4L 1N6UA 3R0NA 1QLRB 1BIIA 4OZGF 3ROLB 3RWIB 3PGDA 2ID5A 4KRLB 3RIAF 4MCZA 3WUWA 3V79C 3HN3A 1A3RL 4BQCA 4PJGA 4XBPB 1P2CB 1XGRB 4JFFB 4JZNB 4NQCA 3C60B 4QCIB 4RMWA 3JZ7A 3H7BA 4MZ3A 3JUZA 1RUAL 3ARBC 5TE6H 1MQKL 1C5DB 4DOHB 4IJ3C 4H1LB 1Z2KA 3TIEB 2DJ4A 5CGMA 1MHCB 4Y19D 5I9QB 4LVEA 2HT4C 1P5VA 3D39E 5B39G 5E1AB 1YEKL 3PV6A 3AC0A 4HUUA 5E8OA 2ZJSH 4K07A 3MLRH 1ETZA 4KVCL 5ACMA 4KRMB 1FVEB 4OLWL 1RU9L 5HHME 5TE4H 2ZUQC 1E27A 5DHVB 1KLGA 5I16A 4QRPD 5F9JA 1J0IA 3LEYL 3NIGF 4P57B 3VFTA 5DEGB 4KMLB 1MUJA 4WV1C 3OWEA 4HK3N 5K33A 1R3KB 3S4SA 5HVHB 4AJ0A 4XAKE 5CJBA 1CR9H 5CIPB 3D3VE 4HX1A 4LDEB 5KSAA 4QYOA 5FUCC 2X05A 5ESAA 2ZUUA 4ORGB 1BFVL 4RMRA 4X6CF 2E8YA 3DVGA 4HUXA 5T1DL 1FYHB 4F7TB 4JDZB 3VI4F 1DUZB 4Z78A 3ULUD 4GRWH 1Z5LA 4GKZA 2CIIB 4OQTA 2ZCHL 1E4KC 1OCWH 5F7LB 4DJMA 5FK9B 5C0RH 3FCTB 2JCCE 2X4TA 1CXFA 4NZUL 2C4FT 1IBGL 5TF1H 3ZE1F 4NKIL 4MGXA 2Z31B 3K1DA 2FEEL 4RGNE 3RZCA 2AXGA 3U2SB 1AGBB 1J1OH 3BKYH 2NXZB 2AJUH 2IBGA 4LLAA 5AWNL 5TQ0L 1VACA 3RIFF 4U1MB 4X4XB 3FFCE 4P2RB 3QUZD 5FOBB 2C3VB 4ZG1A 4I48A 4JPWH 4PJXF 1AE6H 5GS0L 4KHTH 1OGAD 4LCUA 3V0VB 3FMGH 4XB8A 4HIJA 3NPSB 1TIUA 3ARVA 4G8FB 3RKDD 3E6FA 2VXUL 4R4ND 1GC1L 1ZOXA 4WI8A 1DUYB 4LARL 4Z0XB 3B2UD 3UC0L 4ODTL 2WIIB 3L3GA 4NQED 3CX5J 4RAUB 4DTGH 1SM3L 5J9PA 5EZJB 1BFSA 4S2SB 3C5ZD 3NCMA 4NHUA 5EOCJ 4QRRA 5C6TL 1QSFD 1KCLA 4NO0B 1OP5H 4UOJA 3RWGA 4MJ2A 1YEJL 1VB9A 4CNIB 1R6VA 3MRHA 1OL0A 5DJDB 1DJSA 2NTSP 2QQKL 4D0BB 2NR6C 4G80A 1MCOL 1H5BC 4OCXH 3WDJA 1XH3A 1Z3GL 3QWOB 5CILH 2VLME 3NCCB 5JHDB 3C09B 4M03A 2CK0H 4YHNA 5H35B 4QHUA 1CGSH 3ARTA 3C9NA 4X5XA 2A6DA 5T3XD 3WFDL 3WDHA 5TE7L 5L8JB 4JQIL 3D18B 3D1MC 3U4AA 1KXTB 4ZQKA 1W0VA 3F7YA 5GGRY 3HA0A 5E8PB 2DQEL 1N64H 5I1LB 3BP4B 4NFDA 3W5NA 1F4HA 3GKWH 2OX5A 3ARZA 1Q72L 3MROA 4HIHB 4TOYH 3L3HA 2R23B 5DJXA 3WFEL 1FFNA 3LB6D 1N26A 2R2BB 1DFBL 2IQ9H 3PGCA 2XACC 1S7TB 2RBLA 4XCNB 5D1XD 3DRQB 4YXHL 3F6IA 3RBGA 4YX2H 1OP3H 1YN6A 2YWYA 1JN6B 2ZSWB 1LO4L 4JDTH 4OZHF 2YHGA 1EX0A 3QIWA 4YGVA 3OR7B 4AT6A 4OM0L 4M3JA 3KPRB 1ZA6B 1OT2A 4I0PC 3VFVA 5J89A 2EDRA 3D25A 2VERN 5LGHL 4PRAB 1MFEH 1ZAGA 2Y06H 1LD9A 3LEVL 5IFAL 5DD0H 1UXSB 2VLLB 5IVZA 5L9DL 1F5WA 4PJCA 1K2DB 3TT1L 4JKLA 2W60B 1EUTA 4XC3L 1BPVA 3E1F1 4XC1H 5ITFB 3BZFA 4KC3B 1FNHA 4BQ8A 4C54A 5FECA 3DI2B 3KWWA 5F6HJ 4MD4A 1KB5H 5EU7C 3NACL 4WU5B 5KSBF 2CKBH 2UWEA 3BKCL 3T0EA 2YBRB 1EZVX 3SDXB 3FTGB 5DK0A 1FO0A 2DIBA 1YECL 4KHXH 5ENWA 3STZA 1RJCA 2P42B 4CU7A 5ICYB 5CJOH 5CMAB 2ZPKL 1ZLVH 1IAMA 3L6FA 3ZKQD 2OP4H 3MFFB 1EBPA 5GSVB 2DI8A 2ICEA 3GSUA 2P48B 4YHMH 4MAYC 3VMOA 5F71A 4KUCD 3LS5H 1EAPA 1AGCA 4I3RL 4WW2F 2X4QA 4APQA 3LN5B 3PL6D 4P9MH 1X7QA 2VYRE 4JG1L 3OZ9H 4HG4K 2DQIL 1KJMA 3CXHK 4YPGA 4J3TA 3V5HB 1F6AA 5JW5A 2BNRE 4P3CL 1YJDH 3HG1E 4UTBH 3QUXC 3MV9D 4X5WB 2IH1B 1QSZA 3VA6A 3VGFA 4NO3B 1SMAA 5ABDE 4FRWA 5L6YL 4P9HC 5KOMC 2A0LC 2FIKB 2X40A 1HWHB 3V6ZA 4PTTA 1GAFH 5F1KC 3QSKB 2Q7YA 1EFXD 4FQLL 2W0FB 4LSPL 3DSNA 4KV5F 4N90E 2PN5A 4KH2A 1WTGT 4EUPA 1RUPL 4IS6B 3ZL4H 1JZ7A 4Q9RH 3DARA 4BK5A 3LV3A 2FX8L 1GGIH 4TRPL 4MQ7B 3FB8B 5I1EH 2XFXB 1JCKA 3FT4B 1OQXA 1UQSB 5I1CH 3RWEA 3GGWA 5FKPA 3O4LD 2PYEE 2X4OA 4ONFL 5F1IB 3S36L 1CFBA 3B2UC 2J5LB 3K80A 3NCYP 4ZOAA 4JCLA 5EUKA 4M93C 5I17B 3VXTB 2NY1C 3QIUB 4QHMB 5D70H 4NKQB 3WLWD 3U7WH 1QYGL 2CDFB 4K2UL 2VXTL 4POUB 3U30C 1Q0YH 4V2BA 1S9VB 3S97C 2MQ0A 4NGHH 5TDNB 3EHBD 2FX7H 2KBGA 3AY4A 1ADQH 3WIHA 2M1KA 3A6BH 1FL5A 4YHYB 4ODVH 1W72A 3CJJA 3BRDA 1KEGL 3LKSA 2PW1A 1RZIA 3ULVD 3KNBB 4C56D 2BCKA 1K8DB 1I85C 2VAAB 2EDYA 3HRPA 4UAOC 1NLDL 2FCBA 4U1KB 3ZKNC 1G1YA 1NGQH 2A9MH 3DX8A 4TULL 1H3GA 2R0WH 3HR5A 1BD2E 4O2EA 1IEHA 1GVIA 5AEAA 1A9EB 4BZYA 3C6LD 2CSPA 1IQDB 1KIPB 1J0KA 4MYWB 5F9OL 3LIZH 3PHQB 1CXLA 1K5NA 1NCDH 3H9HA 4MDJB 5GJSH 3G9AB 4F9LC 4U1IB 3SDDD 1FORL 1CE1H 1FYTE 4G8GD 4FHBD 1I8LA 3O81A 4JO3H 3LB6C 1YMMB 4WU7A 3MO1A 1MHHB 1LO5A 2OMNA 4I0KA 3TFKC 3TYFB 1L6ZA 5IQ7H 4R7DA 1C16A 5C0BD 2YRLA 2GJJA 2VDQL 4HKXA 1BFOA 4LHUG 4PJDB 4PJEB 5IVXF 1M7IB 1FZMB 3X13A 4EIGB 4WO4D 4I3GA 4U1JA 4N1EA 1CICA 3WNNA 5ACLA 4HK0A 1FSKC 5I1AB 3W9DA 4GSDL 4C83A 3KXFA 1HSAA 5FGBA 5SV4A 4P5MB 3TNNA 1TJHH 4Z0BH 4LKCA 1QD0A 3Q48A 4XWGL 4HMDA 1Y18B 4TVPD 5IB5A 2WLZA 1T04B 4K71C 1KIQB 2VISB 3BZ4A 1PY4A 3CFJA 5FYLL 2CLVA 1CFVH 1UWXH 4WTZG 5JPNB 4EOWH 3FQUB 4RFOH 1OP9A 3MGTA 4NOFA 4NYLB 1YNTB 1FL3A 4ODUB 4QTIL 1ZANL 2XZZA 3TJEH 2VN4A 4HS8L 7CGTA 1CK0H 1J88A 2B5IB 1F3RB 1TCRA 3BFOA 4LSRH 2R1XB 2DLFH 5MENE 3VGHA 5M95B 4Y8DC 4PJ9B 1T4KA 4UU9B 4NRYA 4LNVA 5INDA 4KRPB 1F4AA 3DHJA 4D0CB 2VKXA 5DVOA 3D9AH 4HF5H 5DFWH 3BMWA 2DQCH 3RI5F 1T5XB 2AEQH 4JJHA 1K4CA 1S78D 3BZEA 3RWFA 3HI6L 2W07A 3IJHB 4LPXA 3EOYG 1FZKA 3CMOH 3FB5A 4P0DA 5ISZD 1CD0A 1U41A 3EYFB 4K23L 3MCG1 2ESVE 5C07D 2VDLL 1GZPB 2CPCA 4GMSL 5E2UH 3NFNA 1RUKL 2FRGP 2XNAB 3L7FB 5DJCB 4TNWF 4XP4L 3BW9A 3MJ9L 2WBKA 1F3DH 5EOTA 4CU6A 4IRZL 2G2RB 4PJIB 4Z76B 4X4ME 4LSUL 5FB8B 4M1DH 3LN4B 5D7JD 3IDGB 4A6YB 4ZO8A 5E00A 3QPXH 3QDME 5TPWL 1HCFX 1ZLSL 5IM7A 4JDVB 4IRSB 5B3JF 4DQOH 3IU4H 1Q8MA 5D5MF 1INEH 1S5HB 4L1DA 4QHKI 1WTLA 3WLWC 3MLVH 4OSUL 3CFDA 3PP3H 3LS4L 3N9GL 3W82A 2HG5B 2GT9B 2E27H 4H8WH 4KTEH 5MHSD 1UB6B 5I6XC 4JFXB 5JOFA 5L2KD 4JRYB 3DV4A 1EDQA 3RGVA 1F4YH 4YGAB 3PWJB 5DRZA 4RZCA 4AM0B 3QQNA 3IJYB 4KJPD 3P4OB 3IDUA 4HT1H 5CP3A 1PKOA 5FV1L 3ZT7A 1ND0B 2J6EH 2QLVB 4J4PA 5B3NA 4N8VB 3MYJB 4FXGB 4PY7B 5IW6A 5DRNB 2CXKA 3WO4C 2X6MA 4E5XA 1IAKB 4JKPH 1D5ZA 5FV2A 2IANE 3F58L 1AXIB 2DQTH 2VQ1B 1BOGB 4L4VA 2V6HA 4KROD 2R2EA 4UBDD 3K4DA 1GYAA 5KAQG 4XPFL 3CFEB 1QO3B 5E8EB 3TNMB 1KYOJ 1NEZB 1QFWM 4PJ5A 3T2QA 1NQBA 3SDDC 4NC2B 4WW1B 1I8IA 3DROB 1PVHA 4YBQD 5DSCB 2ILLA 4K3DH 5GS0C 2YPVL 4UNTA 5E9DA 5EBWA 2H2PD 1A7QH 2H32B 1OAYL 5K9OA 2R4RH 4OLYL 1GC1C 3JTTA 1N4XH 1JHLH 2GJ6B 3NMEA 3QDJA 4KDVA 4BA8A 4Z7UA 3SCMA 4ISVB 3ZT5A 1JWUA 5I8EA 3MRBA 4GG6A 5BRZA 3NIFF 4WWKD 1D9KB 1U3YA 2HJFA 3C5SA 3RDTB 1KCRH 5HDBF 3TO4A 3FT3B 2G75A 4L8CB 4TSCH 2AJVH 4GXVL 4YHZL 3VFNA 2IGFL 1TLKA 4ZO6A 1BBJB 4DKDC 3HPLB 2OJZH 5KAQF 2WM0A 5KSVA 3A67L 4MVBD 4PRHD 1KCUH 3UEZA 1JYXA 5I1DA 3WD5L 4G42B 4KJYA 4WHTA 3QZWA 5J4MA 1DQTA 4NO2B 3INUL 2JIXB 4RQQA 5E70A 3BE1L 3CDFA 1FVDB 4F37F 4F3FA 4HAGA 2EEBA 4R6UA 1CDBA 4R2GC 3TO2A 4OCSH 1CXEA 1WV7T 1J1PH 3KLAA 2QHRL 4KQ3L 1A9BB 4TSBL 2I25N 3CCHB 3MV7E 3P2TA 4N0RA 4PRPB 5JA8B 3VW3L 4Z18A 5JLZA 1UT9A 2AJYL 2C3WA 2EE3A 3GRWH 3L5WB 3WJLC 4DVRH 4OZGA 1N5YL 5K59F 3QRFM 3H0TA 4BUHA 1IGYB 1TPXB 3PHOA 1OB1B 4EJ1C 2JJWA 2XIDA 1IQWH 1NCCL 2R0ZL 3AREB 3U6RA 3VFSB 2D0FA 4MLSA 3PDDA 3RUGB 2Z0BA 3IDNB 1O7VA 4I3SL 3REWA 5E94B 2ICWJ 5CEXA 1LEKA 2X4RB 5J6GA 3V8OA 2BSED 5FUOH 4FQ1L 4MQXC 4TVSa 3SJVA 1CL7I 3EUUA 2IF7A 3TBVA 4P5TB 1RIHL 2HJLB 4F7CA 1GCFA 3OGCB 5E03A 2DQFA 3D39D 3GSRA 5C0AA 4ZNEE 4B41A 2KZWA 1A3LL 4XVUC 4E0RB 3NA9H 5D7JC 5IKCA 1YYLH 5HHMD 5IF0B 3IDJB 4ZAKC 3HE7A 4HH8A 3EYQC 4G43B 4EBQL 1EO8L 2V9TA 2AVGA 1RI8A 1DDHB 3LSOA 1S7UB 3ZDYF 2VH5H 1FAKT 4X6CA 1QRNE 5MERB 2APWA 4JRXE 4KJQD 1LDPL 1U8OB 2BSRA 3VXUE 1E6JH 1YUHB 2FZ3B 2XWTB 4XAKD 5AZEL 1I1YB 3D3VD 5EU6B 3BP5B 3ARGB 3QDAA 4Y16A 5EO1A 4HUWB 4DN3L 3DVIA 2ZOLA 3CZJA 5GGTH 1A5FL 3NVQA 5B39A 3PUCA 1RVFL 2D0GA 2NY3B 3WFHA 1G0YR 1LE5B 3IAQA 4HHAB 3OKOA 1U8LB 3OG6B 4LEOA 4RGND 4U2YA 1E0OB 3SO3B 4XNUL 1I7RB 2OS7A 4DVBB 2J4WH 3WNOA 5C08B 4GAJH 5EU5A 1JNNL 2AQ2A 2WP3O 4LP4A 5SWSA 1BF8A 3QR2A 5H2BB 3FFCD 4YXKL 5DI8B 2IFFL 3D2UB 3GI8H 1NMCB 1V7NH 3DXAB 4IRJC 1V7MH 3PDOB 4LBEA 4YBQC 1A6TB 4QHNA 1KXQE 3QQ4B 1CG9B 5JIKA 4UINL 1HWGB 2B0SL 4MJIB 4YDKL 3FQNA 4FQQB 4KK8C 2DOCA 4MA8L 4NQTA 4ZSOA 3GHEH 3NFSL 4JFEB 43C9A 1KC5L 1Q94B 2V2TA 3MR9A 1U8IB 4QNPE 3WNLA 2ZUQB 3Q6GH 2XWBA 1K3IA 2VZVA 4NQCB 2MCPL 1UACH 1G9ML 4QHLB 5DDHB 2OR8A 3H7BB 4WCYH 4Y4FB 3B5GA 1LEIB 1FG2A 4WV1B 3E3QE 4NNPL 5E0QA 1X6LA 5J6HA 1G7QA 5DD5H 2VQUA 3CH1A 2QR0B 4PTUA 4KKLD 4F15B 3CVHH 4TUJB 4X6BB 5GIRA 3HFMH 1I1AA 2VLMD 4K3EL 4B7IA 4MVBC 4ZS7L 4FFYH 4MAUL 3HZYA 2LU4A 1MI5A 2XTJB 5HYQB 2Y6SC 2QKIA 4JFPB 1XF1A 3GMQB 4GKSB 3SKOB 3IKCA 4XP6H 4XBGA 4UOW0 3VFTB 5D7IA 3SEPA 1A1MB 1MUJB 1JI1A 1DBKH 3HZKB 1GPOH 1JMZA 2P5WB 5BS0A 1NBZB 5D1ZA 3LD8B 1B3JA 3EJYD 5IVOA 4KUCF 4EZMA 4I18C 5HGDA 5I2IA 1N8ZB 5KSAB 4IOIA 1KJ2L 3HMXL 3VGEA 4HUXB 3QH3A 1VERA 3QQ3B 5CD5D 3RRQA 2VL4A 5B4MC 4PJHB 4Z78B 3RY4A 1KCVH 4OZHA 2FJGA 2FX9H 3K2UL 3V4VH 5J56B 1IKFH 1BEYL 1OD7A 4UZGA 2IAMB 4O58H 1KGCE 2EICA 3CSGA 2VE6A 3MLWL 4R8WL 1PZ5B 4XGZA 3LKQA 1EEYA 4ZPVB 1YY8B 1A0QH 3VWJC 3QEQB 1U8MA 1SBSH 3TN0D 3WLBB 5E24E 1WWCA 3U4BL 3TV3L 4K8RH 4ONGH 3WSQL 4GFTB 2FSEA 4RX4A 5DLML 1A6UH 3RTQB 4OGXH 5CLWA 4GLRI 5MEQB 3O2DH 4L8BB 1JGUL 4I5BA 5K9KB 2H1PH 5KSBA 4G3YL 1MCHA 4ELKA 2DQUH 4MNGA 3UYRH 4AK1A 3QHFH 1H5BB 1L7IL 4EI5C 2ED8A 3MSPA 3WS6A 4HWBA 2FECL 4OLUH 3G5VA 5KW9H 1JUFB 4P3WA 3DBXA 3BT2L 3H9SA 5DEZA 2DWDA 5J9PB 4L9LA 4WW2A 4GAYA 4KJQC 4OGYH 3CX2A 3RWGB 1MQ8A 4TPRL 5I1HH 5EU3B 3I6KA 5IG7A 2ZUSA 2C3GA 1XF3A 5KTEL 1JRHH 1NC2D 4XVSH 3HC4L 3EYVB 3MLSH 3KPMA 3FOMB 4XP1H 4Y0GA 2EKSA 5B8CB 2MHAB 2GTZA 4TN9A 5E8DH 4M7JH 4G9FE 2BNRD 3HG1D 4MWFA 1BECA 4M48H 5L2JA 2D31A 2VXVL 4L8DB 4M5YL 4X5XB 5D2LF 1N6VA 4JHZA 3F12B 1AKJA 4UQ3A 4RGNC 4XPAL 2NY0D 4JHAL 2DAVA 3VXSA 3MOBH 4KKCD 4X6EA 4QRRE 5DMIL 5TH2A 1AJ7L 3ZTNL 5HYFA 1ZWIA 4N90D 4LDOB 1MFBL 2BX5A 2BRRH 5IMLB 1DQLL 3KYOB 3G6DL 4E41E 5EUOE 1IGIL 2VLJB 4NHCL 5JW4Q 4L4TB 4OJFL 2OTWA 4KY1H 5BVJA 3BJ91 4V2CB 3MV8B 2WBJB 5KN5A 1NANI 1SEQL 2PYED 4IMKA 1MVUB 3KPSA 1PJ9A 3STLB 2R4SL 4P4RA 3MNWB 4Q2ZB 4XPTH 4UUJA 2BDNH 5I8KL 3R1GL 4EDWH 5E2VL 1RULH 4F58H 1BZ9B 5C0CE 5D1QD 2AS5M 3WFBL 1FNSH 1QLFB 4J3VA 1RURH 3QEHB 1CXHA 3BSZL 1VGEH 1WBZB 1FZJA 1WSST 1EGJL 3VFVB 4GRLC 2DDQL 5L88H 5GJTH 3IETB 1Q1JL 4XVTL 5DK2A 3VE0A 2BXZA 1R5WA 3T2PA 1O5DT 3Q3GB 3EJZC 2J1KA 1HYRC 2OL3B 1HQ4B 1DQDH 2EE9A 5JR1H 2BRQA 5GGVY 4DEPC 1SY6L 3L1OH 3KWWB 4KXZI 5KVFH 3LKOA 4XPGL 4CADB 2Y7QA 2CRMA 2F54E 3FN0L 1JK8B 1BD2D 1V3JA 4LLVA 5C2BH 4KTDH 3QUMH 4ZUSA 5IHZB 5DK0B 2EH7H 1DP0A 2GJZA 3STZB 3EJYC 3RVUC 5GZOC 4LKXA 3DYMA 2ICEB 5T5FL 3FN9A 2IG2L 3BD4A 5CSZB 4Y1AD 1FYTD 3ULUE 1S3KL 3FT2A 4APQB 3KDMB 3MV11 5CD5C 5T1LA 4H5SA 3VGGA 5IVXA 3N0PB 1FBIH 3E0GA 1UCTA 1T89C 3ARBA 3SGEH 3TZVC 1EJOL 3TYGL 2AAVA 2YPLA 1F45A 2W9EL 1JWMA 3TN0C 4M93B 4X6DB 5DYOB 4LSSH 1A7OL 3RL2A 1BVLA 1GOGA 4R0LC 5GXBB 3FOLB 2NY2C 2FBOJ 3K8MA 2CLZA 2Z93B 5LG1A 4G8IA 1WIOA 1D5MB 2R0KL 3L3IA 4HLJA 3ZTJG 2AJSL 1GGTA 1ZGLB 1KEMH 4HPOL 4WTXA 4POZD 2J8UF 3HUJB 4QXTA 1L0QA 2VDOL 2X4OB 5SWZA 5JXAH 2P5EA 1BGXH 5CZVL 1EEUA 1LILA 5IQ9B 5JNYB 2O5YH 4LHUA 3GSNL 2MQCA 4JPIB 4JN1H 4B0MM 3X12A 1YC7A 1ITCA 1FCGA 2XA8H 1KN4L 4J3UA 5IR1B 4Z7WF 1UEYA 5MEND 4CVUA 2H9GB 4AENA 2HJKB 4G6MH 1RZKL 2IPKA 2Q7NA 2IADA 2ICWA 3GM0A 3U46A 5CLTA 4NQUA 2YPKA 2C4FU 4JFFE 4U1LA 4ZS6D 3JXAA 3S5LG 3G6JF 3LKSB 4DOHE 4NCC1 5CS7A 3DECA 1HZHH 3CU7A 3O45A 1QPXA 1MJ7L 5JW4N 4WTZA 1F3JA 5CJXC 2XQYG 1B6DA 4DN4H 3ZDXF 3MV01 3VA2C 4GJTB 1LP9A 4WNQA 5HI4C 5FO8B 2CO6B 3AMLA 2C3HA 2ZZUT 4NJAL 4X6FA 2AABL 3DX7A 4I2XB 4OV5B 4FABH 2CRYA 3B9DA 12E8H 3S3SA 1BQLL 5DT1L 3PWVB 3RWDB 2ESVD 4R90L 3MLXL 5DFTA 3UTQA 5DXWA 1F4WL 1X9QA 3FFDA 4MS8C 3VXNB 1NMAH 2VLRB 1F58L 3UJIH 3PWNA 4PG9A 1KFAH 5D5MA 1CDYA 3SGKA 3QG7H 1JV5A 1FL6A 3QDMD 2WAHA 1CLYL 1ERNA 1QTYT 3ZKXB 2NTFA 3QULA 1X5AA 1RZJH 5HYSG 2Q8BL 4UIMA 2ERJC 4YDLC 4PJAF 4U6XA 2WUBH 3V4UL 3PGFH 4HK0B 4C83B 1NFKA 2GAZB 3O6FA 2XRAL 3D85D 4L5FL 4ZOEA 5BZWB 2A9NL 3P4NA 1URLA 2DTML 1KENL 4JB9L 2DYPB 4MDIB 3MBED 4X9GA 5D2NC 4FZ8H 5T1KD 1OTSD 2A74A 4P2RE 3L9RA 4LGSB 4OLXL 2HTKD 2IQAB 1SHMA 1SJEB 5DEFB 4HBCL 4YFLI 4D3CL 1QBLL 1QNZH 2ZCLL 3RA7L 2IAND 1ZLUK 3GDBA 35C8H 3NCJL 4HJ0C 1P69B 2VZUA 1TCRB 3K74B 4MLIA 4U7SA 2FGWL 3PABA 2YS4A 1ZHLB 2I60L 3KXFE 4NRYB 2A2QT 5C2UB 1X5HA 3RJQB 2XWJA 1UZ8B 2C5DC 3I3DA 5EO9A 1DSFH 2E9BA 1Y0LB 1G6RA 3BHBA 2LAAA 3OKDB 4UDTB 5JDSB 2H26B 2NNAA 3BOVA 1JGEA 1WBXB 3UTSA 1QOKA 2P46B 1CLOH 4I0PA 3BZEB 3SHSA 3RWFB 5AAMA 2QV2A 4Y19A 3GEWB 1N7ML 2BOCB 1FE8L 1EJ6A 4PB9L 5D7SH 3UYOD 5BXFB 5INCB 3CFCH 4MJ4A 4NBYB 1G9MC 1R24B 1D6EA 4X7SL 2DKUA 4MA7H 3KLHD 4JZOB 4JE4B 1MRDL 1IFHL 4TTGA 3SGJC 3BP7B 1G0DA 1NDGB 3IS1X 3MUGB 4QRPA 5FHAL 4EKXA 3O2WH 3Q1SH 3VFMA 3FO1A 5CEZL 4MA1B 3Q2CA 1A6AB 3AVEA 3QIBB 3O8XD 5E00B 3RNKB 1AC6A 1Y6MR 1Q38A 5TE4L 5J3HC 1J0ZA 1U3HC 4Y2OA 3H9YA 2HKFH 2P49B 3NTCL 4P4KC 2XN9B 3HC0A 5DURB 1T2JA 2H3NA 4KK9D 1ZLWH 3O11A 3MV7D 2HN7B 4LRNH 3DPBA 1YEFH 3VXQB 1K8IA 3B9KC 3RHWF 4JVPA 4P2OD 4HFUH 4YO0B 3BRFA 1U8NA 5ERWA 3U0PB 2FWOB 6FABH 1AGEB 4YQXH 4RCAA 3VFOA 2B1AH 5DRZB 3QDGE 1T1XA 1E28B 3JTSA 3MRMA 4FQPA 5IW3A 2JELH 1AO7B 1EFQA 3BXNA 2GQHA 3B8SA 5DZOA 2JCCF 4LF3B 4W4OC 1CIDA 1WK0A 5CGTA 2PF6A 4OCRH 1AGFB 3QUZA 4PGJA 4M6NH 1F97A 1VFOA 4K8RD 1OGAA 5HGAA 4OCYH 3UPRB 3CDGB 4QY8B 4RGMC 4LLWA 4LSQL 2AJUL 2GHWB 4M8QB 4BH7A 3GJFB 1NCBL 1CCZA 3SDXE 1FZOB 2FHFA 1KELL 3P30H 1HDMB 5FM5M 3FMGL 3OJVC 1QSFA 5BOZG 5DGRA 1W72H 3QRGL 1MWAL 4J3OC 2P43B 3NH7H 2VKWA 5CIPH 3ZYZA 3V2AR 4FFVC 4PD4K 3ILPA 5JIPA 3NPZB 1KT2A 3BYYA 5B38A 3MCKA 1MHPH 5IBTL 4S1SL 3SCMB 1IGCH 4J3SA 1QRND 4XCCH 1I9IL 4XNMB 4JRXD 3MRKB 1I7TB 3VXUD 4PY8J 2RAMA 2P8LA 3HZVB 2DWEB 1LNUA 4H20L 1UM4L 5I18L 4J6RH 4XBEH 3H3PH 4PJ5E 4P2YA 3MJ8B 4HS6A 3IFLL 1PG7X 1T2QL 4LLMB 2E9JA 2F5BH 3HNTL 2LU7A 3HB3C 4RDQG 5IJVB 5J12B 4U3HA 1OTSC 1GHFL 3HRZA 4FQJH 4WHTB 2X70A 3WIFA 4RQQB 2ZUVA 4M1GL 4O5LH 4F9LA 3QWRD 2X1WL 4PP2A 4UT7L 2WV3A 2E7LC 1BBDH 3MRNA 3RPIA 5JHLH 2GK2A 1S7XA 5C1MB 5EN2B 2Q86A 1IC5H 2Q6WB 2YKLL 4NKOA 5HDLA 5CJQH 2AGJL 3QNXB 4ONHA 3GB7A 4U1NB 4HSQA 3O3DA 4GS7C 1X5LA 3UPCA 1UXWB 4Y4KC 1SYSB 3PHOB 2GY7B 4NM8H 4GKOA 4EVNB 3ABZA 3OKMB 1S7QA 5DF0A 1NAMH 2R15A 2E9IA 3TIDA 3HAEB 3U4EA 2HTLD 3LH2H 3QEUA 3REWB 4RDQF 1VSCA 2AV1B 4MB4A 3BN9C 4IMLB 2VOTA 1T1YB 5J6GB 4UT6H 2QADD 2R1WA 5DR5H 5MEOA 1HHIA 3KLHC 1RJLB 4ODHL 1CBVH 2Z8VC 4K3JH 3BD5A 1U8JA 3N85H 4N0FB 1QBMH 1X5YA 3AROA 3CD4A 4JY4B 2VMFA 4JZJB 3GSRB 5HI3D 4L29B 4POYA 4JG0H 3IU3A 3KLDA 4GG8A 4FQXB 5E2TH 3VDCA 4HCRH 3GHBL 3CLFL 2P7TB 2VZOA 3O8XC 4Y5YB 1DBBH 5DJ0A 2UY6A 4X7EC 1JZ6A 3I2CL 2ED7A 4I0CC 3KS0J 4NN7B 4JLRA 1MJJA 1RIVH 1Z9OA 4U6YA 4OF7A 3FB6B 4WVRA 1OLLA 3PL6A 3TBWB 2BSRB 1DVFD 3VG9C 3M45A 2HLFD 5E7FA 5C8JB 1QKZH 3SJVE