4GBYA

The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
475
structure length
475
Chain Sequence
b'YNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-xylose-proton symporter
publication title Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 198
structure length 475
sequence length 475
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4gbyA01
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4gbyA02
5A2NA 4D2BA 4JREA 1PW4A 4IKZA 4ZW9A 3O7QA 2Y5YA 4Q65A 5D58A 4ZWBA 4ZYRA 4TPJA 4IKYA 4IKXA 4GBYA 4JA3A 4GC0A 5D6KA 4U4WA 5EQIA 4TPHA 5A2OA 4LDSA 4PYPA 3O7PA 4UVMA 4YBQA 4J05A 4YB9D 4OAAA 4IU8A 3WDOA 2V8NA 4XNJA 4TPGA 5D59A 4OH3A 4D2DA 4U4VA 5EQGA 1PV7A 4IKVA 4IKWA 4QIQA 2CFQA 5GXBA 1PV6A 4IU9A 4XNIA 5EQHA 4W6VA 4D2CA 4JR9A 4U4TA 4LEPA 2XUTA 5C65A 2CFPA 4ZWCA 4GBZA 4APSA
chains in the Genus database with same CATH superfamily
3OG4A 3H3VE 1I1RB 1Y6ML 2B91A 3L5WI 3HOZD 3OQ3A 2R7ZD 4BBSD 1Z92A 3G6DA 3DGCL 1EXZA 4D2CA 4LEPA 2R93D 4GBZA 2H24A 4YPGC 4RS1A 1M4CA 5D22A 1EMRA 1A22A 1Y6KL 4YB9D 4A3ED 4CNIC 4DOHA 1Y1VD 4YDYI 3NCCA 4U4TA 5C44D 1IK0A 1LK3A 3B5KA 3D85C 4APSA 2E9WC 4D2BA 4JREA 4Q65A 5D58A 4NEMA 4DKFA 3NPZA 1BGDA 2JA5D 3S9DA 2Z3RA 1CN4C 5FUCA 1ITLA 2LAGA 1PGRA 1LKIA 4QIQA 2GMFA 5GXBA 5D72A 1JLIA 4GS7A 2JA6D 4LRLA 3PO2D 4J05A 1LQSL 1NBPA 4A3JD 4XNJA 3N06A 1BUYA 2Q98A 3IRHA 4XNIA 2VUMD 4BY1D 3QWRB 3PO3D 4GBYA 4GC0A 3QB7A 1PW6A 4UVMA 3INKC 1RHGA 4IU8A 5C7XA 1P9MB 3VA2A 1BGCA 5IP7D 3TGXB 2CFPA 2L3OA 1M4AA 1IJZA 4A3LD 1F6FA 1HWHA 4PYPA 1EVSA 2OQPA 4O9HA 4DKCA 1Y6NL 5D70A 1BCNA 5EQHA 1M4RA 1F45B 4W6VA 1PVHB 3G9VB 3HOVD 4A3BD 2KZ1A 4ZYRA 5A2NA 3D87A 4NN6A 1AX8A 4ZWBA 2ILKA 3BPNA 4JA3A 2D48A 4A3KD 2O27A 1HGUA 4ZF7A 2C35A 3DI2A 1V7MV 4A3DD 1B5LA 4Z5RD 1ITIA 1PV6A 2L3YA 1BP3A 3O7QA 3SE4B 1HIJA 2INTA 1ILKA 1CYLA 5E4EA 3HOYD 3HOUD 1IL6A 3D48P 4BY7D 3EJJA 4EXPA 1PV7A 2B90A 5FLMD 3NCFA 1RCBA 2JA7D 2R92D 4ZWCA 3UF5A 1M48A 4IKYA 2IL6A 3LB6B 4A3GD 1INRA 4LDSA 3UX9A 1A7MA 5TS9A 1N1FA 3NCBA 4A3ID 3BPOA 3PIWA 3SE3B 3I4MD 2CFQA 1WCMD 4ZS7A 2XUTA 3MZGA 1PW4A 2Y5YA 1IRLA 1CSGA 4IKXA 5EQIA 1IARA 4A3FD 1EERA 1RW5A 1CD9A 2Q14A 3HHRA 4IKWA 1GA3A 4J4LC 1FG9A 1HULA 5D28B 3AYHA 3EW3A 3UEZE 2CYKA 5IP9D 2B8UA 3DLQI 2B8ZA 3I4ND 1PY2A 3FKID 4O6KA 3PIVA 1ALUA 3HOWD 5C4XD 4OH3A 1CNT1 2LMSA 1Y14A 4EXNA 1HZIA 1VLKA 1KF9A 5C3ED 1AXIA 2B5IA 4TPHA 5A2OA 1ETEA 4DKDA 4BXXD 4TPGA 1HIKA 1BBNA 3N0PA 5FHXA 4DKEA 4JR9A 1D9GA 5C65A 4NI7A 3HMXB 3DI3A 3OG6A 2XQBA 1RFBA 3H0GD 1J7VL 3QB1A 1WU3I 5D6KA 4A3CD 1GNCA 4U4WA 2B8XA 3O7PA 1M4BA 3WDOA 1M47A 2B8YA 2PSMA 4A93D 1FYHA 4A3MD 5KNHI 2O26A 1ITMA 4PS4A 3Q1SI 4NKQC 1HWGA 2O6IA 3HHCA 1D9CA 4NN5A 2Q7NB 4YBQA 1Z7CA 4NN7A 4WRLB 3UF2A 4X51A 2B63D 5D59A 2JA8D 4NI9A 4IU9A 2Z3QA 3LB6A 4FA8E 1EKUA 4ZW9A 2D9QA 3BPLA 4OAAA 1YKBA 1HUWA 2V8NA 4MHLA 5L6YC 3QAZA 5IYDD 5EQGA 4IKVA 4GRWA 4NEJA 2ERJD 4YUEC 4YQXA 1V7NV 1BGEA 5LQBA 5IYCD 3L5XA 4IKZA 2HYMB 3WCYI 3DUHC 3QT2C 4TPJA 3BESL 3HOXD 5IYBD 1M49A 1QVNA 3NCEA 1ITFA 4D2DA 1SCFA 4U4VA 1Y1WD 4I77Z 4BBRD 5D71A 1AU1A
chains in the Genus database with same CATH topology
5A2NA 4D2BA 4JREA 1PW4A 4IKZA 4ZW9A 3O7QA 2Y5YA 4Q65A 5D58A 4ZWBA 4ZYRA 4TPJA 4IKYA 4IKXA 4GBYA 4JA3A 4GC0A 5D6KA 4U4WA 5EQIA 4TPHA 5A2OA 4LDSA 4PYPA 3O7PA 4UVMA 4YBQA 4J05A 4YB9D 4OAAA 4IU8A 3WDOA 2V8NA 4XNJA 4TPGA 5D59A 4OH3A 4D2DA 4U4VA 5EQGA 1PV7A 4IKVA 4IKWA 4QIQA 2CFQA 5GXBA 1PV6A 4IU9A 4XNIA 5EQHA 4W6VA 4D2CA 4JR9A 4U4TA 4LEPA 2XUTA 5C65A 2CFPA 4ZWCA 4GBZA 4APSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2N A;  4D2B A;  4JRE A;  1PW4 A;  4IKZ A;  4ZW9 A;  3O7Q A;  2Y5Y A;  4Q65 A;  5D58 A;  4ZWB A;  4ZYR A;  4TPJ A;  4IKY A;  4IKX A;  4GBY A;  4JA3 A;  4GC0 A;  5D6K A;  4U4W A;  5EQI A;  4TPH A;  5A2O A;  4LDS A;  4PYP A;  3O7P A;  4UVM A;  4YBQ A;  4J05 A;  4YB9 D;  4OAA A;  4IU8 A;  3WDO A;  2V8N A;  4XNJ A;  4TPG A;  5D59 A;  4OH3 A;  4D2D A;  4U4V A;  5EQG A;  1PV7 A;  4IKV A;  4IKW A;  4QIQ A;  2CFQ A;  5GXB A;  1PV6 A;  4IU9 A;  4XNI A;  5EQH A;  4W6V A;  4D2C A;  4JR9 A;  4U4T A;  4LEP A;  2XUT A;  5C65 A;  2CFP A;  4ZWC A;  4GBZ A;  4APS A; 
#chains in the Genus database with same CATH topology
 3OG4 A;  3H3V E;  1I1R B;  1Y6M L;  2B91 A;  3L5W I;  3HOZ D;  3OQ3 A;  2R7Z D;  4BBS D;  1Z92 A;  3G6D A;  3DGC L;  1EXZ A;  4D2C A;  4LEP A;  2R93 D;  4GBZ A;  2H24 A;  4YPG C;  4RS1 A;  1M4C A;  5D22 A;  1EMR A;  1A22 A;  1Y6K L;  4YB9 D;  4A3E D;  4CNI C;  4DOH A;  1Y1V D;  4YDY I;  3NCC A;  4U4T A;  5C44 D;  1IK0 A;  1LK3 A;  3B5K A;  3D85 C;  4APS A;  2E9W C;  4D2B A;  4JRE A;  4Q65 A;  5D58 A;  4NEM A;  4DKF A;  3NPZ A;  1BGD A;  2JA5 D;  3S9D A;  2Z3R A;  1CN4 C;  5FUC A;  1ITL A;  2LAG A;  1PGR A;  1LKI A;  4QIQ A;  2GMF A;  5GXB A;  5D72 A;  1JLI A;  4GS7 A;  2JA6 D;  4LRL A;  3PO2 D;  4J05 A;  1LQS L;  1NBP A;  4A3J D;  4XNJ A;  3N06 A;  1BUY A;  2Q98 A;  3IRH A;  4XNI A;  2VUM D;  4BY1 D;  3QWR B;  3PO3 D;  4GBY A;  4GC0 A;  3QB7 A;  1PW6 A;  4UVM A;  3INK C;  1RHG A;  4IU8 A;  5C7X A;  1P9M B;  3VA2 A;  1BGC A;  5IP7 D;  3TGX B;  2CFP A;  2L3O A;  1M4A A;  1IJZ A;  4A3L D;  1F6F A;  1HWH A;  4PYP A;  1EVS A;  2OQP A;  4O9H A;  4DKC A;  1Y6N L;  5D70 A;  1BCN A;  5EQH A;  1M4R A;  1F45 B;  4W6V A;  1PVH B;  3G9V B;  3HOV D;  4A3B D;  2KZ1 A;  4ZYR A;  5A2N A;  3D87 A;  4NN6 A;  1AX8 A;  4ZWB A;  2ILK A;  3BPN A;  4JA3 A;  2D48 A;  4A3K D;  2O27 A;  1HGU A;  4ZF7 A;  2C35 A;  3DI2 A;  1V7M V;  4A3D D;  1B5L A;  4Z5R D;  1ITI A;  1PV6 A;  2L3Y A;  1BP3 A;  3O7Q A;  3SE4 B;  1HIJ A;  2INT A;  1ILK A;  1CYL A;  5E4E A;  3HOY D;  3HOU D;  1IL6 A;  3D48 P;  4BY7 D;  3EJJ A;  4EXP A;  1PV7 A;  2B90 A;  5FLM D;  3NCF A;  1RCB A;  2JA7 D;  2R92 D;  4ZWC A;  3UF5 A;  1M48 A;  4IKY A;  2IL6 A;  3LB6 B;  4A3G D;  1INR A;  4LDS A;  3UX9 A;  1A7M A;  5TS9 A;  1N1F A;  3NCB A;  4A3I D;  3BPO A;  3PIW A;  3SE3 B;  3I4M D;  2CFQ A;  1WCM D;  4ZS7 A;  2XUT A;  3MZG A;  1PW4 A;  2Y5Y A;  1IRL A;  1CSG A;  4IKX A;  5EQI A;  1IAR A;  4A3F D;  1EER A;  1RW5 A;  1CD9 A;  2Q14 A;  3HHR A;  4IKW A;  1GA3 A;  4J4L C;  1FG9 A;  1HUL A;  5D28 B;  3AYH A;  3EW3 A;  3UEZ E;  2CYK A;  5IP9 D;  2B8U A;  3DLQ I;  2B8Z A;  3I4N D;  1PY2 A;  3FKI D;  4O6K A;  3PIV A;  1ALU A;  3HOW D;  5C4X D;  4OH3 A;  1CNT 1;  2LMS A;  1Y14 A;  4EXN A;  1HZI A;  1VLK A;  1KF9 A;  5C3E D;  1AXI A;  2B5I A;  4TPH A;  5A2O A;  1ETE A;  4DKD A;  4BXX D;  4TPG A;  1HIK A;  1BBN A;  3N0P A;  5FHX A;  4DKE A;  4JR9 A;  1D9G A;  5C65 A;  4NI7 A;  3HMX B;  3DI3 A;  3OG6 A;  2XQB A;  1RFB A;  3H0G D;  1J7V L;  3QB1 A;  1WU3 I;  5D6K A;  4A3C D;  1GNC A;  4U4W A;  2B8X A;  3O7P A;  1M4B A;  3WDO A;  1M47 A;  2B8Y A;  2PSM A;  4A93 D;  1FYH A;  4A3M D;  5KNH I;  2O26 A;  1ITM A;  4PS4 A;  3Q1S I;  4NKQ C;  1HWG A;  2O6I A;  3HHC A;  1D9C A;  4NN5 A;  2Q7N B;  4YBQ A;  1Z7C A;  4NN7 A;  4WRL B;  3UF2 A;  4X51 A;  2B63 D;  5D59 A;  2JA8 D;  4NI9 A;  4IU9 A;  2Z3Q A;  3LB6 A;  4FA8 E;  1EKU A;  4ZW9 A;  2D9Q A;  3BPL A;  4OAA A;  1YKB A;  1HUW A;  2V8N A;  4MHL A;  5L6Y C;  3QAZ A;  5IYD D;  5EQG A;  4IKV A;  4GRW A;  4NEJ A;  2ERJ D;  4YUE C;  4YQX A;  1V7N V;  1BGE A;  5LQB A;  5IYC D;  3L5X A;  4IKZ A;  2HYM B;  3WCY I;  3DUH C;  3QT2 C;  4TPJ A;  3BES L;  3HOX D;  5IYB D;  1M49 A;  1QVN A;  3NCE A;  1ITF A;  4D2D A;  1SCF A;  4U4V A;  1Y1W D;  4I77 Z;  4BBR D;  5D71 A;  1AU1 A; 
#chains in the Genus database with same CATH homology
 5A2N A;  4D2B A;  4JRE A;  1PW4 A;  4IKZ A;  4ZW9 A;  3O7Q A;  2Y5Y A;  4Q65 A;  5D58 A;  4ZWB A;  4ZYR A;  4TPJ A;  4IKY A;  4IKX A;  4GBY A;  4JA3 A;  4GC0 A;  5D6K A;  4U4W A;  5EQI A;  4TPH A;  5A2O A;  4LDS A;  4PYP A;  3O7P A;  4UVM A;  4YBQ A;  4J05 A;  4YB9 D;  4OAA A;  4IU8 A;  3WDO A;  2V8N A;  4XNJ A;  4TPG A;  5D59 A;  4OH3 A;  4D2D A;  4U4V A;  5EQG A;  1PV7 A;  4IKV A;  4IKW A;  4QIQ A;  2CFQ A;  5GXB A;  1PV6 A;  4IU9 A;  4XNI A;  5EQH A;  4W6V A;  4D2C A;  4JR9 A;  4U4T A;  4LEP A;  2XUT A;  5C65 A;  2CFP A;  4ZWC A;  4GBZ A;  4APS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...