4GBZA

The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
475
structure length
475
Chain Sequence
b'YNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-xylose-proton symporter
publication title Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 198
structure length 475
sequence length 475
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4gbzA01
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4gbzA02
4JA3A 4GBYA 4LDSA 4XNJA 4OAAA 1PW4A 4ZW9A 5A2NA 5EQHA 4ZYRA 4IU8A 1PV7A 5GXBA 5EQIA 5A2OA 4LEPA 5D6KA 4Q65A 2CFPA 4OH3A 4IKWA 4TPGA 4IKVA 5D59A 4YBQA 1PV6A 4U4VA 4D2CA 4ZWBA 4IKZA 4IKYA 2V8NA 4J05A 4TPHA 4GBZA 4IKXA 3O7QA 4IU9A 4ZWCA 4D2BA 4D2DA 4GC0A 4U4WA 4W6VA 4PYPA 3WDOA 4U4TA 4XNIA 4UVMA 4TPJA 4JR9A 4YB9D 2Y5YA 3O7PA 5D58A 4APSA 2XUTA 5EQGA 4JREA 4QIQA 5C65A 2CFQA
chains in the Genus database with same CATH superfamily
1CSGA 3FKID 1I1RB 3B5KA 5LQBA 5D59A 4CNIC 5E4EA 1A7MA 2PSMA 4U4TA 4UVMA 5FUCA 1M4CA 4BY1D 5FHXA 3PO2D 3DUHC 2H24A 5EQIA 1Z92A 3PO3D 4NKQC 2CYKA 4U4VA 1GA3A 4A3LD 1J7VL 4MHLA 4TPJA 1EXZA 5C44D 4PYPA 5IYCD 2B8YA 2KZ1A 2O26A 2B90A 2CFPA 3HOZD 3G9VB 1M4AA 1B5LA 4GBZA 2HYMB 4BBRD 3NCCA 2R92D 4JREA 5FLMD 4LDSA 5TS9A 1PGRA 3AYHA 1CD9A 4PS4A 4YQXA 5D72A 4D2CA 3N06A 1PY2A 4D2BA 1ITMA 4YPGC 1VLKA 3N0PA 4A3BD 4YUEC 4JA3A 4NN5A 4XNJA 3WCYI 3NPZA 1F45B 1HULA 3IRHA 4LEPA 1BUYA 2XQBA 1IL6A 4ZS7A 1PV6A 5D22A 5D58A 4NN7A 3SE3B 5IP7D 2OQPA 1Y1WD 1PV7A 1Y14A 3BPNA 1QVNA 1HIJA 4J05A 1LQSL 4EXNA 2Z3QA 4A3ED 4BY7D 4YB9D 1EMRA 3NCEA 2GMFA 3UX9A 1ITLA 5C4XD 4QIQA 1N1FA 1ITFA 1WU3I 4DKCA 3QB1A 5EQHA 4IU8A 5A2OA 3DI3A 1AXIA 4Q65A 2O27A 4IKVA 3D87A 1M4BA 2Q98A 4NN6A 5IP9D 4IKXA 1Y6KL 1HUWA 3HHRA 1RCBA 2B5IA 2B91A 2JA8D 4OAAA 2D9QA 1CN4C 1PW6A 4NEMA 3HHCA 5D6KA 4A3KD 3OG4A 4RS1A 3BPLA 3NCBA 1HWHA 1D9GA 2LMSA 2L3YA 4ZF7A 1YKBA 4D2DA 3HOXD 4XNIA 1ALUA 1FYHA 1BGCA 4BXXD 4BBSD 4LRLA 5C65A 3I4ND 1ITIA 3BPOA 3LB6B 3DLQI 1JLIA 2ILKA 3D48P 1HIKA 1LKIA 4DKDA 2B8XA 3QAZA 2Q14A 4Z5RD 3I4MD 2O6IA 4NI7A 3LB6A 3TGXB 1PW4A 4ZW9A 1AX8A 5A2NA 4ZYRA 2L3OA 5IYDD 1HZIA 4YBQA 4O9HA 3NCFA 2R7ZD 4ZWCA 4W6VA 4YDYI 4X51A 4DKEA 3PIWA 1INRA 4GBYA 1AU1A 4A3DD 1Z7CA 5GXBA 1RHGA 3DI2A 1RFBA 4A3FD 5C3ED 2B63D 1Y6NL 1PVHB 1Y6ML 2LAGA 4A3JD 3O7QA 3L5WI 3QWRB 1M47A 3OG6A 4U4WA 1BGEA 1FG9A 3L5XA 2C35A 1M4RA 1HWGA 1IARA 2Y5YA 1HGUA 1EVSA 4NEJA 4FA8E 2B8UA 3HOVD 3QB7A 3Q1SI 4J4LC 4A3CD 4TPGA 3EJJA 3HMXB 5D28B 5IYBD 4A3GD 1ETEA 2V8NA 1BP3A 1CNT1 4TPHA 5C7XA 3EW3A 1V7MV 3H3VE 2INTA 3H0GD 4EXPA 3HOYD 3MZGA 3UF5A 3D85C 1D9CA 4NI9A 2Q7NB 4IKWA 3SE4B 4GRWA 4I77Z 3HOUD 2ERJD 1M48A 3UEZE 3UF2A 3S9DA 3O7PA 2Z3RA 3INKC 3DGCL 5EQGA 2CFQA 3QT2C 1EKUA 1WCMD 4A93D 3VA2A 4WRLB 2JA5D 1GNCA 4ZWBA 3HOWD 4IKYA 5D71A 5KNHI 1ILKA 1SCFA 4GC0A 1BCNA 1RW5A 4JR9A 3PIVA 4A3ID 4APSA 2XUTA 4DOHA 3BESL 1LK3A 4GS7A 4A3MD 1A22A 2JA7D 1IK0A 1NBPA 1M49A 4DKFA 2JA6D 1BGDA 2B8ZA 1IJZA 2R93D 1P9MB 4O6KA 5D70A 1IRLA 1KF9A 1F6FA 4OH3A 1CYLA 5L6YC 1Y1VD 4IKZA 2D48A 4IU9A 1EERA 1V7NV 3WDOA 3G6DA 1BBNA 2VUMD 2IL6A 3OQ3A 2E9WC
chains in the Genus database with same CATH topology
4JA3A 4GBYA 4LDSA 4XNJA 4OAAA 1PW4A 4ZW9A 5A2NA 5EQHA 4ZYRA 4IU8A 1PV7A 5GXBA 5EQIA 5A2OA 4LEPA 5D6KA 4Q65A 2CFPA 4OH3A 4IKWA 4TPGA 4IKVA 5D59A 4YBQA 1PV6A 4U4VA 4D2CA 4ZWBA 4IKZA 4IKYA 2V8NA 4J05A 4TPHA 4GBZA 4IKXA 3O7QA 4IU9A 4ZWCA 4D2BA 4D2DA 4GC0A 4U4WA 4W6VA 4PYPA 3WDOA 4U4TA 4XNIA 4UVMA 4TPJA 4JR9A 4YB9D 2Y5YA 3O7PA 5D58A 4APSA 2XUTA 5EQGA 4JREA 4QIQA 5C65A 2CFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA3 A;  4GBY A;  4LDS A;  4XNJ A;  4OAA A;  1PW4 A;  4ZW9 A;  5A2N A;  5EQH A;  4ZYR A;  4IU8 A;  1PV7 A;  5GXB A;  5EQI A;  5A2O A;  4LEP A;  5D6K A;  4Q65 A;  2CFP A;  4OH3 A;  4IKW A;  4TPG A;  4IKV A;  5D59 A;  4YBQ A;  1PV6 A;  4U4V A;  4D2C A;  4ZWB A;  4IKZ A;  4IKY A;  2V8N A;  4J05 A;  4TPH A;  4GBZ A;  4IKX A;  3O7Q A;  4IU9 A;  4ZWC A;  4D2B A;  4D2D A;  4GC0 A;  4U4W A;  4W6V A;  4PYP A;  3WDO A;  4U4T A;  4XNI A;  4UVM A;  4TPJ A;  4JR9 A;  4YB9 D;  2Y5Y A;  3O7P A;  5D58 A;  4APS A;  2XUT A;  5EQG A;  4JRE A;  4QIQ A;  5C65 A;  2CFQ A; 
#chains in the Genus database with same CATH topology
 1CSG A;  3FKI D;  1I1R B;  3B5K A;  5LQB A;  5D59 A;  4CNI C;  5E4E A;  1A7M A;  2PSM A;  4U4T A;  4UVM A;  5FUC A;  1M4C A;  4BY1 D;  5FHX A;  3PO2 D;  3DUH C;  2H24 A;  5EQI A;  1Z92 A;  3PO3 D;  4NKQ C;  2CYK A;  4U4V A;  1GA3 A;  4A3L D;  1J7V L;  4MHL A;  4TPJ A;  1EXZ A;  5C44 D;  4PYP A;  5IYC D;  2B8Y A;  2KZ1 A;  2O26 A;  2B90 A;  2CFP A;  3HOZ D;  3G9V B;  1M4A A;  1B5L A;  4GBZ A;  2HYM B;  4BBR D;  3NCC A;  2R92 D;  4JRE A;  5FLM D;  4LDS A;  5TS9 A;  1PGR A;  3AYH A;  1CD9 A;  4PS4 A;  4YQX A;  5D72 A;  4D2C A;  3N06 A;  1PY2 A;  4D2B A;  1ITM A;  4YPG C;  1VLK A;  3N0P A;  4A3B D;  4YUE C;  4JA3 A;  4NN5 A;  4XNJ A;  3WCY I;  3NPZ A;  1F45 B;  1HUL A;  3IRH A;  4LEP A;  1BUY A;  2XQB A;  1IL6 A;  4ZS7 A;  1PV6 A;  5D22 A;  5D58 A;  4NN7 A;  3SE3 B;  5IP7 D;  2OQP A;  1Y1W D;  1PV7 A;  1Y14 A;  3BPN A;  1QVN A;  1HIJ A;  4J05 A;  1LQS L;  4EXN A;  2Z3Q A;  4A3E D;  4BY7 D;  4YB9 D;  1EMR A;  3NCE A;  2GMF A;  3UX9 A;  1ITL A;  5C4X D;  4QIQ A;  1N1F A;  1ITF A;  1WU3 I;  4DKC A;  3QB1 A;  5EQH A;  4IU8 A;  5A2O A;  3DI3 A;  1AXI A;  4Q65 A;  2O27 A;  4IKV A;  3D87 A;  1M4B A;  2Q98 A;  4NN6 A;  5IP9 D;  4IKX A;  1Y6K L;  1HUW A;  3HHR A;  1RCB A;  2B5I A;  2B91 A;  2JA8 D;  4OAA A;  2D9Q A;  1CN4 C;  1PW6 A;  4NEM A;  3HHC A;  5D6K A;  4A3K D;  3OG4 A;  4RS1 A;  3BPL A;  3NCB A;  1HWH A;  1D9G A;  2LMS A;  2L3Y A;  4ZF7 A;  1YKB A;  4D2D A;  3HOX D;  4XNI A;  1ALU A;  1FYH A;  1BGC A;  4BXX D;  4BBS D;  4LRL A;  5C65 A;  3I4N D;  1ITI A;  3BPO A;  3LB6 B;  3DLQ I;  1JLI A;  2ILK A;  3D48 P;  1HIK A;  1LKI A;  4DKD A;  2B8X A;  3QAZ A;  2Q14 A;  4Z5R D;  3I4M D;  2O6I A;  4NI7 A;  3LB6 A;  3TGX B;  1PW4 A;  4ZW9 A;  1AX8 A;  5A2N A;  4ZYR A;  2L3O A;  5IYD D;  1HZI A;  4YBQ A;  4O9H A;  3NCF A;  2R7Z D;  4ZWC A;  4W6V A;  4YDY I;  4X51 A;  4DKE A;  3PIW A;  1INR A;  4GBY A;  1AU1 A;  4A3D D;  1Z7C A;  5GXB A;  1RHG A;  3DI2 A;  1RFB A;  4A3F D;  5C3E D;  2B63 D;  1Y6N L;  1PVH B;  1Y6M L;  2LAG A;  4A3J D;  3O7Q A;  3L5W I;  3QWR B;  1M47 A;  3OG6 A;  4U4W A;  1BGE A;  1FG9 A;  3L5X A;  2C35 A;  1M4R A;  1HWG A;  1IAR A;  2Y5Y A;  1HGU A;  1EVS A;  4NEJ A;  4FA8 E;  2B8U A;  3HOV D;  3QB7 A;  3Q1S I;  4J4L C;  4A3C D;  4TPG A;  3EJJ A;  3HMX B;  5D28 B;  5IYB D;  4A3G D;  1ETE A;  2V8N A;  1BP3 A;  1CNT 1;  4TPH A;  5C7X A;  3EW3 A;  1V7M V;  3H3V E;  2INT A;  3H0G D;  4EXP A;  3HOY D;  3MZG A;  3UF5 A;  3D85 C;  1D9C A;  4NI9 A;  2Q7N B;  4IKW A;  3SE4 B;  4GRW A;  4I77 Z;  3HOU D;  2ERJ D;  1M48 A;  3UEZ E;  3UF2 A;  3S9D A;  3O7P A;  2Z3R A;  3INK C;  3DGC L;  5EQG A;  2CFQ A;  3QT2 C;  1EKU A;  1WCM D;  4A93 D;  3VA2 A;  4WRL B;  2JA5 D;  1GNC A;  4ZWB A;  3HOW D;  4IKY A;  5D71 A;  5KNH I;  1ILK A;  1SCF A;  4GC0 A;  1BCN A;  1RW5 A;  4JR9 A;  3PIV A;  4A3I D;  4APS A;  2XUT A;  4DOH A;  3BES L;  1LK3 A;  4GS7 A;  4A3M D;  1A22 A;  2JA7 D;  1IK0 A;  1NBP A;  1M49 A;  4DKF A;  2JA6 D;  1BGD A;  2B8Z A;  1IJZ A;  2R93 D;  1P9M B;  4O6K A;  5D70 A;  1IRL A;  1KF9 A;  1F6F A;  4OH3 A;  1CYL A;  5L6Y C;  1Y1V D;  4IKZ A;  2D48 A;  4IU9 A;  1EER A;  1V7N V;  3WDO A;  3G6D A;  1BBN A;  2VUM D;  2IL6 A;  3OQ3 A;  2E9W C; 
#chains in the Genus database with same CATH homology
 4JA3 A;  4GBY A;  4LDS A;  4XNJ A;  4OAA A;  1PW4 A;  4ZW9 A;  5A2N A;  5EQH A;  4ZYR A;  4IU8 A;  1PV7 A;  5GXB A;  5EQI A;  5A2O A;  4LEP A;  5D6K A;  4Q65 A;  2CFP A;  4OH3 A;  4IKW A;  4TPG A;  4IKV A;  5D59 A;  4YBQ A;  1PV6 A;  4U4V A;  4D2C A;  4ZWB A;  4IKZ A;  4IKY A;  2V8N A;  4J05 A;  4TPH A;  4GBZ A;  4IKX A;  3O7Q A;  4IU9 A;  4ZWC A;  4D2B A;  4D2D A;  4GC0 A;  4U4W A;  4W6V A;  4PYP A;  3WDO A;  4U4T A;  4XNI A;  4UVM A;  4TPJ A;  4JR9 A;  4YB9 D;  2Y5Y A;  3O7P A;  5D58 A;  4APS A;  2XUT A;  5EQG A;  4JRE A;  4QIQ A;  5C65 A;  2CFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...