4GC3A

Crystal structure of l-histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn and sulfate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
263
Chain Sequence
SLKKLDYHFHSHFSADSEELPRKHVTEAIAHGLEEICFTEHRDFYFPGMDFSLNLPEYFQEINQLQAEFKDKIKIKIGLEMGIDLRFKSEINQFIDSAPFDFVIASVHEIGDIEVYDGTEFYLQKTKEEAQREYLLACLDVVQNFENYNSFGHLDYVARYGPYTDKSIKFAENREILFEILRALASKEKALEINTRLFDDPKTEQFYSDLLINFKRLGGKFITLGTDSHIAKRDWLSIHKARTLIKKAGFHELATFSGMKIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Characterization of l-Histidinol Phosphate Phosphatase from the Polymerase and Histidinol Phosphatase Family of Proteins.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords L-HISTIDINOL PHOSPHATE PHOSPHATASE
total genus 108
structure length 263
sequence length 263
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02811 PHP PHP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gc3A00
3URNA 5E5CA 4B90A 4DI9A 1EYWA 2VC5A 2WJEA 4L9XA 4R7WA 1EJUC 3S2LA 2BGNE 1V7AA 4LALA 4XAZA 3A4JA 1FKWA 4KESA 1A5OC 1FWCC 4C6FA 4LCQA 4GX9A 4GXWA 4IG2A 3FDGA 3LU2A 4XD6A 4CEUC 3N2CA 1S3TC 3QGAC 2AMXA 4KF1A 2FVMA 4NP7A 4WVXA 4PBEA 4C6NA 3MKVA 4HK5A 1RA0A 4C6BA 2QS8A 4B91A 1EJSC 4H01A 1BF6A 2DVTA 4H9ZA 2UZ9A 3KM8A 1POKA 4HJWA 4LAOA 3D6NA 1PTAA 3OOQA 4IFKA 3LY0A 1A4MA 2E25A 1A5NC 4H9TA 4LEFA 4GK8A 3NURA 4IFOA 3IJ6A 4J5NA 4XD3A 4HK6A 5A6TC 4QS5A 1XWYA 1YIXA 2D2GA 4J35A 2A3LA 4QS6A 2P50A 4GYFA 3IV8A 2XIOA 3LGGA 3OQEA 1GKPA 4C6KA 4G7EA 4INFA 4V1YA 4OFCA 1WXYA 2F6KA 3UBPC 1KCXA 4C5YA 1EJVC 2W9MA 4XD4A 2GSEA 4IH3A 4HK7A 1NDZA 1UMLA 4XAGA 3IARA 4IGNA 3ICJA 2R1LA 4H00A 2WM1A 3NQBA 2YXOA 4AQLA 4KIRA 4PBFA 1EJTC 2O4MA 4MUPA 3F2BA 1XRFA 2ADAA 4GX8A 4DLFA 3MSRA 4XAFA 3F2CA 1YRRA 2PLMA 1FWFC 4GY7A 4DIAA 1J79A 1RJQA 1K1DA 4F0LA 2GWGA 2GWNA 4B3ZA 1E9YB 3S4TA 4LCRA 1I0BA 3URBA 4EPDC 1YNYA 1J6PA 2I5GA 4DI8A 4CNTA 3QY7A 4J2MA 2R1KA 1NDVA 4ERIA 4DZIA 2D2JA 3RHGA 4GC3A 1PB0A 1FWEC 3K2GA 1QXLA 3TN4A 3GTHA 3OVGA 2R1NA 4LFYA 4CQCA 3EWDA 3EGJA 2RAGA 3GTIA 3E74A 3RCMA 3MVIA 1ITQA 4IQJA 3EWCA 3QY8A 3DC8A 4CEXC 1FWDC 1XRTA 3R0DA 4ERGA 3PANA 1J5SA 2Z28A 3E3HA 4KETA 2Z2AA 1R9ZA 4EP8C 1FKXA 2Z00A 3E2VA 3TN5A 2E1WA 3GTXA 3FDKA 3HPAA 4QTGA 1ONWA 1FWHC 3QGKC 3GG7A 4C6IA 3SO7A 4DLMA 2IMRA 1FWBC 3O7UA 4LANA 2Z4GA 1RAKA 4QRNA 3S2MA 3O0FA 3PNUA 3NEHA 1A5KC 3ITCA 4ZSUA 1FWIC 1UIPA 1P6CA 1R9YA 3UPMA 2Z29A 4KEVA 2OOFA 3WYZA 4H9MA 1HZYA 2VUNA 4RDWA 4M51A 2WJFA 3MJMA 4G7EB 2ANUA 1K70A 2D2HA 1EJXC 3WZ0E 3LSBA 1YMYA 4I6VA 1ADDA 3T81A 1R9XA 4C6QA 4GOAA 1W1IE 3CAKA 3PBMA 2DVXA 1V77A 4E3TA 4H9YA 5HMDA 1DPMA 3TNBA 2Z27A 4WHBA 3FEQA 4LCSA 2HBVA 2YZ5A 2PUZA 3MVTA 1WXZA 1ITUA 1UBPC 2VM8A 4EPKA 3S2JA 1GKQA 2Z7GA 3T8LA 1EZ2A 4KEZA 4EPEC 2GOKA 1RK5A 4ERAA 3AUOA 4CNUA 1V51A 1YBQB 3E0LA 3GIPA 4YIWA 4C6LA 1KRCC 3IPWA 4Z42C 4IGMA 4D8LA 2HQAA 3RYSA 3OU8A 2ZC1A 3BE7A 3GU9A 3ISIX 4R88A 4C6OA 3MPGA 4LAMA 1M65A 3TN6A 2AQOA 4C5ZA 4GY1A 3QY6A 5CH9A 3MTWA 1M68A 2GZXA 3T1GA 4DYKA 4XAYA 2FVKA 2O4QA 2HNHA 3CJPA 3GU1A 5AKQA 1A4LA 3DCPA 2DVUA 3IGHX 1RJPA 2VC7A 2CZVA 1UIOA 1FWJC 4EPBC 4KERA 5HMEA 1EJWC 2OODA 2PGRA 1RJRA 2Z26A 3DUGA 4C6JA 4WGXA 1E9ZB 2AQVA 3CS2A 4I6KA 4DO7A 2G3FA 2VHLA 4P5UA 1PO9A 5LXXA 1O5RA 2WJDA 3B0YA 4B92A 4V1XA 4BKNA 3UR2A 4F0SA 2HPMA 4H9XA 2Z24A 3URQA 1EJRC 2Z2BA 2YB4A 4NG3A 4CQBA 2QPXA 3HM7A 3LA4A 4F0RA 3GU2A 2P53A 4BY3A 4LAKA 3OJGA 1FWGC 3HTWA 2Z25A 3S2NA 1V79A 3GUWA 4ICMA 4PCPA 4IF2A 3GRIA 4C6EA 5G4HC 1P1MA 3IACA 4IFKB 1VFLA 3G77A 4C6PA 3MDWA 3K4WA 3LSCA 2OQLA 2QVNA 2OB3A 3K5XA 4C60A 3F2DA 2I9UA 4GZ7A 2FTYA 3B0XA 1P6BA 3PNZA 4LH8A 4RDYA 4DNMA 4PCNA 5HMFA 4L6DA 1XGEA 3AU6A 3B40A 3C86A 4KEUA 2PGFA 3E0FA 2VR2A 2Q09A 2ICSA 1GKRA 2YB1A 3LS9A 4H9UA 3OODA 4RDVA 1KRAC 3UF9A 1ZZMA 3LGDA 4JOMA 1ONXA 2FTWA 4XD5A 1NFGA 4GBDA 4PE8A 3V7PA 4C6CA 1V4YA 4QSFA 1PSCA 3AU2A 4C6MA 4AC7C 2R1MA 4RE0A 3RN6A 1IE7C 4NI8A 4UBPC 2OGJA 3F4DA 4GY0A 3URAA 1POJA 4CQDA 2EG6A 3JZEA 5FSEC 4BJHA 3TN3A 2EG7A 3E38A 1A5MC 1RA5A 3F4CA 3ORWA 3LNPA 2UBPC 4ZSTA 1I0DA 2KAUC 3IRSA 1NDWA 3PAOA 4DZHA 4RZBA 2Q01A 4UB9A 2HBXA 3A3XA 1EF2A 2R1PA 3MDUA 2EG8A 4G2DA 1YBQA 1A5LC 1NDYA 4IG2B 2HPIA 1O12A 2QT3A 4TQTA 3GTFA 3ID7A 4RDZA 5FSDC 3WMLA 4C65A 4CNSA 4KQNA 1KRMA 3UR5A 1M7JA 2FFIA 1QW7A 2BB0A 4QROA 4H9VA 3A3WA 1K6WA 4C6DA 3GIQA 1JGMA 1FWAC 4R85A 4HA0A 1RK6A 4IFRA 2Y1HA 2PAJA 1J6OA 3SFWA 1KRBC
chains in the Genus database with same CATH superfamily
1VFMA 3I7QA 1GOKA 3HGJA 3M43A 3SI9A 2GQ9A 5BRBA 2A21A 1C93A 3RITA 2YBUA 1IEIA 2KZHA 4QNEA 2J6XA 2J47A 1AMYA 2SFPA 1F3XA 1SO3A 2C79A 5DXXA 2PGWA 1I75A 3UG8A 3T78A 1WZAA 2B7PA 5JVLA 3WEOA 3PBYA 3PBUA 5A6BD 2DSUA 4AWUA 4ZQRA 4UTWA 3MJYA 3VA8A 2QJIA 3GYEA 2WSPA 4QHRA 4GYKA 1EC7A 5CSUA 2A3LA 2Y5SA 3A24A 3W2JA 1L6YA 2EO7A 4V1YA 1ICPA 3CZKA 3S8HA 4O53A 1BYBA 4Z1BA 1H4PA 3AAMA 3NFUA 2PWHA 3C8FA 1D8CA 3NQBA 4GYPC 3MCOA 1O1HA 1KQYA 5GPRA 5F2GA 4LUSA 5CBBA 1KCLA 5CPOA 1YRRA 2XVNA 2PLMA 1OYBA 3AHYA 4AHPA 1UYQA 3NM3A 2H9AA 3P61A 4HOZA 1REQB 3MWAA 2J7FA 3PZGA 4U3CA 2WPGA 5AVHA 3MSDA 1TWZA 2AGKA 3FFSA 2R8WA 2P5NA 1OB0A 2PDFA 1XIBA 1V6XA 4YXGA 3KVLA 1K6AA 1BG9A 3MA8A 3RLHA 1AJZA 3ITVA 3SCUA 3IK2A 5ABFA 4O1DA 2BNJA 5GJNA 3WK3A 4AD1A 3PFRA 3UG4A 2I56A 1VIZA 2BVDA 3E3HA 1F4AA 4GXPA 1FKXA 2WC3A 3QEZA 4BWLC 3DEQA 2QDHA 3BCJA 4NZCA 5D4YA 3JVAA 4EWJA 2CETA 1XIDA 1CNVA 3GG7A 1RVGA 4IL2A 4HU3A 2NUXA 1Q45A 2YL9A 4D6JA 2VI0A 1KD0A 3O0FA 1B90A 5I03A 1P6CA 3EEGA 4KEVA 1PCWA 1TPFA 4GYPA 1ZRQA 1EA9C 4FF5A 3BARA 4E8GA 1UOZA 1GOWA 4LY4A 3P62A 4QCEA 2ZUTA 1LZOA 2PWVA 1JDCA 3JS3A 5EB8A 3UXLA 1Q6GA 3THDA 4MYXA 1UB3A 6CGTA 2W67A 2HBVA 1DIKA 2Z1KA 4MB3A 4CNPA 4C1NA 1UBPC 2VM8A 3FS2A 3B05A 4DBEA 2Z7GA 4QLJA 1I2PA 4D9PA 3GD6A 2PDCA 4AF0A 5BYWA 1AK5A 2UY5A 3TWBA 2ON3A 3E0LA 4UZUA 5E0CA 2AL2B 4D8LA 2IQDA 3FEMA 2PTYA 1OWQA 4ICCX 4CQAA 2ZC1A 5D2XA 2F8QA 3E49A 4IIEA 4UTJA 3VUPA 1VLWA 5CH9A 3WLRA 3L67A 4D6HA 3ZIZA 3MV01 1ISWA 2FTPA 4H19A 5D30A 1OFEA 3MHFA 1WNOA 3CV7A 1UR9A 1EDTA 4BHYA 3N2TA 1GW9A 2OOGA 2DSWA 4FNTA 3KLKA 3GBDA 1I45A 3R11A 3S2CA 1WXJA 1ICSA 3W73A 2OEMA 2PGRA 4HQVA 4WGXA 3VPLA 4PMJA 2UY2A 1V0NA 5K9DA 3A47A 4B5NA 2HS8A 4PBGA 1QNPA 4A8IA 3CH9A 4RNHA 4YTTA 3PUOA 4J3SA 3B0YA 2G4FA 2VWSA 3CHFA 3N12A 3R94A 4HMDA 1BXCA 1JZ2A 2REQB 4FLOA 3NWRA 4F0RA 1O4UA 2P53A 4LAKA 5A6SA 3NYZA 2WNWA 3VIFA 5KITA 3S2NA 1V93A 1OCBA 4U3AA 3GRIA 4AXNA 3U9IA 1GVOA 3VD7A 3IUDA 1XW8A 2OB3A 1KV5A 3NZQA 3C6CA 4JZ5A 4F2UA 4U10A 4W7VA 1NFBA 1W1B1 3UYIA 4HYWA 1CBGA 2ZCGA 2ALDA 3FNDA 1SFLA 2B7OA 2WVVA 4MDOA 4L1WA 1TKKA 3GC2A 4NQ1A 1KRAC 3LK6A 1I2RA 4ZA0A 1J2WA 4J7RA 1QMLA 4EANA 3WQPA 3LTSA 7A3HA 1PSCA 1W17A 3DYMA 3V75A 3R43A 4WKFA 3R89A 4AZCB 1XIIA 2V5KA 4GY0A 4FB7A 1F8IA 3MZNA 4BJHA 2BVYA 2TYSA 4O13A 2C13A 4D8AA 3ORWA 2Z1BA 4QJ3B 3JZUA 2UBPC 2YA2A 3H2NA 3KWSA 1KXVA 4CKQA 1EDQA 4RZBA 4MM1A 4UR7A 2WHKA 4KIEA 3HFYA 4LGXA 3W7LA 1EF2A 3NIYA 2JKPA 5I79A 5I0DA 2OZ3A 4UTWC 3LXCA 3QM3A 4Z2LA 1WX0A 4HNOA 3U0HA 2QMKA 5FA5A 1S2CA 1K6WA 4AWSA 1YXCA 3OZOA 2IKIA 4KH2A 1CGUA 4I90A 5A6JA 1KM2A 1G1YA 3SURA 3V0SA 3QQ0A 5AECA 4ZO9A 3A3HA 3M5ZA 2J9ZA 1NWUA 4E38A 2G50A 4PUEA 2OWCA 4QDMA 3AIWA 3OQ8A 5DN1A 4GX9A 4MVAA 3WBAA 3ABQA 2AGTA 3HIJA 1VBRA 2IKGA 2CHNA 4QAIA 4CNNA 1QBBA 4OQVA 1GYMA 2WXDM 3IIOA 1V3KA 3M1ZA 5RUBA 5AYYA 1VPQA 3EKZA 1E1CB 4GBUA 5BWFA 4RW3A 3GDBA 3W7HA 2JALA 3A13A 4B2DA 1W37A 2X1SA 1CXHA 4AIBA 6XIAA 1JI1A 1SJBA 2E25A 4QFUA 1A5NC 1G9HA 2ZX6A 3GNXA 2ZWZA 2NQLA 5A6TC 4DWSB 4J35A 3B8SA 2XIOA 1EQCA 2PDWA 1R2SA 4V15A 4MFDA 3W1PA 3I4KA 2W9MA 3MY9A 3O6CA 4CLMA 2DIKA 4KW2A 3WBXA 3RJXA 3VIPA 1W9UA 1FH8A 1A53A 1UC5A 1T8QA 4NX5A 2PDNA 5I3IA 4FLSA 5CPSA 2VFFA 2G95A 2X8RA 1VIWA 1J6PA 3VNYA 4QE1A 2W0UA 3B8VA 1PHWA 2XH2A 1ZCOA 5AY7A 5CGMA 1HNYA 2VZSA 3VDCA 4WXYA 1HUVA 5C9RA 4IMDA 3U4FA 3GTHA 4O1CA 3GFYA 1LM1A 4U28A 3CBWA 5FF0A 3V5FA 4MDPA 1HXJA 1F6PA 3ARSA 3KRUA 4LW7A 2BASA 1UR4A 4JEJA 4WSHA 2NT1A 2VURA 3M0JA 1LF1A 4XIAA 1XGZA 2WPBA 3IGXA 3B0UX 2A6LA 1HL9A 4R3UA 1TG7A 4KRUA 2ZZ1A 4D8ZA 1B30A 4U2YA 2OLHA 4UOZA 3AS2A 1H63A 3GXIA 1B3ZA 5LNUA 1PZ0A 3ARZA 1VCGA 2I5IA 1A5KC 3HURA 2XM2A 4KBXA 1TPDA 3CZ8A 1LOLA 3WYZA 1ZB5A 3DFPA 4E4PA 1NF7A 2XWEA 1FHUA 1W1TA 3OEXA 2WJFA 3WH9A 2JFEX 2RHGA 3W2NA 1YMYA 1TWIA 1LORA 3CL7A 2Y8UA 4M19A 5LNVA 1O5KA 1ZBCA 3RCYA 3WH6A 5D32A 5CG7A 2TRSA 3T8LA 3LMZA 5AC4A 1QI3A 2VX6A 2V3FA 2VQUA 2VVSA 3KP1A 3ZJKA 3O9NA 5F4XA 1V51A 1H0GA 4LYPA 1FWRA 4DY1A 1K7XA 2PWUA 4PTMA 3CUXA 2ZE0A 1J96A 4PFHA 4JPGA 3SY1A 1KXQA 2QF8A 3AJ7A 4EXQA 1U22A 5HBFA 1TREA 4C5ZA 1W5PA 1UA3A 1XSKA 4H1ZA 1A5SA 2XM1A 3HN3A 3C8NA 4M3PA 1HKVA 2HNHA 3GU1A 3NVDA 1A4LA 4KFOA 3WFZA 1F73A 5U4NA 2CZVA 1RPXA 2IKHA 1UBSA 3R58A 1VF8A 3KCJA 2J77A 3CO4A 4LVFA 2DJXA 4P7NA 4X2RA 5C2CA 1DYSA 1MUWA 1N8WA 4H6RA 1EBHA 3EWUA 2OCZA 3H24A 3PN8A 3W4RA 3HPSA 3WDPP 2WC4A 4BWLA 5KZ6A 4P5UA 1KR1A 4FALA 3VNZA 5IFPA 5BXPA 3VNDA 4B92A 3VZYA 1J0ZA 4F0SA 3DFQA 1R3QA 3K13A 4ROPA 3FJNA 4QBXA 3TYCA 2QPXA 2YIHA 1J01A 1HJUA 3OIHA 3D0CA 5FOOA 3SW6A 2VENA 3T07A 1QUMA 3HBLA 2PLKA 4XKYA 1GOMA 3EOSA 1F07A 4D6GA 1CXKA 3G77A 1JNDA 3POCA 2F2KA 4C60A 4G5DA 1C9WA 2FTYA 1ML1A 4DXXA 1QW9A 1GYLA 2DT3A 2VR4A 1H60A 1PZ2A 2PDHA 1JZ7A 1LLZA 2FIQA 4N9BA 4DUOA 3SUVA 1ZY9A 2Q8XA 4W86A 3DERA 1SQ7A 3RFAA 5C2XA 3LLFA 3LRLA 2NSOA 4C1LA 3N73A 3QVQA 2F9RA 5K3VA 4GO8A 1KKOA 5IBXA 4NX0A 1OFDA 5DCEA 4WXZA 1NP0A 4Z2KA 2X7WA 1ECEA 1X1ZA 1LQ2A 2EXOA 5LNWA 3JZEA 5FSEC 3B9AA 1RVKA 4J28A 5HANA 3W2KA 3FLUA 2X1IA 3QOKA 5MKGB 2PWGA 2PWEA 1U83A 2A5HA 3NDYA 4IZGA 4I8YA 1IIGA 2C19A 1YE6A 1CZ1A 2E28A 1TELA 1DP0A 3MHGA 1OX5A 3RR4A 1X7IA 3EEZA 3CUFA 2QUTA 1F9CA 1R47A 5GNYA 2GQAA 4Y96A 4U33A 3VABA 3FGCA 4UQBA 3ID7A 4AF0B 2ISFA 1EA0A 4AC1X 3EMQA 3UGRA 4EX4A 4XISA 2ISWA 4KWSA 3JW7A 2YZRA 5AHIA 4H9VA 1JYWA 4JY8A 3H2FA 4JTIA 2I9EA 4HA0A 1UJPA 1NSJA 2E5CA 4DUVA 4W7WA 1TMQA 4IP4A 1GQIA 3KVJA 3TOYA 4XAZA 5DRIA 3A4JA 4UFJA 3BAWA 4KESA 4JTEA 4DUXA 4O0KA 4IICA 3POHA 4ZTYA 1HN1A 3PAJA 3WQVA 4X9YA 4CEUC 3IVTA 1TV5A 4QXIA 2DZBA 3TWAA 3LZ5A 3SCOA 5K9CA 2YA0A 1BVWA 1V08A 1RA0A 2JEPA 2O0TA 4Q4MA 1KTNA 3IUIA 3EX4A 4KRTA 4C90A 3D6NA 2QEZA 1CW2A 1MFUA 2H9AB 4AW7A 4IFOA 3VX0A 1XS2A 1JCYA 2WM0A 1QDSA 4X3ZA 5FJIA 3M5VA 5EKYA 4GJ1A 4Y8FA 4URIA 1US2A 1X38A 4UNIA 2NVCA 2Y6ZA 4PODA 2XYLA 3IIVA 1S38A 3BCFA 3Q65A 4UNLA 3ITLA 4RX0A 1QCWA 2RDTA 4DZ5A 3N9SA 2GDUA 2GSHA 3BSHA 1AG1O 2QULA 2NW0A 3QMRA 3V5OA 2BTMA 1FCBA 3DFHA 3CC1A 1QNSA 1YNYA 1M6JA 3O05A 4EE9A 4QLLA 2R1KA 3W3OA 1N2VA 3RIKA 3P60A 4BF9A 2DW7A 3NCOA 3PPCA 4BFAA 1UZHA 4GXMA 4NJGA 1SFTA 4ZZ9A 2D3NA 1UCWA 3WLOA 4BZYA 5E93A 3WLSA 1TE6A 2FQIA 3RCMA 4U5KA 2YFNA 4OVXA 1PYMA 2GOUA 2X1TA 3TXVA 3F4WA 2OLAA 2YCJA 1CB7B 4IUOA 4GPNA 1GPFA 1Q6DA 2QAFA 2WC7A 2WW5A 4BEQA 1NJJA 3MCNA 1TJRA 2D0HA 3STCA 2IMRA 4C7FA 4JQ2A 3EXSA 4GIYA 3MQTA 4LANA 1OT1A 3SUWA 4XZ9A 2E6YA 2C1IA 3FA5A 1JXJA 2DQWA 3OTRA 4QRNA 1HW6A 1E6QM 3AIRA 1DWJM 3PF3A 1BXBA 4YHEA 4ZSUA 1W9XA 3GQYA 2XZ7A 2WVTA 1U5JA 2OELA 1F3EA 3ARYA 4K37A 2VTFA 3UZWA 4L56A 4G56A 4AU0A 3KBJA 2ALRA 5CLTA 4ZVJA 2OJPA 4Q8PA 3TIMA 4Q8VA 4O57A 2WAGA 5CC5A 2Q8LA 3R7MA 3RCNA 3B04A 5HMDA 3AXXA 1V0MA 1I2OA 1TCMA 4L5ZA 1E9LA 1SJDA 1UP0A 3KTCA 5HWNA 2PUZA 4HTBA 4K2SA 1C8VA 3GAKA 4RE4A 4FPSA 3NUKA 1GHSA 1TQJA 4KWUA 5HJLA 5D03A 5A8PA 4KEZA 3GXMA 4I3GA 3RU8X 3NQFA 2PF0A 4S39A 2C0HA 3N11A 2HISA 2RKXA 2VEPA 4TX8A 3E6EA 3K30A 3ZZ1A 3F03K 2VOMA 1KM5A 4IPNB 2Z1XA 1FCQA 2J8TA 1LCOA 1KWKA 3VI2A 3OZYA 5JMUA 2J24A 2VP8A 1IZJA 1FWJC 2E6DA 3CV6A 5HMEA 4DAIA 4O4WA 4HZ6A 1BFNA 3WNKA 5CEWA 4CGTA 3XIMA 4L4MA 3L68A 1E9ZB 1PYFA 1UWAA 4FA3A 3LHUA 4RR4A 3QKZA 3DI1A 1LLWA 5BXRA 3DHPA 4JQ4A 1QR7A 3WJWA 4P7RA 2FZMA 2Z24A 1JF5A 3ZO9A 3NZRA 1AW2A 2ZX7A 1BWKA 3ATZA 3NO3A 1GZGA 2G3JA 3B8DA 3QQWA 1QOPA 3CZGA 1C29A 2JIWA 4V2XA 3TTYA 4JX5A 2WBGA 4R5EA 1JUBA 2X1RA 3ARWA 1JF6A 1PIIA 3UJFA 4LUSB 1JPIA 3LM3A 3D3AA 5PTDA 4E6MA 4GFIA 3CGTA 3W1XA 2C18A 1GVQA 4F3HA 2DW6A 3OODA 3DGRA 1FWTA 3FW6A 2ACQA 3STGA 1Q2RA 3WEMA 3FY1A 1QASA 3VGBA 1Q8JA 1E3ZA 2GJPA 1WOBA 1DJQA 2WNQA 1MW1A 4GCXA 1JXKA 2W5FA 5DEZA 1WDQA 2Y5EA 5K9XA 2WVSA 2Y24A 1POJA 2WBKA 3VIIA 4X2PA 3W7PA 3PTQA 3TSDA 3L23A 1Q65A 1Q3NA 1SSDA 1A5MC 3V1HA 4MMWA 4IM4A 4QAWA 5ABHA 1UPMB 1WAWA 4AVFA 3EOOA 1I0DA 4XIMA 1KGWA 3S83A 1WDWA 1E43A 2ZUMA 3P5YA 1BHGA 3N4EA 2EAWA 3SM0A 5AHFA 5HPCA 3IAPA 4XZMX 2V0TA 4HB7A 3BANA 1DBTA 3BMVA 4M24A 2XIIA 4KWOA 1K9DA 4JIIX 3GZAA 1ZP3A 4PUUA 1X7FA 2X30A 1ADSA 2XZ9A 2FDSA 1FHDA 3A3WA 3VD5A 3AYSA 3DGBA 2PWFA 4DJEC 1K7EA 2AQWA 1UZ1A 1IV8A 1VC4A 3SUUA 3PSWA 3OHIA 1VFUA 2BGNE 2RDUA 2B81A 1YNQA 3NG3A 4UQCA 4IG2A 2BMBA 2Y4SA 4FX7A 3QYQA 1MZHA 4RXFA 3QGAC 4J3XA 4CD5A 2FMOA 2QGHA 3GG8A 4GNJA 5HK4A 4O12A 1IT0A 4HK5A 3V35A 3R8HA 2DVTA 4H9ZA 1UC4A 7ENLA 2UZ9A 1LRNA 4UTTA 3VDGA 3REQA 4JIPA 1ZJHA 3DX5A 4E4UA 3QW4B 1ZU8A 2VMFA 3W1QA 3NURA 1QHZA 3N19B 4J5NA 1IIHA 5M03A 4A21A 4QS5A 5LA0A 2VEKA 2V5CA 4QS6A 4GYFA 4V33A 1BTMA 3BAXA 5F1UA 4DUWA 1CT5A 3OIXA 3WD3A 2EQDA 4C5YA 4EK7A 1IR1A 3KOYA 4UCGA 3UJRA 1H1ZA 4IGNA 1FDZA 2YL5A 2R1LA 4NXKA 2PCQA 2YXOA 4WSKA 5CPQA 3CWHA 3R79A 5D9MA 4IQDA 4A2SA 4GX8A 1GOOA 4A3YA 2VEFA 4WSJA 4Q4RA 2QPUA 1VEMA 3RDKA 4NAFB 3VKAA 1DVJA 1KM0A 2E9MA 1PDYA 1YX1A 3UZ5A 1G4PA 1SW0A 4TV6A 5EMLA 4N02A 3ARQA 3EPMA 1XIHA 4PSRA 1NDVA 4OJYA 2ZWYA 3IJLA 4J2PA 4DZIA 3UG5A 2V69A 1RZMA 1LL4A 1UD5A 1C3FA 3W76A 5HQMA 1FWEC 3AZSA 1YTKA 1VRDA 3QBUA 2QKFA 4PMVA 3ZR5A 1JAKA 3HGOA 3DBNA 3E74A 4LF2A 1ITQA 4LVGA 4PB3A 1X98A 3VOGA 1JFXA 3TC6A 3AMCA 3PZNA 3PANA 1TFVA 1HKWA 3SCNA 2ATMA 2Y7GA 1XLBA 2WSQA 3TU9A 1TA3B 3TW6A 2ZDRA 2A7PA 3DFSA 1VQTA 4W85A 1MXGA 1OX4B 3AIQA 3E9AA 2YDRA 2WO5A 4N0RA 4FMVA 2GGHA 4MLRA 5MHBA 3S2MA 1SYTA 3NEHA 1QWGA 2DEPA 4CCEA 1O6IA 1YPIA 1S5TA 4H2CA 3FX4A 3AXKA 4MJMA 2AOSA 3HGRA 4Z2HA 4LNCA 3TSBA 4AY8A 3KW3A 4YPJA 4JCLA 4JTDA 4AFYA 1ADDA 1YPXA 3D3FA 4IJBA 1LUCB 5A94A 1F2JA 1CX9A 4RZ5A 3RG6A 2YA1A 5A6LA 3IRDA 5HUOA 2JGQA 1GKQA 2J8GA 3HMJG 2BZNA 1GZ1A 5G1TA 3SRHA 3S6OA 5LGZA 3VNIA 2MANA 4Z42C 1BYDA 1Y7VA 2ZUSA 1EP2A 3GU9A 3ISIX 4R88A 3IEBA 1K02A 1ZAHA 3NQCA 3L4ZA 3T8QA 3W71A 3B9EA 4NNBA 4F9JA 1X39A 3M5XA 3GFZA 1C91A 4FK9A 2QV5A 2C91A 1VBHA 1VAHA 1R5YA 4XBJA 1VH7A 1XIJA 3QPYA 4C7GA 2Z6JA 3IJ9A 4IIFA 5FCZA 1A49A 2CWNA 1KM1A 4KERA 1QNOA 1S5NA 1WPCA 3AIUA 1GQLA 3M64A 2Z26A 1S1PA 3W38A 1SZEA 4MY8A 1UMYA 3CTTA 2YJQA 3OLEA 4XX6A 1TZ7A 4GVFA 3V1PA 3L9CA 4GHRA 1BYAA 1TRIA 4FO4A 2POZA 4UUIA 3SFKA 1OZMA 3RO8A 4M6QA 2VRQA 4E2BA 5DFAA 1QI2A 1TR1A 1CWYA 1DIDA 3O6AA 4A3RA 5C9XA 1W3NA 1MNZA 3O2LA 4AYGA 3TCSA 4MJZA 4UNKA 3W7RA 2GLKA 4J3ZA 1JQXA 4HU8A 3KHDA 3UR8A 2J13A 1FX6A 4TX9A 3OHMB 3F2DA 3WF1A 3GDRA 2H3BA 4P8WA 3EDEA 1HIZA 2V82A 4XVDA 2PD5A 5KEZA 5CPNA 4B3KA 4BF5A 2Q09A 3V0TA 1EEXA 3CIXA 4AIOA 5HULA 4NL1A 3HJZA 3EX1A 2ZXDA 5K7JA 4Y9NA 3L2MA 2RDXA 3SJ3A 3LLXA 3GKFA 3W7NA 1KW1A 2WJZA 4D2JA 4Y6GA 2DPEA 1MDRA 5DXYA 2P0OA 4JHZA 3URAA 5A1AA 1E9IA 4PN2A 1V3IA 2Q6ZA 4M7TA 3GDMA 2DIJA 4UR9A 5M1TA 3F5JA 1R7AA 1JI2A 5JU6A 2YW3A 3AYTA 3PWIA 5GJMA 2VZUA 2DFAA 1X1NA 4ACZA 3EB3A 3ZM8A 1KXHA 3W75A 3I3DA 1F76A 3ES7A 1A5LC 4I5RA 1NDYA 2HPIA 3GXDA 3C0LA 5HDRA 2YCLA 3VDAA 5H8PA 2JKAA 4A8LA 4YU1A 1GZJA 3PG8A 3GBEA 1FWAC 4R85A 2QJJA 3QTPA 3A5VA 3DECA 2VCBA 3ARTA 1E5NA 4B90A 3L4WA 3IIXA 2WJEA 1W1VA 3FYOA 3F4NA 2ZYFA 2QV4A 3T4CA 2ESCA 3A23A 1L8PA 4GYJA 1BVNP 1W0MA 4XZBA 5DY3A 3WDHA 4FNRA 4TO8A 2C1HA 4K7VA 1OFOA 5ABFB 4L80A 4N42A 1K7FA 3RX3A 3WQ6A 3EWBX 1J9YA 1YADA 5HNUA 1RD6A 4DJFC 4H3DA 1S5MA 3USBA 3W72A 1DHKA 1CGVA 5BU6A 2INZA 3CPUA 1S39A 1UUOA 1V02A 2XDFA 1H1YA 3UETA 4ATDA 2WMHA 1G94A 1V5XA 5LIYX 1OIFA 2VGFA 1TTQA 4LAOA 2QCCA 2QUMA 3GTNA 3PJXA 4JN7A 2CLEA 3OOQA 3BGJA 5D9OA 5IHSA 3R2GA 2HE8A 2V38A 3QR0A 5BNKA 1VCVA 4PC8A 5TQLA 4Y90A 4C6KA 1LL7A 4MWAC 4PEKA 3UBPC 4QCFA 2CBVA 1KGUA 3MMUA 5TIMA 2GSEA 4OE7A 1UMLA 5EPDA 2HXTA 3TXZA 1A50A 3W22A 3BSGA 3KL5A 3QPEA 4QJ4B 1BSLA 1TWWA 4M8UA 5LIWX 3PZUA 1R3YA 3E5BA 1Z44A 2WKJA 4LV9A 3MSRA 3F2CA 5E0FA 3ABSA 1XLJA 3CUJA 5CC7A 2NV9A 3NSNA 5I02A 2E40A 2IPWA 1MMFA 5D05A 1OT2A 1GVIA 1RY8A 1VFTA 1CGWA 2IQTA 4H7CA 4WD0A 2CWXA 1GT8A 4LAUA 1TPWA 3OZMA 5BWAA 3DAQA 3WQ5A 2OQHA 3KDNA 1KFWA 3EOUA 2REQA 5FJRA 3ZJ7A 3BGAA 1JYNA 3M41A 3P84A 2AL2A 3N9RA 1DIOA 3GNPA 1M53A 3EA2A 3EGJA 3UPBA 3GTIA 4Q4PA 1FWDC 3W1MA 4K68A 3VNMA 3G1VA 4WKAA 5TNVA 2PTZA 4IIHA 1EIBA 2GVEA 1LQAA 5E0KA 2GJXB 3UA4A 3ABRA 1ISVA 1J0HA 1VFFA 4IOTA 3LHTA 2RGLA 1U5VA 1MEWA 1C8YA 1EOMA 4PUMA 3WUBA 2ZX5A 5I78A 1DWAM 3F5KA 2IKJA 3FVDA 4YTRA 4ORIA 3QSTA 1HZYA 4AD3A 2NQHA 3TLQA 1LRQA 3MJMA 4WCJA 4Y8EA 3NO1A 2JIEA 4AB4A 1HT6A 4DHGA 1PPIA 3VIMA 3FAXA 4OV4A 3MUZ1 3FXYA 1WA3A 4WHBA 4CUCA 2AL1A 4XTDA 5TBOA 3OG2A 1Q4NX 3SQLA 1P0NA 1EIXA 3R10A 5JQ9A 1FDYA 4MNKA 2DH2A 3AZRA 3DU0A 4JTTA 4O1EA 3MZ2A 3WNPA 2EPKX 3L4TA 3TYEA 4EPEC 3TFXA 1SZRA 3MMWA 3I3EA 3YPIA 1SJCA 4FI4A 1XI3A 1D8WA 5C0QA 5C54A 3OU8A 1ZCCA 1WOAA 1S5WA 5M3WA 3M6YA 3M4HA 1ADOA 1PJ9A 1SMDA 2JQXA 3AIBA 1XYCA 1ME9A 5G1YA 1TR9A 1AQFA 2NV1A 4WRHA 4YVVA 3CJPA 2RUSA 3LYEA 2YBTA 1FP8A 1RJPA 4XKYB 1TPVA 2VC7A 1IZKA 3VGHA 3WLIA 1V0LA 4FF7A 3WJYA 1OYCA 1XH2A 1XLCA 1QU4A 3A9BA 1B5TA 4C6JA 4QISA 4Y9PA 5LNRA 3W85A 2OZTA 4QP0A 2AQVA 4NNCA 4NZ3A 3WLQA 1OY0A 1DJNA 4I7VA 4UQAA 2QCMA 5LXXA 3VCCA 1IHIA 2E8YA 3LM7A 1ME7A 3H2OA 4JL1A 2HPMA 2OMAA 1QK2A 4UC5A 1C8XA 1PS9A 3GHTA 4DYJA 3WEZA 4PMUA 4WK9A 1W5OA 5A2AA 4DF2A 1BRLB 4MUZA 4MSSA 5C6MA 4IF2A 5H1WA 3WKZA 5G4HC 2WSYA 5DO8A 1TCDA 3NL5A 1JQVA 3ZT7A 1DJGA 4XG1A 2EPNA 1LUCA 2OWXA 3B0XA 2LLEA 1U2YA 1VYPX 4N4PA 1SUXA 2QUVA 2XGIA 2NVAA 4TX6A 2VC6A 1GKRA 3H70A 3CHEA 1DEDA 4H9UA 1ZZMA 1GVFA 4D6DA 2VQTA 3MS8A 1VFHA 1Q6LA 1KC7A 3CAQA 5IOBA 1LG2A 1V4YA 3U3HA 4XBSA 2E3ZA 4YN5A 3GY1A 3LBMA 2WB5A 3BLIA 2J7GA 4LAZA 4ZO6A 4ZMGA 3DC0A 4LS0A 3LHZA 3RX4A 4HA4A 3BOFA 5GNXA 3GVGA 1LBFA 4JKLA 5HJXA 3G1SA 4ZOEA 4Z17A 2CLKA 3SGZA 3GVRA 4AUBA 3WH5A 1EYEA 2C7FA 4B5XA 3CIVA 4PTVA 3SCSA 5DX7A 4BR1A 1RBOB 3CUGA 4QGCA 4NJHA 2JK2A 3HJEA 5M5DA 2VWTA 4X60A 5FEWA 1E72M 4R9XA 3LQLA 3W25A 2OPJA 1RXOB 1LL6A 2TSYA 3G1AA 1E4IA 2PWDA 2HK0A 4L9XA 1FKWA 1JZ5A 4LCQA 3A22A 3T09A 5F4WA 3W37A 4XO7A 3VOCA 3N2CA 5EU9A 3O3RA 2E5BA 4PCTA 2HMCA 2CLFA 2V5JA 1T6MA 1VEOA 1F05A 5BMWA 3VIOA 3KBWA 4WVXA 3S3GA 7REQB 3P0WA 2OX1A 1UR0A 3ZR4A 1YXYA 3L5LA 3NOYA 3U2OA 4C6BA 1ISZA 1JZ4A 1XIGA 2WCAA 4J3UA 2OVLA 2WNNA 4B5SA 5DRCA 2RH9A 5FAJA 4S3CA 4NYUA 3T40A 4GK8A 4Q8UA 1MQQA 3KLLA 4OV9A 1VFOA 2P50A 3LGGA 5D2YA 1MEIA 2ZRWA 2V5BA 4FXSA 3ZXWA 4J1OA 4O16A 2HNEA 1DQUA 1BGGA 3P7YA 4XAGA 4YNGA 4PL1A 4IMFA 4JX4A 1SW3A 3SN4A 1EWEA 1DORA 1SO6A 3DESA 3VKBA 1DIEA 4W7UA 2ADAA 4P2VA 5LHFA 4KEMA 4O18A 2AKMA 4CU6A 1CDGA 3W2MA 2V30A 2A79A 1J79A 5FEPA 1YW1A 2X16A 5HINA 3GHRA 1FH9A 2BV9A 4WDXA 4DM1A 1JFHA 1GWJA 4PUWA 3STEA 3THUA 1HL2A 1NWRA 2I5GA 4D6EA 3VIGA 4N9CA 1AH4A 1E6ZA 3CASA 3HU7A 5AHEA 2GQ8A 3SIMA 1TV7A 1PXGA 3WD1A 3WLJA 3NXFA 3C2OA 1PAMA 5CSYA 4F9DA 1HJWA 1R6WA 1XRTA 1HO4A 1N8IA 4XB3A 2XSAA 4M6VA 3AJXA 1LJYA 3UXAA 4O1AA 1N55A 4NAEB 3ZSTA 3H2AA 2X0SA 3CUIA 3NOEA 1BLIA 5I3DA 4Q8OA 3PFMA 1BKSA 5LSMA 4DJDD 4YHGA 2G41A 1JUEA 4D72A 2DZWA 3AISA 4ATLA 3PNUA 3S5SA 4JTHA 3AWOA 3WFAA 1XISA 1ZL1A 3H4XA 3ME3A 2VUNA 3MMDA 2I7GA 3PWGA 4GOAA 1W1IE 4JYEA 1F5ZA 3SCVA 3DENA 2IPFA 4W87A 4HA3A 5HJYA 3SCQA 1OVDA 4K8HA 3TC3A 3W6LA 5D33A 3C56A 3WQWA 2XN2A 3W7MA 5CZ0A 2A3AA 2FB2A 3W7OA 2D0FA 4UFIA 4XBKA 4YTUA 6REQA 1SFJA 3WQFA 2WVVB 1VP5A 2ZTJA 3KTXA 4UTMA 4WDWA 4MFEA 1NTHA 3W27A 2PB1A 3WNMA 3TQKA 1SVDA 4LC6A 4GQBA 1FXPA 3OA3A 1O5XA 5FEZA 1JZ8A 1LBLA 4XAYA 3PPFA 1KBBA 2O4QA 4WUIA 1NVMA 1M9HA 1ZENA 4FNQA 2CHOA 1Q7QA 3BLEA 4EPBC 4ZQMA 3T0BA 4MKVA 4AZCA 4LB4A 3W23A 1XM3A 3M6DA 3LZ3A 4RK8A 2C6QA 1OFAA 2C71A 3A21A 1M7OA 3W7DA 3C61A 3VILA 5AZ0A 4ALDA 1JRBA 4YL2A 3QRHA 3SSZA 3URQA 1EJRC 3SB0A 4OUIA 2ZUVA 1W54A 5REQB 4JX6A 2ZA2A 3T0DA 4J3VA 1UR3M 1P1MA 3LMYA 4MZ8A 3IACA 2XSBA 2GJLA 4DO5A 3K5XA 4GQGA 2DZVA 5LNSA 4HHMA 3W7EA 2VJXA 1SZGA 3HV9A 1ZFJA 5U7SA 1P6BA 2OT1A 3OLDA 3VIKA 4MWAA 5EBUA 4F2BA 4QITA 3EWYA 4RPQA 1FOBA 1ZBKA 2R94A 3TQPA 1JAEA 2PDUA 2Y85A 2O9RA 2BHZA 4UWMA 5HQLA 1A5UA 4C6CA 3VDBA 1EBGA 4LUYA 4N9DA 3W87A 2RDWA 3A6OA 4UXDA 3PBVA 3W6YA 3W82A 3UWYA 3IAQA 3FJ4A 5BRPA 1US3A 1Z89A 3DKJA 1GYNA 1WE5A 4O28A 6TIMA 3EBVA 3BZGA 3MKKA 4IJCA 8RUCA 2EJ1A 1OSEA 2E68A 4B15A 1T96A 1TYGA 1KFCA 3L65A 3UWQA 3I6EA 2DORA 3KBVA 2BS9A 4OIFA 3CH0A 2E6FA 3QYSA 1XBZA 1H0IA 4HHPA 3TW7A 4LV4A 2HWGA 3LERA 1HJVA 4HNLA 7PTDA 4RLIA 3R4IA 2QJMA 3ABXA 4GZIA 3N34A 1IEWA 4QEHA 1ZALA 3GYCA 2PRMA 4GACA 3CQHA 3H2CA 3T2OA 1TO3A 4ZODA 2DZXA 2HVNA 1OD8A 4KKXA 3B8UA 5AHLA 4NZJA 4HCHA 1EJUC 1ODUA 4GQQA 3A4AA 3W2LA 3F5LA 4GGBA 3ZQ9A 2NUWA 3P6LA 2QZRA 3NNTA 2CNCA 4HU0A 1DL3A 4LU0A 4POCA 4NUWA 1AL8A 3II1A 4M1BA 3VYLA 3TTEA 3KS5A 1EPVA 2XSXA 4OUEA 1UUQA 3M0IA 1H09A 4YVXA 2BVTA 4K38A 4XZWA 4TVDA 2Y61A 4ZR8A 3DBPA 2VR5A 4UMAA 4JKKA 3OQEA 3W1TA 2O7SA 1XFCA 4WR3A 2NQ9A 3NL2A 3AQUA 4RE3A 3OBKA 5FF7A 1TX0A 1E1FA 1CXFA 3ONCA 3V0UA 3ICJA 1JPDX 1X6LA 3LPOA 4DWSD 1R3WA 3NPXA 1IWPA 3G1DA 2X42A 1JG9A 3PZMA 2WKLA 1K1DA 3W7QA 4WY0A 1I0BA 3TCEA 4AD5A 2R24A 1E0TA 3TMLA 4MYAA 2VFHA 4DI8A 3GZ3A 3THCA 2FDMA 3PULA 4AD0A 2G37A 1DJXA 1RH9A 5F2IA 4JTFA 3CWOX 3QHNA 1Q7ZA 4PUNA 4TR9A 3TN4A 1QAPA 5AYZA 1XDJA 3LXBA 3RRXA 3LRKA 3UR7A 1ZSXA 4WJEA 1EKOA 4YTSA 1EXBA 4MAVA 5A6KA 3WQGA 2CBUA 1K8YA 3BVJA 1OFRA 4EP8C 3UWVA 3RLGA 3CZEA 1TTIA 1GQNA 4MNJA 1GG1A 4J27A 1J0YA 3PG9A 3FDKA 4MWAE 2A4AA 2NXHA 3VD9A 1BQGA 4XO6A 4ZFCA 2Y5JA 4Q8MA 3OO2A 1EHAA 5AN7A 1FWBC 1UD2A 5I77A 2CPUA 1TA3A 3IJDA 4QNWA 1ICQA 2DDXA 2CW6A 1M7XA 3NQ6A 1VKFA 4GE8A 3RPDA 1HGWA 3KTSA 5KMYA 3W9ZA 1PWMA 2Z29A 4H7VA 4KFNA 3K1DA 1AD4A 4H9MA 1U1UA 5J04A 3ARUA 3S1UA 1JCJA 3CXOA 1KKRA 1F8MA 5I00A 2OLSA 4JD4A 3WZ0E 3PJUA 1JDDA 4C6QA 1G4SA 3E0WA 3GNRA 4IX0A 4KPLA 4H9YA 4WQ6A 2DP3A 2Z27A 5GVJA 3UYCA 4UFKA 1PX3A 2F6UA 3SBFA 3IS4A 3AWNA 1EGVA 1GEHA 3UCCA 1J93A 2DY3A 3P74A 1LT7A 5HPOA 1IGWA 1TV3A 3DIPA 4J40A 5F4SA 4JTGA 4C6LA 2E1DA 1HG3A 3HV8A 4A6GA 4O54A 3W7JA 1XH1A 2WQPA 2QJGA 2B4GA 1NWTA 1J0JA 3WNNA 4LT9A 3LV6A 4NU7A 3WENA 3MT1A 1M65A 4A2RA 4MIMA 3W26A 5JIWA 3MTWA 1IR2A 3S47A 3T1GA 3NGJA 1X6NA 4Q4SA 5DBTA 4X63A 5T91A 2O55A 3RAOA 3S9IA 4O17A 4RXGA 4S3AA 2QYGA 3INPA 4S2CA 4LRTA 4BEUA 1FRBA 1HJXA 5LA2A 2NX1A 1E0XA 1OABA 2GGGA 3W1LA 1I2NA 3HG5A 3SUTA 3AYRA 2CHRA 1EC9A 3WMSA 7TAAA 2VUYA 2RJHA 1J8VA 5AVNA 2ZRZA 3PBGA 3UWWA 2XJ7A 2D20A 3HGSA 3BH4A 3CYJA 2Z2BA 2YB4A 4OBRA 1DWIM 2W66A 1XDLA 5TF0A 4UTIA 1I1XA 4X0NA 1Z8AA 2PBGA 2A3CA 3HTWA 2AAAA 2QCEA 4ICMA 2PE4A 4HNCA 1VFLA 3KS6A 2E77A 1SR9A 4PRWA 2I9UA 4N6EA 4L4PA 4IL0A 2XGZA 5BXTA 3ES8A 3PNZA 3TTOA 5LXEA 4LJ3A 4US6A 1OG0A 2QIWA 1AVAA 3CT2A 4GRSA 4KEUA 1A5AA 1MYRA 2HEJA 2A6NA 2VR2A 1XC6A 1F3WA 4UIOA 3NZ1A 1KFJA 1FWNA 2WMJA 4JOMA 4QG8A 3M07A 4DJEA 4AZ7A 3UWUA 4O19A 1H5YA 3VXGA 3FA3A 2YL8A 4QSFA 4EAYA 1EL3A 3BJSA 4C6MA 1PTDA 2GSJA 2R1MA 3G18A 3RN6A 1NEYA 2C16A 1RR2A 2V2CA 3TDFA 3MANA 1YE4A 2VX7A 5D9PA 4BQ4A 3BLKA 1VD6A 4S3JA 3ABZA 5FJOA 1Z6KA 4NZ5A 1NDWA 1PHQA 1UJQA 1EX1A 1QPKA 1U1HA 1GJWA 3A3XA 1NY1A 1RP8A 4GI6A 4S3BA 3VM7A 3N29A 1H51A 3KFTA 3JR2A 2L5HA 1OINA 5HWJA 1E5JA 1GOIA 1KRMA 1RY0A 2BXZA 1G0CA 1BVZA 3GH5A 4JTLA 2Q3RA 2ONEA 2OYKA 1UWTA 5I3JA 3CL8A 3SFWA 5E09A 3ZWSA 3DYOA 5E5CA 3ZFHA 3TROA 3PZOA 4A4AA 3AHTA 4MF4A 1XD0A 5H91A 3K4AA 5CBIA 1R2TA 3UESA 3TOPA 3I4EA 3B06A 3BAJA 5K2ZA 4YCPA 5I6SA 3UNDA 4JTRA 4U4MA 3HA1A 3W7IA 5HNRA 4WGHA 4AEFA 4ZEPA 3PB2A 4L65A 3PP7A 4RCXA 1JPMA 1RQHA 8XIAA 1EJSC 3BC9A 2HXUA 4GKLA 2GPTA 4KWVA 4IFKA 1L9WA 1A4MA 2CKRA 1O94A 3OLIA 2CLLA 1R38A 1YDNA 5CXPA 3DXIA 1P7TB 2V8ZA 3TEVA 4HNVA 3WLPA 3HG3A 1XYBA 1EHNA 3UZZA 1RALA 1UR8A 5HATA 2ZUNA 4IH3A 3AMDA 3O1NA 3BMWA 1XYMA 2VRKA 2V5DA 2QCFA 3F2BA 3CL6A 4IISA 3EMCA 1I60A 4MWAB 4J3WA 3HQNA 4DLFA 3AALA 1M03A 4DWSA 1VENA 4UTUA 4EIVA 1C7SA 1LWJA 1RCOB 4DIAA 4JTKA 2NQZA 1J2BA 5HUPA 4Z1CA 3URBA 2BG5A 4WF7A 4IQEA 3WDQA 3UU0A 2Q8ZA 3AS0A 1E0VA 4PB4A 3PBWA 4M6UA 4R34A 3W29A 3NVTA 1XINA 3U2CA 3BSMA 5IHRA 3PTMA 2EPLX 5HMSA 2R82A 1GGOA 1UZ4A 3EWDA 1XCXA 3NA8A 4O4VA 1Q8AA 3FHAA 3WMCA 3ARRA 4PMDA 2VZTA 4DPQA 1E73M 3QPZA 3WDIA 4GI9A 2Z28A 1H7XA 2PDQA 3ZYZA 3CU2A 2CERA 4BI5A 2HCVA 2QLYA 3GKAA 1R86A 1LP6A 3DYPA 3N25A 4Q4KA 3RNDA 4ECLA 2QHAA 1GG0A 1C9DA 3QR1A 3I10A 1QPOA 3PVFA 5A8NA 2OO0A 2WHMA 1UIPA 4Z1YA 3U5YA 3DG3A 4GFSA 1TJ2A 1QHOA 3W7GA 2E7FA 4JICA 1G4EA 4M51A 3GFXA 3S5OA 3EX3A 1IXNA 1ENUA 2YLAA 3M0LA 3L66A 3N6QA 3T81A 4BS0A 1XKJA 4KGLA 3CHVA 4AIEA 2PC4A 4Q7BA 1UUMA 3BG3A 3HQOA 4UCFA 2DUZA 3T08A 2XINA 1TVNA 4Q7NA 1SJAA 1CCWB 3NZPA 4L7ZA 1XGDA 1GVRA 4QQ3A 5DT7A 4DF1A 2NLYA 1OGBA 3KVKA 1RK5A 2VNCA 1B54A 3OW1A 5HOSA 4YIWA 1KRCC 1JDAA 3ZR6A 3IV3A 2DQXA 5CAHA 1B0IA 2NUYA 2GGIA 1EXPA 1BWVA 2DZUA 1E0UA 3HO8A 1UWUA 5HQEA 1EWDA 3DCPA 4O1FA 1AZ1A 3QKEA 3NPUA 4LPCA 3BMXA 5A6BA 3ZT5A 4DF0A 3ABOA 3C5QA 1RJRA 7ODCA 3MSYA 4ZOCA 4UTKA 2BLEA 2YL6A 2VEIA 2FJUB 3NGFA 2J27A 1L6FA 5G1MA 2YPIA 4Q7IA 1F6KA 3CEUA 4W8BA 3C3UA 2VDIA 1VRXA 2QCDB 3VGEA 4BQ2A 1OC6A 3LEPA 1K77A 4O50A 2C0AA 4Z0SA 2C1GA 3B4UA 8CGTA 3OJGA 1VS1A 5I09A 3AMLA 3EA1A 2FGBA 2ABBA 3K4WA 4TUFA 3H6OA 2QVNA 1DJIA 3L0NA 2VOTA 5I3KA 1CXLA 1CECA 1G7VA 4RDYA 1J5TA 1KBIA 4MZ1A 1OEPA 3BWWA 3UEQA 3WK2A 3C86A 3BK0A 1RHCA 1XPYA 2EJAA 2YB1A 1UKPA 7CGTA 4BI7A 2J4GA 1EQPA 5CAKA 3E02A 1US0A 2O9PA 1TV8A 5LZLA 2FHFA 1X96A 1N82A 3KP0A 1UWQA 4GGHA 1P7TA 2GQ3A 4AZ5A 4OWGA 3AZTA 4X22A 4AC7C 4RE0A 3V36A 2OGJA 1TSIA 2ZRVA 2VD8A 1Q6QA 1V6WA 2VC9A 2BODX 3NJ3A 4YWIA 3O6YX 2ZC8A 4TU1A 4NF7A 5DQPA 1A5CA 4NKCA 1RA5A 2XG9A 3WLMA 1NH6A 1GQKA 4P7OA 5EMJA 1MDLA 1NELA 3B3DA 2Q01A 2YDSA 4AX6A 4BQ5A 3EMZA 1WYIA 3VOFA 2XIQA 4BK9A 2QXWA 1FQ0A 2EG8A 3TKFA 4IG2B 1O12A 2CZ5A 1NAL1 3ITTA 1I2QA 2PDXA 1R7OA 1XCWA 4RDZA 4FIRA 2R91A 1NP2A 1XD1A 4X0VA 2FFIA 4RJEA 1JGMA 2VVNA 1JZ3A 4K1WA 4WY0B 2WWDA 2XFRA 4UTLA 5FACA 2PDBA 1E4NA 2V3GA 3TC7A 2D24A 1V7AA 1XYAA 2E9LA 1FFQA 2I16A 4L9ZA 2GUUA 4HZMA 3W7CA 4AWTA 4H6QA 4ROQA 5FIPA 5H2ZA 2AMXA 1KQZA 1V02E 4B2DD 4RE2A 2VGGA 2JF7A 3LTPA 3QZ6A 1G69A 5C7VA 1B57A 3H7RA 7TIMA 1E15A 4FLQA 5EMMA 4DBSA 4HKPA 5BOFA 4XSMA 4CNOA 4CQ8A 1UQZA 3SUSA 1UOKA 3I68A 2FMNA 4DJFD 2ISDA 1UH4A 2V9DA 3VOIA 4TTGA 3P8JA 4KFPA 1HP5A 4GQ0A 4OFCA 3QV7A 3PJTA 2A7RA 3N2BA 1EJVC 2WMIB 1P4CA 3LXAA 2FYMA 3BLLA 1H2JA 3IARA 4HYRA 3H2EA 2ZUUA 3KUMA 2V67A 3MU7A 3G24A 2OTDA 3W02A 5F1VA 5AC6A 2WYSA 3RMJA 1VYSX 3APYA 1JULA 1DJZA 4Z1AA 4EACA 4XUYA 5T9BG 2YCIX 4GY7A 1P43A 4YYFA 3WK1A 2HJPA 2DZAA 4R53A 3VAVA 2GWNA 4HD5A 2FLIA 2W3ZA 3QY7A 2VELA 1PIGA 4L9YA 2CBIA 2R9RA 3VNJA 1V6UA 5EBAA 1UH3A 4NZ1A 1XL9A 5H8MA 1DTNA 4PH6A 2R1NA 2E0PA 2ZVIA 3WFLA 1VHNA 4PB5A 3WN6A 5C8BB 3I65A 4S2BA 1V7YA 3PZTA 3TUUA 5AOUA 2YYUA 4GVIA 1RLCL 5EMYA 1X6UA 2TAAA 1G6CA 3E2VA 1XLEA 4D6FA 2DH3A 1XICA 5D9NA 1FWHC 4HCLA 4JFUA 5A6AA 4PYSA 1PX4A 1DWGM 4J3TA 1TZ9A 4XZLX 4LS1A 4F4RA 3UWEA 4JN6A 1ITCA 3LN3A 4CVUA 4AVNA 1GNXA 2P88A 3LNMA 3P3BA 4Q4OA 2CCRA 4ES4A 1EJXC 4U31A 5JBDA 2WHJA 2OFJA 2DUXA 4HZ8A 1R9XA 4CQ9A 4LF1A 1C90A 3GVQA 1P6WA 2ACSA 1IWAA 2FGZA 4HJFA 1UASA 3EDFA 3GHUA 1UQYA 4O8RA 4LCSA 3BXWA 3W84A 3NXLA 4REQB 3NZGA 1XSJA 3ALGA 5SWUA 1SZNA 3CB8A 3EB2A 3K4DA 1ZQ5A 5LYRA 2VYOA 5HR7A 1D2KA 4UOJA 3AUOA 3MSGA 4ERAA 4ICNA 3GIPA 3SCRA 4E8CA 2P76A 3WLTA 4DO4A 5D02A 1W5MA 4MG4A 2AMGA 4CU8A 4C6OA 4WOZA 3AI0A 3TN6A 1EO5A 3BL3A 3TV8A 3COTA 4OT7A 1OFPA 2H8XA 2PU0A 5I24A 2X0YA 2EPMX 2DVUA 1TPEA 3ANVA 3VKJA 1SO5A 3SCTA 4H04A 4HVXA 4GIEA 3M0MA 4I9TA 4B4FA 1VJIA 3CHDA 1XYZA 3RM4A 3U7BA 3CQ0A 3W53A 2X41A 2J7DA 1AW1A 3L4XA 1AODA 3BURA 3CS2A 3B03A 3N9KA 4ENLA 2D1ZA 3WF0A 3WUFA 1J11A 1A80A 3T42A 2CLOA 2BHUA 1ZAIA 4PEEA 3B0VC 1KR0A 5EMUA 4US5D 2G8ZA 5FJTA 4M56A 1WZMA 1MW3A 4KCUA 1H3GA 1YDOA 1J4EA 3HF3A 4O0ZA 4WX2A 5ABEA 1QPRA 1DWFM 2JBMA 1W9BM 1U33A 4HNTA 1DTUA 4ZO7A 2OQLA 4PMOA 1E4LA 3EAUA 5A8OA 3QC3A 4E3VA 3RR1A 1CYGA 2Z1SA 3DG6A 1XLLA 4B9YA 5I23A 3BG5A 1D3HA 2W79A 2DV0A 4RZ4A 3AUJA 2BY1A 3N15A 4GJIA 5GQBA 1OQFA 3UG3A 2E09A 1E6XM 1EGZA 3IJIA 1KFBA 3UF9A 3CQIA 4XVEA 4Q8QA 3LPPA 1NFGA 3P93A 3DKLA 4F2TA 4PE8A 3V7PA 2XN1A 3ZLGA 1ECQA 3TTSA 4ATWA 1PVNA 2QDDA 3TTQA 5XIAA 4GVHA 1VLIA 3QW3A 3F4DA 1OX4A 2FZNA 1KM4A 3XINA 1UH2A 4PUKA 3WF4A 2ZX8A 2C8NA 2QIIA 1HKMA 2EG7A 3EOLA 3E38A 1AD1A 2PDYA 2YCLB 2DSZA 2HE5A 4Q22A 3DDMA 4H6EA 4LVBA 4WKHA 4HPNA 1W3TA 2VXNA 3GH4A 4DO6A 4AX7A 2XVKA 4X9SA 1DV7A 4NILA 5IXEA 4KCVA 3QH2A 4TQTA 3QHMA 1EUAA 2Q71A 1A3WA 1CIUA 3ZJ8A 1IYXA 4Y9MA 4OKDA 3UR5A 1M7JA 5A8GA 2OYLA 4Z2JA 2H8ZA 3BLPX 5CCZA 3QLLA 4JKMA 4LUTA 1K8ZA 3DFYA 3MCMA 3CV2A 4A29A 5I3HA 1VPYA 1M1BA 3L4UA 4JIEA 2OG9A 4JFSA 3QV9A 5A2BA 2FVMA 4MJ4A 4NP7A 3KRZA 1N8FA 1EX5A 1WDPA 3NM1A 4M0XA 2DJLA 2GGEA 1UR1A 3WJSA 3V3WA 3P82A 4KGJA 3WQEA 3O6DA 1BF6A 2BY0A 3GUGA 4ZQPA 4DM2A 3H7VA 1LG1A 1TWSA 3WJXA 3TZNA 1KCKA 4QE4A 3IJ7A 2WANA 1GCYA 4LEFA 3CT7A 4O0QA 5LA1A 3NQEA 4H4IA 2OYMA 3PWAA 2D2GA 3IV8A 4W88A 4E2VA 5CG0A 1B3XA 3GDTA 3T44A 1XBXA 1FVPA 2QPSA 2OSYA 3TK7A 4LBSA 4FP1A 2QCLA 3SN0A 3KOFA 3L5MA 1XIFA 1W3KA 4NY2A 1AQMA 3WD4A 4AQLA 2QCHA 3ZVHA 3M0HA 4QIUA 1XRFA 3GR7A 3OGVA 1CLXA 2FHCA 1MW0A 3GNOA 3F7JA 1XLHA 3LTYA 4HPJA 2BFGA 4TMBA 5ENLA 1GW1A 1EC8A 4B3ZA 2KX9A 1DHPA 1KTBA 2FPYA 3TYDA 3SQSA 3FJLA 2NSXA 5G5IA 2ATSA 3SADA 3LD5A 1HQTA 1L6WA 1XBYA 3N3TA 2XISA 3U2EA 3W81A 1Q6CA 4H83A 3BOXA 5CJMA 4JNMA 4G7FA 4XZNX 3TJIA 1GHRA 3MI2A 1W32A 1JDEA 3UD6A 2UV8G 1VGAA 4CEXC 1WBHA 3ZVIA 4YVPA 3TLLA 1FA2A 5C9UA 1H7OA 2W91A 1Y5XA 2F61A 1VJSA 4O15A 3LHYA 4QTGA 2R6OA 1ZLPA 3LQGA 3WQOA 3QGKC 3W1AA 3FV9A 3HB9A 1B2YA 4MPQA 4JYDA 3H12A 3VX1A 4DBDA 4G1NA 2D0GA 1QATA 1NFPA 2PTDA 3GVWA 4FSAA 3CHCA 1YTEA 4CU7A 5I07A 3SDOA 1FWIC 3PJWA 3S6DA 1PX8A 1R9YA 2YXGA 3LI0A 3PHAA 1MW2A 3ZSSA 1JNEA 4W5ZA 4CCDA 5FJUA 5IDZA 3KCLA 3R12A 1EF3A 3LSBA 1XG3A 3TE9A 3W1RA 1P0DA 1V6YA 3BTNA 3CAKA 4M82A 4PMRA 4CCZA 2BP1A 4MZYA 4K7YA 4GIAA 2BGSA 1DPMA 1CGTA 3G8RA 5TD4A 3T55A 1H7RA 2RFGA 2YZ5A 1ITUA 1QBAA 3SEPA 3IANA 1TPB1 2VZVA 1WO2A 2CIPA 1GVSA 3B4YA 2D2OA 3RLVA 4XZIA 2HRWA 2V68A 4CNUA 1AH3A 3M0XA 4R33A 4JNYA 1YYAA 3MHUA 3VU2A 1IEQA 1QOXA 2HQAA 2YR1A 3RYSA 3BE7A 1L6SA 3MPGA 1NIUA 4RKAA 2J6VA 3QY6A 4ML9A 3KOWA 3E1F1 1FFRA 2ZTKA 3U2ZA 1LT8A 4Q32A 5LHEA 4H8NA 3IGHX 2G0WA 2PPGA 4UMCA 4DX3A 2NQJA 3QLDA 4JR5A 1AH0A 5KZEA 4PCFA 5FF3A 1KB3A 2PDPA 3CMJA 5D2VA 1T40A 2XFWA 3PR2A 1XRSA 3UY8A 1TZZA 4E5TA 3Q94A 3WUGA 4JL2A 3O15A 4Z08A 3S1WA 5EGRA 4TV5A 1EGMA 4CD8A 1V8EA 2E5DA 4QJ1A 3UR2A 3A9IA 2W92A 4FHAA 4CQBA 5M17A 1L8NA 3WLKX 3QTGA 1XQKA 4ZL1A 4UFLA 3KOZA 2CFFA 2ZIDA 1FWGC 4FNUA 5G2IA 3VVGA 1P0BA 3TONA 3MDWA 5A69A 2JGYA 3CEPA 4G6CA 2NWSA 1ZAJA 2XH4A 3WG6A 4OU1A 1BPLB 5HXMA 5A6MA 1OCQA 2BX7A 3M0KA 1XGEA 3AU6A 4FOUA 3BV4A 1FWWA 5C9WA 2XFYA 3W6MA 1R3SA 5DT5A 4PTWA 2ICSA 3QFWA 3HQPA 3WDJA 2XWDA 1DJHA 3VMOA 2D23A 4ILSA 1H7WA 1TPC1 3GLCA 1M3UA 5KZMA 4TXEA 3R5EA 3VTRA 2GJNA 3ZT6A 8A3HA 1OF8A 4RZ6A 1EP1A 1BSIA 3AS3A 5LIXX 4NI8A 4A3HA 2F2HA 2EG6A 2OX4A 5AC7A 1KGXA 1WZLA 3G1XA 1GVYA 1WCGA 3MKCA 2Z6IA 5HNTA 3ZLFA 2VCCA 6PTDA 4MB4A 4PTNA 1S2TA 4AHQA 4BI6A 2FZDA 1YDVA 4HSHA 1O60A 4NI3A 3E2RA 1JCXA 4GH1A 5E70A 1R46A 1W3LA 4AZHA 4O10A 4AAJA 3K8MA 3MMTA 2GK1A 3N17A 5FSDC 3APGA 4H2HA 1THFD 1SR0A 1BD0A 4LSBA 4HT3A 4A05A 2XIJA 4U5IA 4IXHA 3REQB 1GOQA 3C52A 2CKSA 3CB3A 3SJNA 3S1GA 3ANUA 3S2LA 1DXEA 4LWWA 1C8QA 2PZ0A 1WDSA 3W83A 5REQA 3E2SA 1A5OC 3P67A 1FWCC 2YGYA 4IIBA 3WCZA 3L2IA 3ITYA 4KS0A 4DRSA 3I7RA 2FKPA 1YKWA 2J25A 4GABA 3NQ2A 3AYVA 3WDRA 1W1ZA 1RPKA 2YBVA 4UMBA 2G3MA 1QW8A 3ARXA 2PURA 3UXKA 1XV8A 4C6NA 4QX4A 3WQCA 3UERA 3DFOA 3VOJA 4XZHA 3H53A 5C2GA 4FAMA 3TQ0A 3L21A 4HJWA 4MOZA 1XKYA 1XDMA 2PP0A 3NQ7A 4PGLA 3LY0A 4LEQA 3WQDA 1YXDA 3CQJA 3IJ6A 2P3EA 1SFSA 5FL1A 2X0HA 1XLGA 1OC5A 3PUEA 4C1KA 4L4LA 1WUFA 4HP5A 2NXGA 4W84A 1QPQA 3GR4A 3TAKA 1ZUAX 1G4TA 3VOHA 4JAWA 4Q33A 2QMJA 4HK7A 3FA4A 1GTHA 9CGTA 4K36A 4Q3MA 3GXNA 2OT0A 3AS1A 1KBJA 3CPRA 3WBWA 1ZNNA 2HZGA 4PBFA 3KAOA 2YXXA 1WKEA 3QXBA 1TMHA 3PB0A 2BY3A 1HJQA 3TNOA 3KHJA 4DXKA 3AXHA 1ZS2A 4LCRA 3IIZA 1DQWA 3T2PA 4LX4A 4CN4A 2IPGA 3DN5A 2D73A 5TAOA 1JDFA 5FD0A 1MI3A 4LNYA 1QI0A 3BJTA 5B80A 4TIMA 2QUNA 3EDDA 3PC0A 2VT0A 1MQRA 3K2GA 1E6SM 1QXLA 3W07A 3OVGA 3PS7A 1CXEA 4OBSA 4V28A 3S42A 4U2ZA 3UZJA 1F7BA 1UROA 3KL3A 1KFKA 1MSSA 2ZXAA 3NDOA 4PRTA 3WH8A 3N6JA 1XYLA 4DELA 3CV1A 2VFIA 4HHLA 4PUJA 3UCDA 1NU5A 2Z00A 4Z0JA 3W74A 3MBFA 1JL8A 4NRSA 4HSNA 2F7FA 2PDMA 2PBOA 3HPAA 4IMCA 1XJBA 4L1XA 4UTHA 4Z1DA 3TMQA 4D1JA 4JGDA 4C6IA 1UHVA 3GH7A 3PPGA 1YPFA 4NAEA 5AB3A 4ADSA 1L6GA 4ORMA 3LCGA 2POTA 2XHYA 5J5RA 1LBMA 4AXKA 4CN1A 3D46A 3HQ1A 1PKNA 4RW5A 4FR6A 1BXNA 4GINA 1E51A 3GDKA 2D22A 1HVQA 2BHYA 4AZ6A 4RDWA 4PMYA 2WVUA 2ANUA 1P5BA 3E2QA 3PBMA 2Y2WA 3BV7A 4MNMA 5F2LA 4E3TA 2PSNA 1YLVA 4K6AA 1E1EA 1HX0A 3G8EA 1TVPA 3UZYA 2WMGA 3O16A 4EPKA 1Y65A 2HTMA 3QV8A 3UGVA 7REQA 1KLYA 2XFFA 4HOWA 1UD6A 3R8RA 1S46A 4W5UA 1FBAA 2C14A 3IPWA 1IWBA 4GI8A 1RQBA 5HWMA 5CGQA 1XC4A 4X61A 1E6PA 1PV8A 5I3GA 1BG4A 5I06A 2GZXA 1JJKA 3J7HA 4DWDA 4DYKA 2FVKA 1HTIA 3SCPA 3LI1A 4L64A 4WZHA 5DY2A 2TMDA 5G4EA 3D5HA 5IFTA 3O8AA 5A2CA 3DUGA 6ENLA 5D8ZA 3R0UA 1QI4A 2G3IA 3GWQA 1IZCA 5KETA 3IJQA 1ODZA 1PL9A 3VNKA 4DO7A 2G3FA 1MO0A 1T7LA 4P7LA 3EPOA 1G01A 2E67A 4C91A 2VDGA 3N14A 3THQA 1ZJBA 3LUTA 3GHSA 2GFTA 3APTA 2BOFX 1RCQA 4IP5A 6XIMA 4F0MA 3RK8A 4JTJA 3VFCA 2ODOA 3M0VA 3NQGA 4S38A 4YCOA 2DT1A 3L12A 4GZ7A 4WDUA 2PDGA 3DHDA 3H55A 1PKLA 2YYTA 3FK4A 4ZXLA 5AFDA 1E3XA 2W63A 3T0AA 3BAYA 1OIMA 5EFFA 1KO0A 1SO4A 1TUXA 3E0FA 1YDYA 4OGZA 3H21A 4QSHA 5BOEA 1OK4A 3LGDA 4IWWA 2PF8A 3WY1A 3HZ3A 4GBDA 3OGRA 4FXRA 4NRRA 3RGTA 3FHQA 3MYOA 1H62A 6A3HA 2ASHA 3EWZA 3SSJA 3L4VA 2NVDA 1XQLA 1JIBA 2NV2A 3W88A 5DMMA 3UPWA 4KMQA 3EX6A 2I57A 2J9YA 4K8EA 1HGYA 2X2YA 4Q4QA 3G2GA 3H26A 4LXFA 2P8BA 5DELA 4FNSA 2VFDA 1S2UA 4DWSC 3IRSA 3T0TA 3PAOA 3VC5A 3WD2A 3KBMA 1IGSA 1NM9A 4IT1A 2ZDSA 4O14A 3VNLA 5CZSA 1KM3A 2W27A 1ZJIA 2EEXA 1R85A 1I8JA 2QAPA 1AQHA 4ZQCA 2PC8A 3ARPA 5JH2A 4UTFA 1RK6A 4IFRA 2Y1HA 3N3MA 1OF6A 1JR1A 3K8KA 4H41A 1V03A 5CKSA 3VGDA 3KDOA 2VC5A 1UWRA 4NAFA 1XIEA 1W1PA 1V3MA 4P61A 1UWSA 4C6FA 1VFSA 4LC8A 1Q6EA 4M29A 2BWGA 4AYSA 4F40A 3PZ9A 3UP8A 4A3QA 2IPJA 1EP3A 3USZA 2HSAA 3SGGA 4W4QA 4ZB0A 1KFLA 3N04A 1PZ1A 1A47A 3GO2A 4IPLA 4AISA 3ZMRA 2WZIA 3TR9A 4GZJA 1ZPTA 3ITXA 4REQA 2FFCA 1HKKA 1XFBA 4KWWA 1D9EA 4NXSA 1W91A 4MPKA 1JCNA 5DMLA 4JFWA 2FPVA 2PDLA 3WSUA 3S9ZA 1JCMP 5D2TA 1EDGA 5IRPA 2NZLA 4DB7A 1KCXA 4ZE4A 1MXSA 3AICA 4NT0A 3TP4A 1V6VA 2C15A 3KBSA 4LVAA 2DUAA 3U7VA 1V3JA 1E6NA 1ZBVA 1S3HA 4HA1A 1M5WA 1MXDA 3WMBA 3ERPA 2BBFA 1QVBA 4NZFA 2O7QA 3JU2A 4ADUA 3AXMA 2OEJA 3L5AA 1ZGDA 3PTKA 1CEOA 1B3VA 2R14A 3KL0A 1RJQA 2P0IA 3MWCA 3R0KA 5EFDA 2J7BA 2Y0FA 4YS1A 2CZEA 5MF5A 3AHVA 2E4TA 3CLWA 3B8WA 3NQDA 1TPUA 2WZTA 1CGYA 2TPSA 2IUZA 1DQXA 3UT0A 4O11A 3S5NA 1U30A 1TVLA 2J88A 1JCTA 3PZVA 4DXVA 3WLLA 5T9CE 5B7YA 4JHOA 3T2QA 4HNNA 2RAGA 1IF2A 3SY8A 5D37A 4ERGA 1SW7A 3BUVA 4QJ5B 1Q6OA 2J74A 2OKTA 3HFTA 3DG7A 1RD5A 1XUZA 4KETA 4RNIA 1R9ZA 3OG3A 3RXZA 3BAIA 3VCNA 2ZQ0A 2I1OA 3SO7A 2J75A 5L9FA 3RPTA 1AMKA 1S2VA 3FYPA 2INFA 3N13A 1FP9A 1K4GA 2PRLA 3VZZA 4TTUA 4ZB2A 3STFA 5JIPA 1LOQA 4WEVX 3ECQA 3UJSA 1LRTA 3VC6A 2ACUA 4RUBA 3G3MA 5JUVA 5EL1A 4ZCWA 3GC5A 5LIKX 2BVWA 2YX0A 4HZ7A 4QLKA 3KZSA 1WQ5A 2J62A 1Y8BA 3PUGA 3EPNA 4FOJA 2GYIA 3DHUA 2DSKA 3FIGA 1REQA 1TWDA 1Z9AA 4XSLA 2J7EA 1W2PA 2WQDA 3WLHA 3NPWA 3S2JA 1QI5A 3G3DA 1LWIA 3D47A 4BCEA 2VDHA 2OKOA 2WZEA 3EKLA 2VEGA 1ONEA 2XH0A 3OVPA 1OADA 1M01A 3T0CA 3P0XA 2GUYA 2ZVRA 3LB0A 1EO7A 1UA7A 4OOUA 3H22A 2B31A 4WOQA 2AQOA 4GY1A 4QDPA 3E0VA 1M68A 3FJ6A 1CENA 3UVIA 3ANYA 1ZBWA 2CESA 3MC5A 2EPHA 1Q85A 1RV8A 4YWSA 4AMCA 3GDLA 4RNJA 4HYVA 4AHOA 1EJWC 2OODA 5E6YA 2X1UA 3EZ4A 4B9ZA 2WCSA 2PU1A 4QG9A 3MO4A 3N2XA 2P3ZA 3GC4A 1Z3NA 2CXGA 3STPA 1PO9A 4DEFA 2JF6A 1R8LA 3T05A 1HVXA 2VL4A 3GNDA 1O5RA 2ZOXA 3RLUA 4S3GA 3EYPA 4NJJA 4H9XA 3F4VA 1AQ0A 1OFBA 3WNOA 3BPWA 3CK5A 1V79A 3G0UA 4PCPA 4AMAA 2WWCA 1Z48A 3KE0A 4A35A 3C2EA 3ZJ6A 3NYDA 2FH8A 3LHWA 4DJDC 2O9OA 1TJPA 4N6FA 3V5CA 3W2UA 3G6LA 4LH8A 1NF0A 1ISYA 1WP6A 3B0PA 3B40A 1W1A1 3MI3A 3S9YA 4RL3A 3UQNA 2QQ6A 3CO8A 3M44A 4S1FA 1DOSA 5G4WA 3OBEA 1P1XA 4IPJA 5A5WA 2FTWA 3MBDA 5E9AA 2Z1WA 3GNNA 1TJ1A 3M0ZA 3KBNA 2W4XA 1T5AA 3IVUA 3KWXA 3QOMA 1OFQA 4HSOA 1T8XA 1X97A 4I8DA 1IXQA 1H5VA 4JQAA 4MB5A 2WMFA 1VJZA 2DT2A 2JEQA 4HNUA 2GJXA 4Y2WA 1L0PA 4R7JA 2J78A 4MY9A 2ZZ7A 4JQ3A 1K8XA 1ZHAA 5LGXA 4WIWA 3THAA 2KAUC 2DSVA 1YQ2A 6TAAA 1WUEA 4IMEA 1FH7A 1H7PA 2RJGA 3LDVA 4GZEA 2QJHA 3U6WA 2A2IA 1K03A 1PCKA 4XQ6A 2F38A 4OECA 4P8VA 2Y63A 4EWND 2DZSA 2EPOA 4IPIA 4B5WA 3WMLA 4C65A 1H7NA 3UFYA 1QW7A 1LLOA 2BB0A 4QROA 4C6DA 1RUSA 5JXQA 4YYCA 1M04A 1W9VA 4PTXA 3B9DA 3UXDA 1KRBC 1GUVA 3S5ZA 1UP2A 4GCAA 2VFEA 4O1BA 2VX4A 1I9CB 2IXUA 1HKJA 1L2UA 2OSWA 2V63A 3G0XA 4GXWA 4GA8A 1K3UA 4XD6A 2OEKA 1HO1A 3BAKA 3VDHA 5KINA 1S3TC 3LGEA 3W24A 2OGYA 4NJIA 3NEVA 1XX1A 2CYGA 1KTCA 3ENLA 4PBEA 4DBWA 3MKVA 3KRSA 4XK2A 3SGUA 3WELA 1CGXA 3DFNA 4H01A 1T99A 3F1QA 3HMCA 1I6NA 1POKA 3H4GA 3TSMA 1HKIA 2XN0A 3B8IA 2QNEA 1PTAA 1ZTVA 1PUDA 2A7NA 2ZADA 1UW9A 4CVWA 5AHNA 2XTKA 2ZZ3A 1VZWA 1YIXA 4GQRA 2VGBA 3FOKA 2BXVA 2HROA 4F0KA 4INFA 1RP9A 2EKGA 4YTQA 4GG9A 3WUEA 4DVOA 3IWPA 1GONA 4MAZA 4B5TA 3G1RA 1NOFA 2DZTA 1KV8A 2B7NA 3ZWTA 1CXIA 1Z32X 4H00A 4GI4A 1UKQA 3CQKA 4QEEA 5C55A 1XRVA 1TTPA 1GOXA 1Z7AA 1EJTC 4HU4A 2PGEA 4XAFA 2ZKMX 3LX9A 3VFLA 2OZ0A 3C2VA 4B5UA 3T6CA 2XGBA 4EPDC 3AMKA 5AYIA 3FAWA 5C7HA 1B9ZA 4CNTA 5JBFA 1DKWA 1YEYA 3MP3A 3VD3A 2ZFAA 1LTDA 2VGIA 1PB0A 3TZFA 3CUHA 3L7RA 2TODA 1B3OA 2GVYA 2QUUA 1V0KA 3UY7A 1LWHA 3H8AA 3R0DA 4QE5A 1UZDA 1LYXA 1R3RA 3G22A 2H3DA 1TJ0A 4D1IA 4M6PA 2PCEA 2E1WA 3GTXA 4C7DA 5AYXA 3CUZA 3P8IA 1ONWA 3GM8A 1S1RA 1PDZA 2WSRA 3UZXA 4NJKA 3BGGA 3ZVHB 1WV2A 1R0MA 3A4XA 5HR6A 2WV8A 1AL7A 2DIEA 3QSRA 3VKCA 4ACZB 1ALDA 1XP3A 3UJ2A 1DWHM 4N7QA 3A64A 1E55A 1X1OA 3S6TA 3QR3A 2EHHA 4G7EB 4JXCA 4JYFA 1FXQA 4I6VA 3G1HA 3A12A 1Y0EA 3CZJA 3NSMA 2VD9A 1K9EA 3AC0A 3ITGA 4PMZA 3TNBA 3EDJA 1W9PA 3Q4DA 3UNTA 4GKTA 3C2YA 1WXZA 2GUBA 1TB3A 3C0QA 4H8UA 2DU2A 4HOXA 4WDTA 1Q66A 4LS2A 4MB1A 5J5DA 4DNHA 1X8CA 1SZFA 3LCIA 3XISA 1XLFA 2YKKA 4AG0A 3RRAA 3VZXA 2XIBA 2Y70A 1WDDA 3P2VA 4P8UA 5IM51 2G96A 3U8GA 3UWZA 3TR2A 4RV8A 1GVEA 2PTXA 4JCMA 3EXTA 4TMCA 5XINA 4ADTA 1Y5WA 2QR6A 3TYZA 1Q2SA 4DAFA 4OBTA 1W3JA 1UIOA 5KZDA 1ZP4A 4GMEA 1WBJA 3GX9A 1EEPA 4Q8WA 4NVTA 4LQ1A 4ZFMA 4AIUA 5D09A 4LYKA 3AFBA 4NSBA 5DCBA 1WKYA 5DANA 1AW5A 1B1YA 2PDJA 2WJDA 2NLIA 4ASTA 1K4HA 3PZIA 5CGTA 1Q6FA 1XF0A 3B8TA 4QQUA 3P14A 1Q6RA 2FJKA 3CIWA 4EXBA 3VK5A 1IEVA 1R2RA 1NWSA 1UR2A 2CBJA 3LV5A 3GUWA 4C6EA 3LSCA 1DJYA 3TA9A 2YDAA 4QG6A 1QOQA 2VFGA 3GG1A 3M7WA 1UKTA 4ZB5A 4EF8A 4N9EA 4S3EA 4H8HA 4MKNA 1SGJA 2PGFA 2WCGA 2V81A 5BZAA 3WQ4A 1FTXA 3LS9A 1ONXA 4E0CA 3L4YA 4IMGA 3RM9A 1DE5A 5CPLA 1QNQA 2FZ8A 4S3KA 4A3UA 3WK0A 3EDKA 4FXJA 3QQ1A 4NNAA 3WBEA 4JTUA 3AHXA 3MV11 1RCXB 3G0SA 5DLCA 4QR6A 1XLIA 3OB8A 1PWLA 3W0KA 5DCDA 3TN3A 1OGGA 4GD0A 3WBYA 1QPNA 3DH7A 1WKFA 1JPKA 3KEHA 4PCSA 1UG6A 3S1XA 1SMAA 3DFTA 3BQ6A 4ZSTA 3MUY1 4F79A 5D04C 5KSWA 1IT8A 3C2FA 5DF0A 1VR6A 1E56A 4DPPA 4K1GA 5ECVA 2OSXA 1AJ0A 2R1PA 3GXFA 4S3DA 2PP3A 3GW0A 4HIBA 4G2DA 1YBQA 2ACRA 2QT3A 3PPHA 5BOOA 5BXSA 3GTFA 3M7SA 1E71M 5CC3A 3RU6A 4MY1A 4GJJA 1H11A 1J0KA 3O07A 4NZ4A 1MNSA 2WOQA 3VMPA 2Z0IA 5CSRA 2A3HA 2V5LA 1B3YA 4ZBCA 1N7KA 3I6TA 4R7WA 1KWGA 3CTLA 3M5YA 3HOJA 4ML4A 3N2OA 3HG4A 2ZRUA 3MYPA 1Q5MA 3GK0A 3Q67A 1LDCA 1GPWA 3FDGA 2J7CA 3DOPA 3V4BA 1SSGA 3KRBA 4AD4A 4YLWA 2I14A 2YCKX 2V2HA 1CB2A 1W3IA 1VBGA 5CJNA 4P8XA 4ZXOA 2J66A 1QNVA 4XTIA 3TH6A 2XVGA 3U5UA 3A5FA 3RPMA 5F2MA 5MKGA 1XUUA 4Y9OA 4EKJA 4HPHA 4H9TA 4ZQOA 5A95A 4HK6A 5CZJA 5EY5A 2DT0A 3RMEA 1GKPA 2ZZ4A 3CMFA 5I2UA 3N1AA 4G7EA 1WXYA 2F6KA 9XIAA 2ISSA 3SRFA 4K39A 3AO0A 1OZQA 4H8VA 4I7UA 1RBLA 2F84A 4B16A 3OBAA 3W70A 2O4MA 2GL5A 3NL6A 4F8XA 3EX2A 3B9OA 3K8LA 2P1FA 5T8GA 1XLAA 3EWXA 4ZOAA 2CITA 3BICA 3UXIA 2WNZA 1XCFA 3VO0A 3KX6A 4KRZA 3QF0A 3AHZA 1UPPA 1D7KA 1ELSA 4UR8A 2XVLA 2EGZA 5FESA 3V16A 2ABAA 2D2JA 1W5NA 2H90A 3RHGA 1JZ6A 4HHHA 4I9AA 4GC3A 1LQ0A 2QCDA 3R8GA 1MZRA 4XWUA 5FI8A 2FPTA 3OZPA 6ALDA 2OO6A 4CQCA 3QMSA 2ZZ2A 2GVJA 4LY8A 1DE6A 2JE8A 1G67A 3MVIA 1I4NA 4MTVA 3DC8A 3T9PA 4LRSA 1TRDA 4UFHA 4XUGA 2Z2AA 3CZLA 4DZAA 4I5UA 3LLDA 5KTLA 4ZE5A 4GVGA 2CLIA 4AH7A 5E9XA 1U1JA 3O7UA 1D3CA 1A0EA 4G9PA 1W2VA 3OVQA 4HPGA 1RAKA 1ONRA 3OLGA 1XSIA 1UD3A 3CYVA 3VKDA 2W62A 4OHQA 3OP2A 3P81A 5G2WA 5D8WA 3UPMA 3GW3A 2MUCA 2PFHA 3VCRA 2HVOA 2D2HA 3UVAA 3VIHA 3L0GA 4H6KA 3PM6A 3O0KA 2DVXA 1YTDA 2X05A 1PIFA 2QDGA 4GISA 5C70A 5C5YA 3BLFA 4E8DA 1CTNA 2IQ0A 2G5WA 1MUCA 4GNKB 4YJ5A 2WZMA 3DHFA 3JUGA 1QJWA 2ISVA 3MI6A 5FAGA 2ZZ5A 3ITOA 4IGMA 3DI0A 3ELFA 1WB0A 4N2YA 4Z2GA 3V18A 1H49A 4B5VA 3G1YA 1KCZA 3SIZA 1VCFA 2FZ9A 4G8TA 3N4FA 2PDIA 1XIMA 5AKQA 2OXNA 5CZTA 2G97A 3GIYA 5J8LA 3U4AA 4BQ3A 1FDJA 3LG3A 1EZWA 5ABTA 3LCXA 3FVMA 2ZXBA 1B31A 3W28A 5K4XA 4F0HA 5H8UA 2WZHA 4Q6XA 3RUBL 4AEOA 4O52A 1A0DA 4YMZA 1JVNA 1XPGA 1CI1A 3H4WA 4PSPA 1O66A 1XLKA 3GVVA 1UKSA 1OGSA 2NX9A 4I6KA 3VMNA 4L1GA 1PEZA 3NSXA 4KCTA 4MKSA 1E4MM 1MWOA 4GNVA 4BKNA 4IIDA 4PULA 3KCOA 3PTDA 5AHMA 3ZLHA 2I17A 2GJRA 3HM7A 1OHLA 3W1UA 1AZ2A 2BY2A 1Q4WA 3LCFA 3BW4A 4GO9A 5DMNA 2WHLA 4CD4A 3LOTA 4PMQA