4GC3A

Crystal structure of l-histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn and sulfate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
263
Chain Sequence
SLKKLDYHFHSHFSADSEELPRKHVTEAIAHGLEEICFTEHRDFYFPGMDFSLNLPEYFQEINQLQAEFKDKIKIKIGLEMGIDLRFKSEINQFIDSAPFDFVIASVHEIGDIEVYDGTEFYLQKTKEEAQREYLLACLDVVQNFENYNSFGHLDYVARYGPYTDKSIKFAENREILFEILRALASKEKALEINTRLFDDPKTEQFYSDLLINFKRLGGKFITLGTDSHIAKRDWLSIHKARTLIKKAGFHELATFSGMKIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Characterization of l-Histidinol Phosphate Phosphatase from the Polymerase and Histidinol Phosphatase Family of Proteins.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords L-HISTIDINOL PHOSPHATE PHOSPHATASE
total genus 108
structure length 263
sequence length 263
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02811 PHP PHP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gc3A00
3N2CA 4EP8C 3GU9A 1XRTA 4B92A 4LAMA 4C6CA 4CEUC 1EYWA 1EF2A 4LCQA 2CZVA 4DIAA 3O0FA 1YNYA 1VFLA 3GRIA 1GKPA 4UB9A 2Z28A 2GWNA 4RZBA 1KRAC 2FTYA 4C5ZA 2AQVA 4EPBC 1FWFC 4XAZA 4TQTA 3HPAA 1P1MA 4CQDA 1A5KC 4C6NA 4DNMA 2PGFA 4QROA 5FSEC 3GG7A 2Z26A 1P6BA 4CQCA 3GU1A 3IACA 4ICMA 3SFWA 2FFIA 3CAKA 4KESA 2VC5A 2VUNA 3A3WA 1IE7C 4WVXA 3BE7A 2GSEA 4M51A 2OOFA 3GIPA 4RDWA 4IFKB 3O7UA 2EG8A 4IFKA 2F6KA 1NDVA 4CNSA 1M65A 4DI8A 3MDUA 1K70A 5HMDA 4C6IA 4KQNA 3AU2A 4ZSUA 2QS8A 4H01A 2FTWA 2GWGA 1FWJC 2E25A 3K4WA 4H9MA 1NDYA 4CQBA 3F4CA 4GX9A 3TN4A 1RK5A 2RAGA 1W1IE 4G7EA 4LH8A 1RJQA 3GTHA 1FWEC 3MDWA 3IPWA 5HMEA 1A5NC 4C6JA 4DZHA 3RN6A 2Z7GA 2PUZA 1POJA 3QY6A 3SO7A 3MSRA 2OQLA 4RDVA 1V4YA 3HTWA 3IRSA 4IGNA 4V1XA 1UMLA 1ITUA 3LY0A 1EJTC 1EZ2A 3C86A 1JGMA 4OFCA 3URBA 4BJHA 4G2DA 1FKXA 4INFA 1I0DA 4C6OA 3ICJA 2Z27A 2QT3A 3UR5A 2G3FA 3UBPC 1M7JA 1NFGA 3GTXA 2Z4GA 3HM7A 3PANA 3LNPA 4GC3A 4C65A 3URAA 2OGJA 1V77A 2WJEA 1PTAA 4DI9A 4I6KA 5G4HC 3F4DA 4IG2B 3E74A 4NI8A 2DVUA 4KETA 4PCNA 4HK5A 5AKQA 2UZ9A 1YBQB 2QVNA 4C6QA 1ITQA 2Z29A 4QRNA 3FDKA 3S2MA 1KRMA 4AC7C 3B0XA 1EJUC 4R88A 2WJDA 2Y1HA 4B90A 4B3ZA 3CS2A 3S2JA 4H9YA 4GX8A 2OODA 2E1WA 3RYSA 4C5YA 3MJMA 1R9YA 4IF2A 2D2GA 3DUGA 1FWDC 1KCXA 1EJXC 4KEVA 1EJWC 3MVTA 1A4LA 1GKQA 1DPMA 3UPMA 3AU6A 4F0SA 3R0DA 3B40A 3RCMA 3QGKC 3WYZA 4XD4A 3EWCA 4NP7A 4H9VA 1GKRA 2HBXA 4UBPC 4XD3A 4C60A 1FWBC 1XGEA 1PB0A 4RDZA 3FEQA 1O12A 4H9UA 3K2GA 1YIXA 1BF6A 2Z2AA 4P5UA 2WM1A 1FWHC 3IV8A 4PCPA 1YRRA 3E38A 3URNA 2W9MA 4GOAA 1KRBC 1WXYA 4DLMA 1RA0A 3UF9A 4GBDA 4C6DA 4F0LA 2R1PA 2FVKA 1O5RA 4HJWA 4D8LA 1J6PA 1K6WA 2Z00A 4YIWA 4LCSA 3GU2A 3T81A 4I6VA 1NDZA 4F0RA 1V51A 4R7WA 1A5OC 3NQBA 3LSCA 3ORWA 3WZ0E 4IGMA 4C6EA 3NURA 3ITCA 2OB3A 1RJRA 4GZ7A 4ERGA 4H9ZA 1ZZMA 3D6NA 1E9ZB 4BKNA 3MTWA 2Z24A 3PBMA 3NEHA 1UIOA 3A4JA 3TN5A 4CNTA 3IJ6A 4ERIA 3PNUA 3UR2A 2WJFA 1QXLA 3URQA 4GK8A 4EPKA 1YBQA 4KERA 4H00A 4CEXC 3ID7A 2KAUC 3K5XA 4LEFA 2YXOA 3S4TA 3TN6A 3LSBA 2PGRA 2R1KA 3OVGA 2BB0A 4IH3A 4B91A 1R9XA 1K1DA 4C6LA 2ADAA 4C6MA 2HPMA 4GXWA 2VR2A 1EJSC 3QY8A 4DO7A 3CJPA 4LFYA 4DLFA 5CH9A 2AQOA 5LXXA 1R9ZA 1FWIC 4PBEA 1ADDA 4KF1A 3S2LA 4EPDC 2GZXA 2YZ5A 1NDWA 1ONWA 2VC7A 3LS9A 4QS5A 2YB4A 2Q09A 3PAOA 4GYFA 1V79A 3OJGA 2YB1A 2IMRA 2O4MA 4DZIA 5FSDC 3EWDA 3OQEA 5A6TC 1J6OA 2P50A 4HA0A 4L6DA 3MPGA 3GTIA 3AUOA 1ONXA 1EJRC 3A3XA 1QW7A 3DCPA 2Z2BA 3E0LA 1XRFA 4G7EB 4J35A 3GTFA 2PLMA 3OODA 3G77A 4LANA 1WXZA 4LALA 4GY0A 3LGGA 3DC8A 4XD6A 4PE8A 4XAYA 1UIPA 5HMFA 1A5LC 2D2JA 3T8LA 3OU8A 1KRCC 2EG6A 1J5SA 3E2VA 3MVIA 2DVTA 4KIRA 3E3HA 1POKA 3OOQA 4WGXA 4IG2A 4H9TA 3TN3A 4LCRA 3F2DA 3QGAC 4AQLA 2I9UA 4J5NA 4HK7A 3T1GA 2D2HA 1RAKA 3MKVA 2ZC1A 2ANUA 4KEZA 3FDGA 4HK6A 2XIOA 1P6CA 4QS6A 1FKWA 4IFOA 2HBVA 1HZYA 4XAGA 4WHBA 3TNBA 4RDYA 1RK6A 4QTGA 4XD5A 2GOKA 2HNHA 2UBPC 2HPIA 3B0YA 4GY7A 4E3TA 3EGJA 4NG3A 1FWGC 2AMXA 3S2NA 4C6BA 3RHGA 2I5GA 1PSCA 4GY1A 1UBPC 4MUPA 3PNZA 4KEUA 1V7AA 3GUWA 1S3TC 2R1NA 4C6FA 2FVMA 4L9XA 2VM8A 4H9XA 3KM8A 2PAJA 4RE0A 3GIQA 1A4MA 4Z42C 3ISIX 4V1YA 2HQAA 2Q01A 3V7PA 3IARA 3WMLA 2BGNE 2VHLA 2EG7A 4J2MA 1RJPA 1FWCC 4R85A 1FWAC 2DVXA 1PO9A 2P53A 1YMYA 4JOMA 4LAKA 1A5MC 3LU2A 4BY3A 4ZSTA 4XAFA 3IGHX 2ICSA 3F2BA 3F2CA 4LAOA 2QPXA 2O4QA 4EPEC 4DYKA 1EJVC 1RA5A 3E0FA 4CNUA 4ERAA 4QSFA 1J79A 2R1LA 4IFRA 1I0BA 5E5CA 2Z25A 3JZEA 1XWYA 2A3LA 3LA4A 3LGDA 4C6PA 4PBFA 3QY7A 4C6KA 2R1MA 1E9YB 4IQJA 1M68A
chains in the Genus database with same CATH superfamily
2GQAA 3BARA 3SECA 4B92A 1P0BA 1E5NA 4S3DA 1EYWA 1H7OA 3A5VA 3BGGA 1LZOA 3KP1A 3AI0A 5D2VA 4MDPA 4PMJA 2YPIA 3S42A 4ZQRA 3WDJA 4K7YA 2GK1B 3M44A 2R9RA 1I2PA 4Z17A 2BVTA 3W1TA 3M5XA 4WUIA 1CGYA 1KBLA 3HPAA 4MYXA 1GW9A 2BS9A 3WLKX 2POTA 2HVNA 2AL2A 3EKLA 2QVHA 1B3WA 3PJUA 2WHMA 3U7VA 3DOPA 1ZP4A 4IJCA 2VOTA 4QCFA 1F7BA 5LYRA 3W71A 3EX3A 3EZ4A 3C5QA 4GKTA 3Q2DA 3E96A 3PFRA 4HHHA 2PDLA 4FLQA 4ALDA 3GW3A 1FCQA 2CLHA 3BE7A 4M51A 4XBKA 5TNVA 2WWDA 2E3ZA 4FXFA 3RFAA 3O7UA 4FPSA 5HNTA 1NTHA 2QCHA 4ZB0A 3PSWA 3WN6A 3OVRA 1K70A 3R94A 4ZSUA 2QS8A 3FOKA 4F9DA 5BXPA 1FWJC 3CUIA 1YXCA 2OO0A 3I3BA 1ZTVA 2VX6A 5XIAA 3NZPA 1V0MA 2GUYA 2OMAA 4G7FA 4AZ7A 4JFUA 5IBXA 1MUMA 4QP0A 3DFSA 2JGYA 4AVNA 2DSWA 3HGRA 2VP8A 3MSRA 1JRBA 4GISA 2FHFA 2EO7A 1ZBWA 4HN8A 2VQUA 2UY5A 1HUVA 3L5MA 1KM2A 2GYIA 4J3SA 5LGZA 2QT3A 3RILA 5JXQA 2E6FA 1JR1A 4K1GA 3W7DA 4DXVA 3PANA 1EZWA 1BQGA 4C65A 2CZ5A 4DI9A 1UZ4A 1OF8A 2H3DA 5FEPA 1K9DA 4DWSB 1QO2A 3BCJA 1XLDA 3S3GA 1DBTA 2VDIA 5CEWA 4LVFA 3AHYA 2YFNA 3W86A 5D33A 1XICA 1TPVA 3ATYA 4AZHA 1MW0A 5IM51 4D2JA 4JTQA 2BASA 2HROA 4GE8A 1OGSA 1S38A 4RZ5A 3MJMA 4G8TA 5J04A 3DI1A 2C16A 3MVTA 3KBNA 3NZRA 3ARQA 4A05A 4C90A 1SZFA 4Z1BA 1UR4A 1FQ0A 3LI0A 3WYZA 2IKHA 2HCVA 3T07A 1RR2A 4UBPC 3L12A 4NIRA 2MUCA 2DJLA 1JAEA 2QR6A 4G9PA 4ACZA 3SAZA 3PK7A 2J77A 3UFYA 4S3FA 1EWDA 1XIJA 1AH3A 1YRRA 2XDFA 2KX9A 4DJFA 3JVAA 4H7ZA 1AMYA 2OFJA 2G50A 3WQ8A 3P3BA 2YL6A 4IUOA 3EMQA 4AIEA 3RJXA 4KCWA 1NDZA 4JXCA 1TZZA 3Q4DA 2Q02A 2XWEA 3BJTA 1VFMA 4F0HA 3QPEA 1S5NA 4L9ZA 1CZ1A 1TV5A 5EMLA 2X0SA 2YOCA 5HUPA 2PTZA 3VNIA 4R7OA 1C9DA 1QPQA 2CXGA 4J7RA 3QQ1A 3MSDA 1G7VA 3RU8X 3V75A 2J9YA 2WWCA 1O95A 4IT1A 3IIXA 3PS7A 5FD0A 2W27A 3H24A 5FKYA 3NXFA 3PUEA 2RGMA 2DV0A 3EA3A 3GNDA 1V3KA 3CPRA 1U1UA 4V2XA 2WPGA 2HISA 3G1AA 1K9EA 1PXGA 1WOBA 1YDNA 4RNIA 3HFTA 2OG9A 2BVDA 3UCQA 1MZHA 5D2TA 3APTA 1GYNA 2GJXB 2NV2A 4DF0A 4HU8A 3STFA 5KZMA 1DWJM 3PM6A 4PEKA 1RH9A 1PE1A 2FZ8A 4WGXA 2VC6A 4H9TA 2J66A 5D05A 2PLCA 1F3EA 3HZ3A 2XPKA 2ZC1A 5ABFA 3W7CA 3OPSA 1UASA 4LYKA 5ABGA 1X7IA 3S6DA 2ZX9A 1TRIA 1CENA 3UR8A 2EPHA 2YSWA 5FEZA 3T42A 4AYGA 2HPIA 1G4PA 2C79A 1EQCA 4V28A 4ICCX 1XF0A 2XSAA 4PN2A 1QUMA 3W4RA 3FS2A 4JKMA 4JEQA 3MUXA 4O54A 4MMWA 3LLDA 2ASHA 2QIWA 1S5MA 4B3KA 5JBEA 4TTUA 3NIYA 3QC0A 1R5YA 3TQPA 2V2CA 4Z42C 3ISIX 4DBUA 5F2GA 1QI0A 5G4EA 2WPBA 4DWDA 1KCZA 2ZZ3A 3B9NA 1CGVA 1J2BA 4X61A 3BQ5A 4LRTA 3S0CA 1IIHA 4YHEA 3MI6A 4Z2GA 1BVNP 3GK0A 4LVBA 4RL3A 3TR2A 4Q8MA 1KFWA 3CC1A 2DIKA 3B0UX 3AIUA 4XZWA 3W02A 4Q6JA 3F2BA 2DZVA 3MMDA 7ODCA 1OG6A 4GI8A 3H54A 4IOTA 1PYMA 4GZIA 5CZJA 4HA3A 1TCDA 5I06A 3M0LA 3CEPA 2ZUTA 3SRFA 1PTGA 4FOUA 2JIEA 2PDHA 3YPIA 3HF3A 3QY7A 1XLCA 2R1MA 4MAVA 4XO6A 3S46A 1RQBA 4G1NA 4UTIA 1KM3A 4PMUA 1CTNA 3NO1A 3W6MA 2YA1A 5CZ0A 2W61A 4NAEA 3WQGA 1CW2A 4MDOA 4MPKA 4Y8FA 1OYCA 1KRAC 4PUNA 1NIUA 1L2QA 1QNQA 2HV5A 1PV8A 4AF0A 1OIMA 2Q8LA 3GE7A 3MUZ1 4GI4A 4TQTA 4WOQA 4ASTA 2NVCA 1XXXA 3RM4A 2G4JA 4ZXOA 2J74A 1P1MA 4TVCA 4ZR8A 1Q63A 1ONRA 2XFRA 2QJJA 4QNWA 3RR4A 5CPMA 2E28A 3TQ0A 5BYWA 3K1GA 4H8HA 5K9CA 1Q7QA 5FA5A 5I3IA 2VC5A 3H6OA 1I2QA 1O1ZA 4RDWA 3UG3A 2Y5SA 3BVJA 3W25A 4JHMA 2ZXQA 4R34A 4DXKA 2ATSA 3BJSA 3HG5A 4PUWA 3SRKA 3PB0A 3NQFA 2D3LA 3GZ3A 2PB1A 3TZNA 4TUFA 4LUJA 1SZNA 2A7RA 2OSYA 3CWOX 5G1MA 1J93A 4U28A 1KFJA 4AXNA 5FACA 2JF6A 3TIMA 4E2BA 3TC7A 1ZENA 3ZS4A 3RN6A 2E9BA 4IUGA 3R0KA 4JQ4A 1PKNA 6PTDA 1V02E 3SCRA 1NEYA 3NL2A 4G2DA 1H7XA 1VRXA 3HGOA 2VRJA 3DFOA 1H5VA 1V77A 2D1ZA 4HMNA 3UPWA 3JUGA 2BY2A 3ZO9A 3KBJA 3VNZA 1KLYA 3ALGA 3UY7A 4JYEA 2HNEA 1IEQA 1T0OA 1RSCA 3W26A 1TUFA 3VUPA 1E0XA 1FHUA 1MXSA 5ABTA 4W8AA 3LZ5A 3W7GA 4XWUA 2ATMA 2QCCA 2IPWA 1XBVA 4ROPA 3NYDA 3AMGA 4Z2LA 2C0AA 5GJMA 2IKIA 1JPMA 4DJFC 4PTXA 3S2JA 3O6DA 1XIEA 3EX6A 1LLZA 1FDJA 7CGTA 2WVVB 3RYSA 1W5MA 1JDAA 3VM5A 2GVJA 1AJ0A 1G01A 2R8WA 3WQEA 1A4LA 3NYZA 3NNTA 2FVLA 4HHLA 4FIQA 1Q7ZA 5CC6A 3DFTA 4NX5A 2J8TA 5HNUA 1BAGA 3MS8A 4HQVA 4KS0A 4LS1A 3TVAA 1EF3A 4UFHA 2ABAA 4RE4A 4A3HA 1CXFA 1XS2A 4QDMA 3N2OA 1ZL1A 1A5UA 4CN4A 2CKSA 2PCEA 2E40A 5CJ5A 2OLSA 4GBDA 2DIEA 5C9UA 2IQDA 2BVWA 5GPRA 4MB3A 1U5JA 3QH2A 3TU9A 3LSCA 3ORWA 1C7TA 2YBVA 3DENA 1MVYA 3S1XA 3RDKA 3D6NA 1E9ZB 5FF7A 4M24A 4ADUA 5GNZA 3HQOA 1IT8A 4O11A 4K6AA 5C2GA 4GC4A 3PZNA 4CNTA 3RX3A 3VOJA 3UR2A 3LRKA 5EMMA 1ZJBA 4EPKA 4IICA 1VHNA 4EIVA 4Y7EA 1DJYA 1UUMA 2INEA 4PGLA 4HCHA 3KS5A 3LSBA 5E6ZA 4D6GA 1R86A 4HNCA 3P61A 4XQ6A 5A2AA 2NWRA 5K7JA 1WKFA 4PUJA 2VR2A 1F74A 1KWGA 1KTBA 4Z2KA 5IBXC 2XVLA 2DH3A 5G4WA 2CLLA 3AS1A 2VC7A 1I9CB 2QW5A 1CXEA 3T44A 5EA9A 3PAOA 2PZ0A 3LBOA 1KXVA 2O4MA 3CASA 3EA1A 2DU2A 1TTIA 3EWDA 3Q67A 2VR5A 3GTIA 4O0ZA 3HGSA 4GABA 2J13A 3W7QA 3KS6A 1MEIA 1O1HA 3AIWA 3NDOA 3VIKA 1A5LC 3IJ8A 2NXGA 1EPXA 3UXIA 3A4AA 2NXIA 2ONEA 2PI6A 2DZAA 5H8UA 2E1DA 4HZ8A 3I4EA 4KCUA 1ISXA 3MO4A 3QKEA 4MJ2A 4JTDA 4DBWA 1UR2A 2V8ZA 1E1CA 2VFEA 3E1F1 1EH9A 3T1GA 2NQHA 1ZAIA 4HK6A 3INPA 4LX4A 2QUTA 3WBXA 4AMCA 4I8YA 1UHVA 4NT0A 4LXFA 4RDYA 3ARTA 2XSBA 4EF8A 3R11A 3TJXA 1EP2A 1SO4A 2UV8G 4TOQA 1SW3A 3AXKA 4X60A 2I5GA 3L7RA 4B5NA 4ZQOA 5H8MA 3IJDA 4BWLA 3GR7A 4NZFA 1HL9A 5G2WA 1VPYA 4C6FA 1FHLA 2R1NA 2ALRA 2VM8A 4CD6A 4GNVA 4LYPA 3ZWSA 5EYWA 5A8PA 5KZDA 2GQ9A 3CHEA 5I23A 4QQUA 2A85A 3ZR4A 3H4XA 3GG8A 3KVMA 5CLTA 3M07A 4LYRA 2VELA 4JQ2A 1XIFA 4DWSD 2R14A 1D7FA 4JOMA 2Y85A 3ZSTA 1VIZA 5DXXA 2NQ5A 1REQA 3L4ZA 4H7CA 5RUBA 1EWEA 3M0MA 4FXRA 4ZOAA 2PU1A 2ZXDA 1IEXA 3STPA 2V9DA 3RLUA 4KW2A 1PVNA 4JCMA 4QR6A 4HPJA 1NOFA 1ZLPA 1KCLA 3BZGA 1M1BA 2QDHA 4HMDA 4EP8C 1AW5A 4UTTC 1TUXA 1F73A 4DJFD 1UZ1A 3KXQA 3A9BA 4Q4KA 1GKPA 4ZGYA 3G1RA 1DEDA 2XWDA 4O4VA 1I2OA 4L1XA 1Z7AA 3LCFA 2WBKA 4GACA 3HJZA 3K4DA 1OABA 4QSHA 3RO6A 4QROA 3FVMA 3UWWA 1W8GA 1XLBA 3PZTA 1JNDA 3IACA 3SFWA 5AVNA 2W62A 1MEHA 3HIJA 3WBWA 4NY2A 5CGTA 3NEVA 4AAJA 1LLWA 3N3TA 1GQIA 4JD4A 1CXKA 1LP6A 3H12A 3H2OA 2NQLA 1W54A 4KFPA 4GD0A 3SIZA 3W38A 4CN6A 3QRHA 5DXYA 4JN8A 3M0HA 1Q85A 4CKQA 3NA8A 3DEQA 4PEEA 1XFBA 4PCSA 2ZC8A 2QIIA 4C6JA 3UYCA 5TAOA 1Q5MA 4M80A 3CUFA 4FOKA 1LF1A 3IIOA 1H7NA 2YDAA 2C7FA 4V1XA 3W27A 3VM7A 2ZRYA 5F4SA 2YXGA 1CWYA 4AD0A 3CHVA 2WC3A 2J24A 1YHTA 1J0YA 1NFGA 4MSSA 1UBSA 4IXHA 4FF7A 2FB2A 3U0HA 2D0FA 3B9OA 1L6SA 3GHRA 3N19B 3WQVA 3LX9A 2GUUA 5C5YA 1QJWA 3LB0A 1E3ZA 1HJXA 2G97A 3F4VA 3K1DA 1E6QM 4OQVA 3WY1A 3HQPA 4UUIA 4XAPA 1HJQA 4OBTA 4A3YA 4FNPA 5AYIA 1FWSA 2QJGA 1Q6LA 4E5TA 4K8GA 1S5TA 3LEPA 1VFFA 4XKYB 2WVVA 3WK3A 3CK5A 4AIOA 4M6QA 3N6HA 4YLWA 4H8UA 4S3JA 4US6A 3SFKA 5D2XA 3RIKA 3PG9A 5C9RA 3CHFA 3MI3A 1VBRA 5HWNA 2OX4A 4GMEA 2F2KA 1D8CA 3AS0A 1K3UA 1B4EA 5D04C 3CB3A 3EOLA 5LIUX 4NP7A 2PBOA 2V2HA 3CV6A 3FJ6A 3ZZ1A 3MB9A 3K2GA 4GLEA 2Z2AA 4P7LA 3L2MA 1WNOA 2P3ZA 1CPUA 3RX4A 1TE1A 4R53A 2XFYA 1SO6A 1ODUA 1KV8A 1W91A 2PA6A 4HNUA 2PURA 4XSMA 3BC9A 3R79A 3U2OA 3OVQA 1AZ1A 2YIHA 1A5OC 3WZ0E 2PRLA 3BZJA 2V5JA 2TYSA 4HTBA 3MMWA 4ZMGA 3BANA 1QMLA 2Z6JA 3T2PA 3WBEA 1FA2A 2YJQA 3RMJA 3NJ3A 1XYAA 4ZZ9A 3GG0A 2QCMA 1SGJA 3IJ6A 4B16A 3NXLA 2VZUA 3SB0A 3CMFA 2A21A 3QV6A 1A0DA 2RJHA 2WNNA 1PZ1A 1XGZA 3G3MA 1OK6A 3S4TA 4JL1A 2X1IA 1XYFA 2ADAA 1FDZA 3BV7A 3H70A 2ZOXA 1KR1A 3PN8A 3WQCA 5AFDA 4HNLA 3V5CA 3AWOA 3WD4A 3I7QA 1W2PA 4OBRA 4PUEA 3TLLA 2WK2A 5CG7A 2XZ7A 4DUVA 1WPCA 1KM1A 9RUBA 2C1HA 4DVOA 1J6OA 4HA0A 2ZE0A 4DN1A 4S2BA 4ADTA 1R87A 3I65A 3U2EA 1KD0A 4HN4A 1BXCA 1W3NA 1V08A 3R7MA 3B8TA 2OWCA 4G7EB 3THCA 3M0IA 3OODA 1EUNA 1NP2A 4GY0A 3LGGA 4OVXA 2FLIA 2CNCA 3ITVA 2ZBTA 4DF2A 4QIUA 1HJWA 4JIIX 1EYEA 5DEZA 1FWRA 3W82A 3H2NA 1RVKA 3NSNA 3ZJKA 3N29A 4YCPA 3FYOA 3CQ0A 3P81A 3Q58A 3IJIA 3MO7A 1XKJA 4E38A 4QS6A 4O10A 5BOOA 2ZVRA 1WZKA 4I7UA 1UB3A 4AD3A 2OU4A 1SR0A 2CFFA 2GOKA 2QJHA 2W67A 3OYZA 2VXNA 4AEOA 3IEBA 1UH2A 1MZRA 4WSJA 4KEUA 3ONCA 1Q3NA 2AAAA 3GUWA 5LIWX 5HMSA 4S3EA 1UD5A 3WDIA 4Q8UA 1RV8A 4AZGA 1DWAM 4JQAA 3OGVA 3AROA 3PUDA 3TDFA 3NVDA 1HO4A 2V5CA 4M8UA 1WZLA 3MKCA 2XGBA 1ELSA 4AWUA 4ZSTA 4XAFA 4GGBA 1TREA 3BK0A 2QPXA 2INFA 4JDBA 4S23A 1XL9A 1EGMA 3BTNA 1BYAA 2CITA 1F3XA 2O56A 4N4PA 2WLZA 5AHNA 2C8NA 3L65A 5FF2A 3BH4A 4C6PA 1NY1A 5C9ZA 3QZ6A 2X41A 1DXIA 1Q65A 4AMAA 3GAYA 4TV6A 1FHDA 1RY0A 4C6CA 1XLAA 3GIYA 3PP7A 3O0FA 2VQTA 3IWPA 4F40A 1Z3NA 5BWFA 3F4NA 5A6BA 4QM1A 3AOFA 1UP3A 2ZICA 1TELA 3M7WA 4DNHA 3WJSA 1FTXA 3K46A 3PBWA 4IMAA 1FWFC 3HV9A 1P6WA 1JUKA 2SFPA 3WIJA 1BRLB 1X6UA 3SRDA 2OEMA 1ZJAA 4KWVA 3CV2A 3W53A 1NVMA 3P0XA 4WKFA 4ATLA 2X1RA 3D3AA 5EBUA 1OC7A 4HSOA 3WQDA 1LBMA 3IS4A 1F8IA 2V63A 1VFHA 2E09A 2OOFA 5I3KA 3L4XA 2F6KA 4AISA 4NAFB 1TPB1 3W1UA 3T0DA 1V0KA 7PTDA 2QKFA 1Z41A 1J01A 1ECEA 3FKKA 4DUWA 2Y7DA 1JAKA 1JI1A 4WD0A 3EOSA 4U5KA 2RAGA 3VNJA 4UTJA 4LH8A 3NO5A 1O5QA 1U22A 2BOFX 4NJKA 5D2YA 2WSRA 1SPQA 2Q3OA 1SZRA 3VX0A 4UTFA 3H23A 3IRSA 1G7UA 1JF6A 3G1SA 4F9JA 3C86A 2BHYA 4GKLA 3LCGA 1JDCA 1M7JA 5AHMA 3H8AA 1PDYA 3NQAA 2DFAA 3W1MA 1GEQA 4N7QA 3PB2A 1BYDA 1O4UA 1RPXA 2J62A 1FH7A 4JIRA 3QYQA 4IG2B 4AY7A 1FP9A 4OE7A 4S1FA 6XIMA 2VFIA 5L6UA 1YBQB 4LUSA 4C6QA 3NTYA 3KRBA 3NCOA 3KBMA 1UWUA 2WNQA 5EU9A 1W9DM 2ON3A 2ZWZA 3AWNA 1KRMA 2H9AB 4M81A 3GKFA 1K4GA 4ACYA 1TX0A 4WF7A 1JG9A 3CZ8A 4WR3A 1ITXA 3T40A 2XUCA 3OHMB 4UFJA 2PTWA 4IF2A 2D2GA 4EF9A 4OV4A 5G1YA 2ZWYA 2X1UA 4I5XA 4AX6A 5HAOA 4WRHA 5CSUA 4I9MA 4C60A 3KLKA 3EWXA 1FWBC 1H63A 3LXCA 4E4PA 3REQB 1OADA 3DECA 1O12A 3ZLHA 1YIXA 2W92A 4P5UA 3VE9A 1PKYA 3IV8A 3ITTA 2DJXA 2WAGA 2AMGA 1XLHA 5EMKA 4R9XA 3SCTA 2R1PA 3PBVA 4LY4A 3IIZA 2RJGA 5IDZA 2O7QA 2H3BA 4XV0A 3IJ7A 1XUZA 3GUGA 4N9DA 5DMYA 3GM8A 2BWGA 3OVPA 1W1PA 4IJBA 3WFLA 1OFRA 4OGZA 4HCLA 1OIFA 1VD6A 4DUXA 4ZE5A 1LM1A 1EP1A 5A6MA 3SZ8A 2CU0A 2CHOA 3RRXA 3DERA 3ENLA 3M5VA 3MHFA 3VDGA 1QXLA 3KBVA 1LROA 4KERA 3TYZA 3WLOA 3TN6A 3VAVA 3TC6A 4ZL1A 1R3SA 5LXEA 1XBXA 4M29A 4A3UA 1L8PA 1UOZA 2I7GA 3WLRA 2PZNA 1R9ZA 4J3VA 1LQ0A 3WQ5A 1MMFA 1ADDA 1SO5A 3B9DA 3CMGA 4KGLA 5CKSA 1RCQA 4GYFA 1H0IA 1QHZA 3TXZA 1B1YA 3S5ZA 4BWLC 1VLIA 1FFQA 4LWWA 4RW5A 3THAA 2HTMA 3SUTA 3ZVHA 3LXBA 3TTEA 3GDMA 1AMKA 1O6IA 3DC8A 2P0OA 4HYVA 2VGIA 3OU8A 3UZWA 1J5SA 3MVIA 1V6XA 3N13A 3QZAA 1K02A 2XVPA 1JYXA 5F2MA 3FA3A 2X0YA 1HX0A 4KEMA 4XISA 3B06A 5BMXA 2PWEA 1KM0A 4GNKB 4IHCA 3L0NA 4GWEA 1H61A 3GH4A 4S3AA 3B3DA 3OZOA 4FNQA 2ANUA 2C1IA 4WJ8A 1CBGA 4A22A 3ZMRA 1FH9A 1P7TB 3ARYA 4XAGA 1W6TA 1MW3A 4WDUA 4M0XA 2PC8A 1NWRA 3BO9A 1XQLA 1QOQA 3GVQA 4GY1A 1Y7VA 2NV9A 1E15A 2VD8A 1V7AA 4A3QA 2PDXA 4FX8A 4CD4A 1OT2A 2QPUA 5A95A 3WH6A 3PULA 2GLKA 1EKOA 3IARA 4S3CA 1X97A 2VZOA 3NPWA 4QHRA 1KB3A 3UZZA 1RLCL 3M7SA 2E5DA 4QLLA 1O7AA 1D3CA 1XC6A 2Y7EA 4BF5A 1B30A 4DX3A 5FL0A 1F5ZA 5D38A 4DYKA 1K8XA 4ERAA 1GOMA 3GDLA 3GFZA 4GUIA 3GDBA 3COTA 1R30A 2D2OA 1JNEA 5E5CA 4N6EA 3F03K 3VKBA 2HS8A 1Q13A 4G1KA 2A3LA 3LGDA 3SN0A 4MJ4A 2G3IA 2G3JA 1TB3A 4JL2A 3HMJG 1OX4A 5JBFA 1EF2A 3N4FA 1JPKA 5G2HA 1Y5XA 1BPLB 4L4OA 1YNYA 4YXGA 5DX7A 5GQBA 3LNMA 4RZBA 3PZMA 2PWDA 2FTYA 3S5OA 5I00A 4XAZA 1AG1O 3TX9A 3N04A 4UQBA 3IV3A 2FGZA 2OVLA 3LMYA 3S1GA 1PJ9A 5EMYA 4NKCA 5G2IA 4AVOA 5M3WA 1P6BA 4B4HA 3N12A 4ICMA 4Q4RA 1IR1A 4QITA 4DWSA 4FXSA 2O9TA 4UFKA 4RV3A 1CLKA 1EDTA 3KX6A 4Q7IA 3BICA 2Z0IA 3LUTA 2VR4A 1BEUA 3TMLA 3BWWA 3VOGA 3FYYA 2ZXAA 5H1WA 3WJYA 2B7QA 4K7VA 4PC8A 3T4CA 3C0QA 1Q4NX 1B3XA 1VF8A 1K4HA 9XIMA 3OZPA 1P0DA 1DJIA 1UUOA 3IUIA 4Q4SA 1PWMA 3T0CA 4QJ3B 3D0CA 4ES4A 3OG2A 4FLRA 4IGNA 2I17A 4NQ1A 2E4TA 1LT8A 1SW0A 4ZB5A 2V6AA 3WLMA 1ICSA 4O4WA 2NQZA 3CQJA 1EPVA 1MO0A 1Z32X 3URAA 3EEZA 2FZ9A 4WY0B 4REQB 1VBUA 4H2CA 4O50A 4RX0A 4K39A 3E74A 4NI8A 1Z42A 2W91A 3ABQA 3OLDA 2OZ8A 5IXEA 5G1TA 3AMCA 3KBSA 1W5QA 1F2JA 4F4RA 2WSKA 4Q4MA 3C2YA 2J47A 3J7HA 4GXPA 1XCWA 4R88A 2ACUA 1GGOA 4MNKA 2ISDA 1M7PA 1SO3A 2OODA 3SADA 2HK1A 2EPLX 1CLXA 3G6MA 4GA8A 1F6PA 1DIEA 1BQCA 1EJXC 4KEVA 2QEZA 1UG6A 2VOMA 3D47A 8RUCA 3TW9A 5JH1A 4O1AA 1US0A 4XD4A 2VL4A 2FMNA 1HN1A 4PFMA 4UOQA 3RITA 1JQXA 3H53A 5KITA 4QQ3A 1FWHC 2PBGA 5HQLA 4EKJA 1WB0A 2DT3A 1ML1A 3URNA 4K37A 2JKPA 4YS1A 3FW6A 1RA0A 3PJXA 3LI1A 4DJEA 4D6HA 3SBFA 1SSGA 4F0RA 2DUAA 4AG0A 1RJRA 4ZOBA 4YTRA 4JQ1A 4ERGA 1QBBA 3H4GA 2PE4A 2J4GA 3FXGA 2DW7A 3W1XA 1IT0A 2PDBA 5L9FA 5E9AA 1RPKA 4EX4A 2KZHA 3G1DA 4ZO9A 3PNUA 4GCAA 1S2UA 3LCHA 3W1AA 3K5XA 3QSRA 3K8MA 4ZCWA 2VYOA 1JXJA 4NJGA 1A47A 2R1KA 2BB0A 2BX7A 2VCAA 3W7JA 1SUXA 3AJXA 2DSVA 2ZRZA 4W5UA 1ZJHA 5JU6A 3GLCA 3BLIA 1I1WA 2BY3A 3N4AA 2GQ8A 4UC5A 1HVXA 1DXFA 4CU7A 3U4FA 2GZXA 5E9XA 2CYGA 3F7JA 4BF7A 1C8QA 5LNSA 3SCOA 3UYIA 1VBHA 1RY8A 3AS2A 1LG1A 2ZTJA 3OJGA 1JGIA 1BHGA 1ZBCA 4JY9A 2F9RA 2POZA 2HEJA 4LW7A 3KE0A 4CNNA 3F5JA 3KZPA 2JQXA 4BI5A 4L1GA 4GZJA 3P67A 3VIJA 3W7HA 3A21A 3OW1A 1DE5A 5CGQA 4OTKA 3T0BA 1GOOA 1VQTA 4JTTA 1VJSA 3P6LA 3TWBA 2FZDA 2YCEA 4JTAA 1RAKA 3MKVA 5AHLA 5C0QA 3POHA 3LHZA 5BROA 1MXGA 2E6DA 3EXSA 4FB7A 3G1VA 3K8KA 1GYMA 4PMOA 3PC0A 3G18A 1SJCA 3C4UA 4GZEA 2Z1XA 4L61A 4UQEA 1TIMA 3GYCA 1KQYA 1DJZA 1EOMA 3PBGA 1DJHA 2IQTA 4DM2A 3W2LA 3KVJA 2GDUA 1TVPA 5DELA 2QCEA 3TP4A 3R2GA 4XTIA 1C9WA 4IMFA 4JKLA 3RLGA 2AKZA 5F2IA 3C2FA 1XH0A 5IFTA 2BSLA 3C61A 1A3WA 2TSYA 3KOXA 1W1TA 4WDXA 3S83A 2VHLA 1QRQA 2VCCA 3KFTA 3TSBA 1DORA 2VFFA 1KA9F 3R10A 4R85A 3RR1A 4Q8TA 1OHLA 2DVXA 2QJMA 4NAFA 4P2VA 1LOQA 1EBHA 2J75A 4WCJA 3W1QA 4I90A 2ICSA 3APGA 1NJJA 2C6QA 4N02A 2FPVA 4EPEC 3GKAA 1DQWA 4FA3A 5ABEA 5C9WA 4G56A 1D3HA 4F2BA 1I1XA 3GR8A 5LA1A 4N9CA 4U10A 2XN1A 1VEPA 2Z7KA 2WMKA 2D73A 4B9ZA 2FB3A 2IKGA 1JZ8A 1WDWA 1I2NA 1QW8A 2YLAA 1MEWA 3I7SA 3M0YA 5F1VA 4HVXA 3AHXA 5C2CA 1ADOA 4I8DA 4JTFA 8CGTA 3W01A 5XINA 1F76A 1VFSA 2B7PA 5KSWA 2TPSA 4GIRA 1H3GA 1ZQ5A 4KWOA 1A5KC 2X1SA 3TZFA 4C6NA 1VH7A 1XG3A 3W75A 3GTNA 1V93A 5AC8A 3CM4A 1J11A 3DZ1A 3G8RA 5EY5A 3KDOA 1UR3M 4MG4A 1IE7C 3OQ8A 4MKSA 3WELA 3CAVA 2BY0A 2WQDA 1Y0EA 5HINA 2WLYA 2Z1VA 3VU2A 3HFYA 3CV1A 5BXTA 4MWAB 3V5OA 3N11A 4IFKA 4RZ6A 3RJYA 1NDVA 1UYQA 3MDUA 3EBVA 1JCMP 3N17A 3VCNA 3WK1A 2C13A 3B8VA 4GX9A 3U5YA 3W22A 4B5UA 3A13A 4I9TA 3WH8A 2ZUWA 4G7EA 1ME8A 2V3GA 1UR0A 3WUGA 1A5NC 3GC4A 4LT9A 5DCBA 4MWAE 4K2SA 2C15A 4PL2A 2NXHA 2PUZA 1VFUA 3VKKA 1R3VA 2NSOA 3U9IA 3T2OA 2GK1A 2PTDA 3JU2A 3CTTA 1SJBA 4HNVA 3H55A 5D37A 3GXTA 4WJXA 3GZAA 4FSAA 3CWNA 3UR5A 1YPFA 1GQKA 3RXZA 1YPIA 5ABFB 4NZ4A 1E0VA 4Y9OA 3SCPA 4BQ5A 4ONVA 5E0KA 5H8PA 2C1GA 2IPGA 2QCGA 2E0PA 4K8HA 4DHGA 1V6VA 4AHPA 2QVNA 4P61A 4H8NA 2GJRA 4LAUA 2A3HA 2OLAA 4QRNA 3WMSA 3DGBA 1ZAHA 2VDGA 5D2WA 3VMOA 2VWSA 4JNZA 4Z1AA 3QR0A 1D8WA 1J0HA 1WUEA 4NJJA 4W93A 5I2UA 1FBAA 2P3EA 5FESA 1TIWA 3OLGA 1XLJA 3A3HA 1KCXA 3I68A 1V3IA 2DZSA 4HTYA 1Q6OA 1V8EA 4I3GA 5CBJA 1FCUA 1XD0A 3R0DA 3B40A 1ZFJA 3BMVA 4AXKA 3TW7A 3H26A 3WH9A 1WZMA 2QCDA 4E4UA 3W6YA 4JAWA 3SQLA 4A29A 4NRRA 2H8ZA 1M41A 2O7SA 4QG6A 4S3GA 1E56A 1GVRA 3GXIA 4NJHA 4X0VA 2X8RA 1E1CB 3C0JA 3UJFA 1YE6A 3FNDA 3W76A 5M17A 5BWAA 2E9MA 4O18A 5T91A 4D71A 4MPQA 4UTMA 1RD5A 4M1BA 1G5AA 3KCLA 4WK9A 1DIOA 3W2NA 2H90A 3CGTA 3GSMA 3W7IA 3AQUA 1WCGA 4U2YA 1V3LA 1E6RA 1GZJA 1Y5VA 1A50A 1E6SM 3VIFA 1VYSX 1H0GA 2JKAA 4O17A 1HKWA 3ELFA 3K13A 4YVXA 3N6QA 2QDEA 2REQA 1EX1A 4PTWA 2V2DA 3DG6A 5FCZA 1U2YA 1UQZA 3B4YA 4QLJA 2OGYA 1Q66A 2BTMA 4QE5A 3URQA 3RCYA 3SCVA 3LHYA 4JQ3A 3U5UA 4CEXC 1ZBKA 1S2AA 1QI4A 1LWIA 4DO6A 3ZIZA 1PUDA 1TWSA 5HPCA 3AJ7A 3CB8A 2WV8A 4DJED 4C6LA 4QXIA 1CNVA 1SJAA 1TTPA 1EJSC 3QY8A 4LUIA 4XKYA 1OY0A 2CLMA 3MJYA 1BYCA 1MW1A 4IMCA 4DAIA 1VCVA 3V16A 1R3WA 1M7OA 2GGIA 2Q09A 1TVNA 1C7SA 3OGRA 2BXVA 5BXSA 4UZUA 1HW6A 4O57A 3G3DA 5EMUA 1MWOA 1ZUAX 4WQ6A 3UERA 3LLFA 8A3HA 1R3YA 1EDQA 2D2JA 3TTOA 4LU0A 4J4KA 4IM4A 2R6OA 1XDJA 2HMCA 1POKA 5A2CA 1N8FA 1Y65A 4ZFMA 3DX5A 2EQDA 2HXUA 3QGAC 3W88A 2EAWA 1SZEA 1N7KA 3M6DA 1T96A 1G0CA 3WFZA 2XN0A 2DIJA 2X0HA 5KZEA 1YTKA 3FDGA 3IGUA 5BRBA 3W81A 5I03A 4O28A 4BI6A 5DFAA 2AGKA 1RK6A 2J6VA 3UQNA 3GXFA 4H7VA 3S6OA 3TCSA 3PPCA 4IX0A 3TKFA 1GPFA 3H2AA 1FCVA 3GAKA 1FWGC 1FCBA 2PDKA 1AQMA 2YBUA 2IPJA 1AUSL 3BAKA 3B8IA 4JDYA 2NSXA 2WMGA 4MY8A 1PEZA 1J12A 2PWFA 3AIBA 4L9XA 2WC7A 3GNNA 3L0KA 1XSIA 1WKYA 3GIQA 3CIXA 4RXGA 2BHZA 5CSYA 1QWGA 3N2TA 1SJDA 4R9OA 3UWEA 2OSXA 4NUWA 1C91A 4AHOA 4NNCA 2CCRA 4RPPA 1UROA 4XUYA 2HS6A 3UJSA 3SY8A 4Q4OA 4LUYA 5JH2A 2P10A 3AICA 7REQB 2F6XA 4CNUA 3MBFA 2J7HA 4UQDA 5EBAA 4ZOCA 4I5RA 1XWYA 4E2DA 4B5WA 3EPOA 4DJDA 2NWSA 4LOCA 3LA4A 3BMXA 4EE9A 2XH0A 4MTVA 3BPWA 1XSJA 3NQGA 3GNPA 1WBJA 3MU7A 3TJLA 3P2VA 1OCJA 3IUDA 2BMBA 4Z08A 4J3TA 2OWWA 4XK2A 4Z0SA 3GRIA 3NFUA 2GWNA 3S1UA 1W31A 1PHWA 4E8CA 4W85A 4FO4A 3KCOA 1R3RA 3BSHA 4L4LA 2Q8XA 2YDRA 3WH7A 4QLKA 3WJZA 5MKGA 2Q71A 1IGWA 4AEFA 3NGFA 2C3ZA 2VURA 4GNJA 4KRTA 3BG9A 3BW3A 4HA1A 1EA0A 3TC3A 4P7RA 4KIEA 1PYFA 1DJWA 2YZRA 1C90A 1MQPA 3CAKA 4XIAA 4KCTA 2GSEA 3VDAA 2EG8A 2PLKA 2CLKA 3O16A 4NRSA 3AHVA 1JQVA 5HMDA 3WLLA 1XD1A 3AU2A 4IGHA 4H01A 1VZWA 4Q8OA 2XIIA 3ARXA 3QR1A 3CQIA 3K4WA 4DAFA 1NDYA 4CQBA 2XIMA 4OKDA 3AXMA 3UGRA 4D6FA 3IPWA 1W3IA 3FIGA 4Z1CA 1KV5A 4EVZA 4TR9A 4EAYA 1QO5A 5DBTA 3LPFA 2BLEA 3WNNA 1AZ2A 3HTWA 1EEPA 1ZHAA 1CGUA 3L9CA 2YR1A 1A5AA 4YNGA 5D30A 4D8ZA 1ITUA 4R27A 1S2CA 1XX1A 4OFCA 1JGMA 4C6OA 3EWWA 4GQGA 1VLWA 5E70A 1OD0A 4L7ZA 1W1B1 1MUCA 4I9JA 3OEXA 4W7VA 4FXJA 3LNPA 4JFTA 3L5LA 4A8LA 4Y2WA 3WDQA 5DCEA 1W5OA 4P8WA 3WJWA 1N2VA 4AZCA 3M47A 4J40A 4BQ2A 1W0MA 5CBIA 2YA2A 3LG3A 4HZ6A 3FY1A 1E9IA 2UZ9A 4QGCA 4Z2JA 3W07A 2D20A 3V1PA 2JFEX 3FDKA 1ZPTA 1OFBA 1GPWA 3SCNA 2W3ZA 1BKHA 1OBAA 1A80A 4HU3A 5H6HA 1W3LA 2FH6A 2WJDA 2Y1HA 3CS2A 4ROQA 4PMZA 4H9YA 2PS2A 4TIMA 1CXIA 4CQ8A 4JYDA 5MHBA 2FPYA 4JTEA 2QCNA 4EXAA 1UP0A 5BW6A 3QF0A 3AU6A 3BAYA 1R7AA 1OB0A 3AS3A 5LZLA 3G1FA 1MFVA 1Z44A 1FRBA 2CWNA 4NZCA 4UTUA 4A2RA 3BSGA 2FYMA 1I60A 3T78A 1UZHA 3ALFA 1BF6A 5D9NA 2QAFA 3GDTA 1HQTA 4M3PA 1TMLA 3MCNA 4KRUA 1EHAA 5M2FX 2DEPA 3CQKA 2W9MA 4V15A 3TYCA 3TLQA 2GQ3A 1B5TA 1TV3A 1O5RA 3T6CA 3KUMA 3MP5A 2INZA 3CUGA 1TCMA 5HA7A 3GU2A 2Z2UA 4FI4A 1PX8A 1V51A 2ISSA 2PWVA 3MCMA 4R7WA 3ZLFA 3ZJ7A 4FNSA 1KFCA 1Q7MA 1XIMA 4H9ZA 5C54A 3GVGA 4DY1A 1UPMB 3C6CA 3S8HA 3HQ1A 3TV8A 3ZYZA 3O05A 1AQHA 2IQ0A 2HK0A 3CUJA 3UWVA 4O13A 1JRCA 2WJFA 1VR6A 2ZZ1A 2WYSA 4A21A 3HGJA 1U5VA 2YXOA 3BW4A 4DYJA 1K8ZA 2ZUNA 1KXHA 2DZTA 1C8YA 4YVPA 4LFYA 5E0FA 2PCQA 3VKAA 2OQHA 5LXXA 4J28A 4R7JA 1QNOA 4EPDC 4TMBA 3ES8A 3HA1A 4LVAA 7REQA 1YXYA 2QGHA 5DY3A 3BOXA 5I07A 4CUCA 2HXTA 4E2OA 3HG3A 1IYXA 1GUVA 1ONXA 4NZJA 2BOGX 2PDNA 1QVBA 4E6MA 2QZRA 1AH0A 3C52A 3UWYA 3NAVA 2Y4SA 1B90A 4KIRA 2EXOA 1VJIA 1GVQA 4NILA 2YBTA 1B31A 7A3HA 1UKQA 3CHCA 4UMBA 4J5NA 3FAXA 1CB2A 1ICPA 1ISVA 2NLIA 1JCNA 1FDYA 1RCOB 3GVVA 3A9IA 1V6WA 1FKWA 2WMHA 1DYSA 3L2IA 3PR2A 3TOYA 4G6CA 3RPTA 1V03A 4W86A 1LLOA 5A6JA 3WLHA 3R1ZA 4JIEA 4AZ5A 1UZDA 4RV8A 3ZT7A 3ITXA 3LZ3A 4C6BA 2ZCGA 3QKZA 1GOIA 1VP5A 2C91A 5DT5A 2OXNA 2W63A 1S3TC 2EGZA 4JN6A 5HANA 2PDWA 4HPXA 4RE0A 3PTMA 3EOUA 4N9EA 1VGAA 4GIYA 2HE8A 9CGTA 2JF7A 4JYFA 1FWCC 1HO1A 3IANA 2D3NA 4PSPA 1OF6A 3SUWA 3B03A 5LNVA 2ZVIA 4RXFA 5D32A 1F4AA 3QMRA 2PODA 3TTSA 1H41A 3U3HA 1BG4A 2O92A 2VFDA 3LRMA 2J9ZA 1H50A 1ITCA 4M1RA 1W1ZA 2GOUA 4KGJA 4J3WA 3W72A 3VNLA 3DYPA 5CSRA 1JD9A 3CYJA 1RZMA 1I0BA 1WDRA 3NQ8A 3UJ2A 2HDJA 3PPHA 3S9YA 1R2RA 3CUXA 1DJQA 3EB2A 3KL5A 3TTYA 1LTDA 2JE8A 3UJEA 5TIMA 4Z2HA 1OFOA 2JIWA 3BLPX 3W29A 5DRCA 5JQ9A 1N82A 4H83A 3THQA 3GC2A 4R3UA 3V0UA 1BLIA 4QDPA 1GQJA 1JDDA 1TKKA 3H21A 2F38A 3KL3A 4DQWA 3ITLA 1BRLA 3G1HA 5B7ZA 1TPWA 1TX2A 3VGDA 4MZYA 5F1UA 3UETA 4HT3A 3H2EA 5I24A 4Q8WA 1OYAA 1ZNNA 4UXDA 3LENA 3WQFA 2XIBA 2R82A 4QNEA 3WF4A 2R94A 4MB4A 4WDTA 4KESA 1YLVA 1EO7A 4JTGA 4Q8NA 3W7RA 5J5DA 4AHQA 3M46A 2JEPA 1FXPA 4ORMA 4CNSA 4DI8A 1E0UA 3WD2A 1V0NA 4BZYA 1PDZA 4ZQMA 2BFGA 4WY0F 1YW1A 3Q45A 1G67A 2EHHA 3EDJA 4ZEPA 2DW6A 1TPUA 4EXQA 1RK5A 5CZSA 2A5HA 3G24A 4GGHA 4FEZA 3O06A 1W1IE 2OJPA 2PDMA 2V3EA 3W74A 3OHIA 2XFFA 1FWEC 1R47A 5F7UA 1JZ3A 1XYZA 2J9XA 2ZYFA 1CXLA 3ZM8A 3GVWA 4UTHA 5CJNA 4O19A 2PDPA 1OCNA 3P82A 3RPMA 2A3CA 5TF0A 3TUUA 4H2HA 1GTEA 1NAL1 1H7PA 1PX3A 4BJHA 2E5CA 5GVJA 1QPRA 4OOUA 3MV11 5XIMA 3KOZA 3E9AA 1GVFA 3O3RA 1OGGA 5LGXA 1GJWA 1RXOB 3TMQA 1CECA 2GUBA 6TIMA 3VIPA 3WG6A 3L67A 4IMGA 1L9WA 3GFYA 2VZTA 5FJJA 3ZSSA 4Q4PA 4Z1YA 3RRAA 1P0KA 1EC9A 1GOKA 4FNRA 2XG9A 5FEXA 1GVSA 2G3NA 3B0XA 2PF0A 1XYLA 1TTQA 1EJUC 1TA3A 1U5HA 1GEHA 1EC8A 4UFLA 3C3UA 5I09A 5I3JA 5KEZA 2EKGA 3AALA 3HPZA 4AY8A 2BV9A 1PBGA 4RR4A 3N18A 3UXLA 2PWHA 1DP0A 2VX4A 4KCVA 1XIGA 2J7FA 3PG8A 1X96A 5LA2A 1VEMA 4AFYA 1JIBA 3F5KA 4GUFA 4XD3A 3VKJA 1T6MA 3CEUA 4UFMA 2OYMA 4GINA 4BEUA 1EIXA 1GHSA 1KRBC 2VT0A 4ZODA 5EB8A 3IK2A 4CCCA 4F0LA 1BTCA 1J5TA 4JTRA 3QPYA 2AKMA 1L6GA 3GX9A 3U57A 1GZGA 2VDHA 3NG3A 3OLIA 3SR7A 3O0KA 1IF2A 1ZY9A 4X2PA 4HNTA 2IKJA 3R8HA 3WF1A 1K03A 3VOIA 3A4WA 3CIWA 3DHDA 4CVWA 3EKZA 3VGBA 2O9PA 4B5XA 2PSNA 1W56A 1YKWA 5JIPA 3IVUA 2V38A 5CPTA 2P5NA 5C9XA 3KWXA 4QJ5B 2BXYA 1C8VA 4UQCA 3L23A 3DIPA 2E77A 1Q6FA 2PGRA 1TSIA 4MADA 1OD8A 2EBNA 3DKLA 5HNRA 4GXWA 3NOYA 1DTUA 2OZTA 2FGBA 3FX4A 3NZ1A 3R13A 2AGTA 4LJ3A 3S47A 3VIMA 2QJNA 4KF1A 3NQ6A 3P8IA 1PZ2A 2ZA3A 3U4AA 1B9ZA 1KBIA 1S39A 1NDWA 3PTKA 2YCLA 5I0DA 5BRPA 2YL5A 2WZHA 2P8CA 1UR1A 1V79A 4Q8PA 4JTSA 1CIUA 1JYNA 3WNMA 4DZIA 2RH9A 3FVDA 1H1YA 2P50A 1AL7A 4XB3A 3CIVA 3MPGA 5DN1A 1GVEA 3DCPA 2Z2BA 1XRFA 1BWVA 3OA5A 4UQ9A 4FALA 3GXNA 3W7OA 5HR6A 2DVTA 4ZTXA 5HJLA 2GDQA 1L6YA 1XGDA 4QISA 3AAMA 3SJ3A 1LL6A 3TN3A 2QAPA 4LCRA 4PYSA 4AQLA 4US5A 3POCA 2VFHA 3USBA 3BW2A 2NQJA 3CHDA 4NI3A 1Q2RA 2FDMA 3PSVA 1VCGA 2G41A 1V6UA 1A5SA 3TNBA 3CZJA 2DUXA 1OX4B 5DANA 1TMHA 4Y90A 4WKHA 2J7BA 5HK4A 4C1LA 2FJUB 3PNZA 1FX6A 1DHPA 5AVHA 1BGGA 5AZ1A 1TG7A 5CPSA 2PDYA 3HQNA 4MZ8A 3QYSA 4P8XA 1GONA 2QCFA 1PZ0A 1A4MA 1PAMA 3BGJA 3VIOA 4J2MA 5AECA 1IZKA 1RJPA 2J7CA 3CH9A 2V3FA 3WD3A 3ZQ9A 1RP8A 1ISZA 3FK4A 2C0HA 5CAHA 1DJXA 3VMPA 2E8ZA 4GJIA 4DZ5A 4LUTB 1E9LA 3QC3A 1NF7A 3S9ZA 3FEMA 1GQNA 4EWND 3V4BA 1GVYA 3E0FA 2X16A 3FYPA 2QDDA 1XPGA 4C7DA 3QTGA 4MM1A 3BLFA 3RK8A 1UC4A 2Z1BA 3EYPA 3U6WA 4IQJA 4IP7A 4IP4A 3GU9A 1CB7B 4AZIA 4AWEA 1N8WA 1CCWB 3SCUA 3UCCA 4AY1A 2BVYA 3VD3A 4AWSA 1N8IA 1EO5A 1T8QA 5BXRA 3QXBA 3UXAA 1A49A 3N1AA 1M03A 4GXMA 1MSSA 3TK7A 4ORIA 1HFBA 2OPJA 4IIEA 2OSWA 4IQLA 2Y7GA 4NU7A 4PMXA 3NQCA 1VPQA 1HKKA 5C70A 3LTYA 4CQCA 5LNRA 3GD6A 2Q3RA 1X39A 1OFDA 1E4IA 3BAIA 3DFHA 4DUOA 3MW7A 1E6ZA 1WP6A 3CH0A 4PRWA 3B9AA 3HU7A 1ZCCA 1M3UA 2OWXA 4C6IA 1HIZA 3PJTA 3TYEA 2WHLA 2EJAA 4Q4QA 3W84A 4H9MA 2QF7A 4U4MA 4XIMA 4MY1A 2BXZA 1AW1A 1Q6CA 1FXQA 1NOWA 1RJQA 1J0IA 3EXRA 5HMEA 1GOXA 3G1XA 3B0VC 1W5PA 1PIIA 1E4MM 3CXOA 2IUZA 1G4SA 4KPLA 3NWRA 1RQEA 1WAUA 4NSBA 4N2YA 3QFWA 3UU0A 2UWFA 1XDMA 5LIYX 2C19A 3R12A 2WMIA 4LYQA 2R91A 3URBA 4B9YA 2YL8A 3ICJA 3QLLA 3VGGA 1VFTA 4L1WA 4M6PA 1J9YA 3UBPC 3UJRA 3OIXA 4DYEA 2Y8KA 2ZZ5A 2RHGA 3NPXA 2Y0FA 4J27A 1S2TA 2QUNA 3C56A 1YDVA 3DBNA 1B0IA 1JCYA 4ZO6A 5I78A 2VVSA 3KOFA 3S2MA 2W6RA 5I5RA 3EWUA 1VRDA 1S1RA 4WLCA 1S46A 1C92A 4AZCB 4ZB2A 1W9BM 4UZSA 3ZXWA 4BEQA 4O1EA 2Y63A 4MNMA 3VKCA 4DF1A 1H1NA 4JKKA 2NZLA 1UA7A 4H4IA 4DPQA 4UWMA 3W2KA 1OM0A 3VE7A 3I3DA 4KFOA 3RCMA 5KZ6A 3EWCA 4I5UA 1XI3A 3S2CA 2XVKA 3WNPA 1Q8JA 5PTDA 3VD5A 1X8CA 1V3HA 3UZXA 1JCLA 4ZFCA 3T0TA 4CD7A 3OO2A 1BTMA 3BMWA 2XH2A 1XLFA 3MYOA 2OT1A 1I75A 1W3KA 3T81A 4PMQA 2ZUSA 1L6WA 1TE6A 4IGMA 1TJRA 1NELA 4D6EA 1K9FA 1UR8A 4KWSA 3MA8A 4HJFA 3QZEA 1TPH1 2RUSA 4BKNA 1XCXA 1LWJA 5LIXX 3SCQA 3VNMA 5I7GA 3C3NA 1NP0A 1TWZA 1G69A 4GHRA 3QBUA 5AC6A 1KC7A 3GBEA 3M5ZA 3RX2A 2IW0A 3E2RA 1XV8A 1S5VA 4I7VA 4UTLA 3OVGA 1OCQA 1J0KA 2V81A 2D22A 3N2XA 2YA0A 4XBJA 4C6MA 3W24A 5CPQA 3WQ4A 4DWSC 4DLFA 3R0UA 1K8YA 1SZGA 1QI5A 2ZZ2A 4GO9A 1DHKA 3WKZA 5BOFA 4GH1A 4QS5A 3UD6A 3QM3A 3GDRA 3CUHA 2FJKA 2IMRA 4A6GA 1LRQA 3WLTA 4CQ9A 5A6TC 1XPYA 4CCDA 2ZX8A 2Y5JA 5JIWA 3VD4A 5LKYA 1WKEA 3G77A 4H6KA 4PE8A 3SCSA 4ENLA 4OJYA 3QEZA 3N6JA 2ZKMX 1W9XA 4F66A 3NR0A 1OYBA 1ZBVA 3TCEA 3IJ9A 4N0RA 5BMWA 1U33A 3Q65A 5C2XA 1VAHA 4L56A 3BLLA 3SDOA 3E5BA 5AB3A 5AC4A 1WKDA 3LBCA 3U2ZA 1KBKA 3ABZA 2ALDA 5J8LA 1XRVA 4MLRA 3CAQA 1QWKA 1UWRA 4FS9A 4E3TA 2ZRVA 1W3JA 4YCOA 1CXHA 3S2NA 4GQRA 2PDUA 1PSCA 4GVIA 1OT1A 1J10A 2F61A 4DBDA 2V3DA 3GHUA 3CMJA 3E6EA 3MMTA 3QN3A 1K7EA 5EKYA 3HG4A 2WVTA 5HWJA 2WSYA 5LIKX 2QCDB 4NXKA 4MUZA 3WMLA 4H04A 2EG7A 2NUXA 3I6EA 3V5FA 1RBOB 1JUEA 1TPDA 3FLUA 2EEXA 4H19A 1A5MC 1IEIA 2GGEA 5E1QA 1H11A 3LCLA 1WAWA 1VPXA 2X05A 3F2CA 2CLPA 3PZIA 2ZZ4A 2Y2WA 4J2PA 4QFUA 1EJVC 4YJ5A 1DVJA 1ODZA 2R1LA 2Z25A 3UG8A 4NNAA 1DJGA 3WD1A 4Y9AA 2VEGA 1J8VA 3LM7A 4C6KA 1XFCA 3R43A 3ZFHA 2TAAA 1EEXA 1E40A 3VX1A 3WQ6A 6ENLA 3VA8A 4RKAA 3PAJA 3WF3A 4DIAA 1XH1A 1OCBA 2WKLA 2I9EA 1R6WA 3EB4A 4WY0A 1OC6A 2JEQA 1NF0A 4HZMA 1D2KA 3GS6A 2XZ9A 3W6LA 4A8RA 4JTCA 3WENA 5SWUA 2XSXA 5FI8A 1OGBA 3PBYA 3G0XA 3VPLA 4L65A 2EF9A 2OO6A 3NM3A 3F5LA 3SIMA 5REQB 3CWHA 2FHCA 4B5TA 3N9RA 1LDCA 3OBKA 5HXMA 3LBMA 2VFGA 3R4IA 4N9BA 3T0AA 3LOTA 3FAWA 5F4WA 4NZ1A 5LA0A 5HBFA 1GORA 4L80A 4XZMX 3AO0A 3SUVA 4WOZA 4DZHA 3CZEA 3O2LA 1W5NA 4XTDA 3QY6A 1JL8A 3G6LA 4Q7NA 1W17A 2I1OA 2OQLA 4IL0A 1NWSA 1V3JA 3PZQA 2NLYA 1UMLA 2ZUVA 4ZENA 3LPPA 1OEPA 1EJTC 3ERPA 3G0SA 2H6RA 3ES7A 2G3FA 3S5SA 3IJQA 3LPGA 4W4QA 3VDBA 1P4CA 4JFVA 4TXEA 2HJPA 2WJEA 1AQ0A 1WXJA 2WCAA 1TVLA 1UWQA 1DV7A 2Z1KA 4UNIA 3M0ZA 3WQWA 1SMDA 3L4WA 4PB3A 5AKQA 4CLMA 4PTNA 2ZFAA 1SMAA 1UPPA 3VNKA 2Z29A 1PIFA 3HURA 1DXEA 1LORA 1E72M 1UMYA 1VENA 1L8NA 2W0UA 3TA6A 3HBLA 1QK2A 3KTSA 3APYA 1MNSA 3N2BA 1G9HA 5LSMA 1B3VA 4FP1A 4HIBA 3SY1A 3DFQA 2OTDA 3GFXA 3HPXA 1EJWC 4MAZA 4JTUA 3UPMA 2BBFA 1QI3A 2ZRWA 4H8VA 6REQB 3W1RA 5FJOA 2V69A 4FX6M 1XYMA 1GKRA 4U33A 3WLSA 6A3HA 5T8GA 5JVLA 2FMOA 4RDZA 1GCYA 3FHAA 3QGVA 1EGVA 3RNDA 4QBXA 4LC8A 3HJEA 4ZTYA 1TV7A 2Y70A 3KVLA 1VHCA 5J5RA 1DIKA 3UF9A 3MCOA 4C6DA 2PP3A 2J7GA 2RFGA 2OR2A 3WMBA 4AD1A 1CYGA 5M5DA 3V18A 2PDQA 5LHEA 3NOEA 3KLLA 3RAOA 3I10A 1TTJA 3EDKA 2IS7A 3FGCB 4HBKA 1IR2A 3HN3A 1HTIA 3H7VA 1KFBA 1UIOA 2YGYA 3A4JA 2CLFA 2NT0A 2ZIDA 4NYYA 3VFCA 3DN5A 2NVAA 3UWUA 4GK8A 1RBAA 2ISFA 2OEJA 1Y5WA 1YBQA 3Q94A 4LUSB 5A8GA 3B8UA 5DLCA 1JCXA 5E6YA 4JX4A 2PF8A 3RMEA 1UWSA 6ALDA 1WYIA 4LY8A 2FKPA 2AL1A 4IX2A 4P7QA 4DO7A 2WSPA 1ONEA 2VEIA 4J9JA 4PCTA 3LHVA 1FWIC 3MUAA 3P5YA 5IOBA 3DHUA 2YZ5A 4L5ZA 4X9YA 2YB1A 1XIIA 2OOGA 4RCXA 3SCWA 1VS1A 4XO7A 4AZBA 3UZJA 1FUYA 4PMYA 4IZGA 5FF4A 3KZSA 1VBGA 4JTIA 2NW0A 3LQLA 1W32A 3EPNA 5A5WA 2PLMA 3BAWA 1WXZA 5CPNA 4RUBA 2GFTA 4EACA 4NXSA 5D8ZA 3GG1A 3NSMA 2MANA 2ZDSA 3G1YA 3GO2A 1MRAA 1PX4A 4TX9A 1CI1A 3EOOA 4IG2A 1ISWA 1OJXA 4DM1A 3SJNA 3VFLA 1BWLA 3RPDA 1Z8AA 1V6YA 1LL4A 4LS0A 1VFOA 4N4QA 1WDDA 1HP4A 3KHDA 2Y5EA 4UQAA 2HZGA 4IQDA 1V0LA 4UIOA 5AYYA 4HZ7A 4AYSA 2J88A 1IWAA 4AIUA 4BCEA 4GYPC 4GY7A 3EGJA 1DE6A 4QCEA 2ZQ0A 2WSQA 5I79A 1RLDA 1LBLA 5CJMA 4OT7A 4DEFA 4H9XA 3SQSA 5HQMA 4C7FA 4MB5A 1HL8A 2Z1WA 1YNPA 1YXDA 3VDCA 4RK8A 1REQB 3OBAA 5FOOA 3PBUA 1JZ7A 3TOPA 4RZ4A 5T26A 3AYVA 1QPNA 2QCLA 5D9PA 3MZNA 4O8RA 1KGWA 3P80A 5CC3A 1RP9A 3PPGA 3TA9A 3T8QA 3SM0A 3EA2A 3KRZA 3VABA 1O68A 5TBOA 4UR7A 1CGWA 4LAOA 1TPEA 4PH6A 4J3ZA 2VD9A 1O60A 3QV9A 4WX2A 2VZSA 2DORA 1J79A 1W1A1 4O8AA 1VC4A 3L2LA 4B3LA 1XIDA 1AJZA 4ZQCA 1UD6A 3KOYA 3N2CA 4AWTA 5I6SA 4GIAA 5FJPA 3FA5A 4LBRA 2FPTA 4LCQA 4DPPA 4H41A 2BHUA 2DZPA 1G4TA 4JNMA 4LPCA 3FJLA 3NO3A 4UB9A 2C18A 3ARVA 4XUGA 1S3HA 4O1CA 1X6NA 1U1JA 3IUHA 2AL2B 3T4WA 3B8WA 3GYEA 1X6LA 3KAOA 3UESA 2PGFA 1SFJA 4LNYA 4MY9A 1VEOA 5D03A 1ZP3A 3MC5A 1HJVA 4V33A 3CL8A 3GU1A 4FF5A 3M41A 5EPDA 4M56A 2DZBA 1NWTA 4A2SA 1WQ5A 3BURA 4JFWA 4FR1A 5CBBA 3W2UA 2QUVA 9XIAA 1RCXB 4HSNA 5REQA 4PUMA 1TMQA 1PZ3A 3LRLA 1BD0A 5HQEA 2GVGA 4KQNA 4LF1A 3VTRA 4BF9A 1KXQA 3PZUA 3IIPA 1RQHA 4D9PA 1A0CA 3WDPP 1BF2A 1AW2A 3F4CA 3UXKA 3QHNA 3PTQA 1VYPX 3GTHA 1CT5A 4S39A 1F05A 2F2HA 2Z7GA 4FOJA 1H62A 2XTKA 1UQYA 6REQA 2XM2A 4PR4A 1E1FA 4WKAA 2G95A 2NX9A 4M19A 1U1HA 4GUJA 1TFVA 5E93A 3M6YA 2Z27A 4UTWA 4IPPA 5D09A 3UPBA 2Z4GA 4JICA 3TFCA 4OU1A 4GC3A 3TYUA 2RDTA 1KWKA 4UOZA 1PTAA 4OHQA 4I6KA 5AYBA 3W87A 3F4DA 4CNPA 2TRSA 3VC6A 2TODA 3BV4A 2WBGA 2CKRA 1KW1A 5FEWA 3GR4A 4XSLA 1HNYA 1ITQA 1QR7A 4LNCA 1V5XA 2FZNA 4UMCA 3EWBX 2CZDA 1WUFA 2F84A 2GVYA 4MWAC 2PC4A 2WHJA 4YVVA 5F4XA 4B90A 1EX5A 1ME7A 2CLOA 1DQUA 4GUHA 1QCWA 4GUGA 3FV9A 1EFZA 4AC1X 2YCLB 7ENLA 1P1XA 2XVNA 4HOZA 4NYUA 4MNJA 1BGAA 5CSSA 1F61A 2PDJA 2PWGA 3IGXA 4RNJA 4D6DA 1ZSXA 4DBEA 1TJ2A 2E6YA 6XIAA 3ITYA 3R8RA 3E0VA 3NQDA 5FAJA 4TV5A 5K4XA 4X9SA 4L4PA 5IRPA 1DWFM 3UP8A 3VXGA 1KGUA 1KTCA 1B3ZA 2G4FA 1J6PA 3TWAA 3VYLA 4MYAA 4C6EA 3C0SA 5EFDA 3WMCA 4RPQA 3ZR6A 3A12A 4HB7A 1X98A 3KTCA 2RGLA 2FDSA 3U2CA 3OB8A 3ARZA 3LCWA 1M6JA 4OUEA 3C0LA 3NGJA 1E51A 4AZ6A 5FJUA 4BR1A 3ANUA 5CLWA 1SU5A 3EX2A 3D5HA 4LEFA 1TRDA 4HPGA 1GG0A 1OWQA 3DU0A 3ARWA 2FZMA 1K1DA 4ZO7A 3R8GA 1YPXA 3B8DA 4PCFA 1V3MA 4NJIA 3QJAA 1YYAA 4QX4A 3VVGA 3NSXA 1IXQA 4PBEA 2WHKA 2B4GA 2PP1A 5U7SA 5KETA 4KWWA 5HPOA 1ZS2A 1MNZA 2X7VA 3ZJ8A 5H91A 1H09A 1NQ6A 2P8BA 4HOXA 1E70M 2A3EA 1QW7A 4F8XA 1US2A 3E0LA 3KBWA 4YPJA 1I8JA 1L0PA 4XD6A 4CQAA 5DMLA 3H22A 4TMCA 3ARUA 3E2VA 1JULA 4PB5A 3I7RA 1ESWA 3QSTA 3BCDA 3WL0A 3F4WA 4RW3A 2YXXA 3B05A 1GNXA 1KXTA 5CQ1A 1CX9A 3PZGA 4D6CA 1G6CA 1AQFA 3TSMA 5ABHA 3CYVA 3O9NA 1IWBA 1D7KA 4EXBA 1HXJA 4WHBA 4DZAA 2DGAA 1YDOA 1SW7A 2UBPC 3SQMA 8TIMA 1XYBA 3ARSA 4GQBA 3QMSA 3LK6A 4ATWA 1IIGA 1HP5A 1JJKA 3BLKA 4RJEA 1MQQA 3VIIA 1TPC1 2WKJA 3DYOA 3IIVA 2ZXBA 4Q22A 2FHBA 1DJNA 3G0UA 1SM9A 3MANA 2IXVA 1ME9A 1QATA 2Q01A 1HKIA 3V7PA 4A8IA 1OFQA 4F0MA 3A47A 1J96A 1K6AA 2XM1A 1AK5A 1GWJA 3W7MA 4OOZA 2P53A 3DI0A 1RVGA 1OC5A 4LRSA 4O16A 2YCKX 3V3WA 2E68A 4AIBA 4S2CA 4E4FA 3CT2A 1ZGDA 3MUY1 3HPSA 4HGXA 4XZIA 4PMVA 2O55A 3M5YA 4IFRA 2PD9A 3M0VA 5K2ZA 2VWTA 1IQ8A 4JCLA 4BQ4A 2HWGA 3QOMA 3L4VA 1QT1A 2P76A 3DXIA 4BK9A 1U83A 2J7DA 5B80A 3BDKA 1W9UA 1DKWA 1ZCOA 2CZVA 1XISA 2EJ1A 4MFDA 3NL6A 2YL9A 3IVTA 1DIDA 2Y7FA 3AYRA 1MYRA 4Y8EA 4F2TA 4HA4A 2VX7A 1XJBA 4KWUA 3WCZA 2I57A 4S38A 3LHUA 2ZA2A 5AYZA 3ZOAA 5BOEA 2ZX7A 3MHUA 3LTSA 1OVDA 4CQDA 3SUSA 3U7BA 3E0WA 3MQTA 3STCA 4ECLA 3VOHA 1J4EA 1UJPA 2IPFA 4MKNA 3B0PA 2QPSA 2E6AA 3VZYA 4QG8A 1FOBA 4WSKA 2VUNA 4Q3MA 5BU9A 1US3A 4AVFA 2PD5A 2EKCA 4XZLX 1A3HA 4IMEA 2VO5A 3T7VA 2X2YA 1H51A 3UGVA 3ECQA 1EL3A 4MWAA 3V36A 3THDA 1TJ0A 2CHRA 3WBAA 2ZE3A 3W83A 4WEVX 2YDQA 4W7UA 3VD7A 3SW6A 4CVUA 1Q8AA 1DWIM 2E9LA 2XGZA 3MKKA 4H3DA 4OZOA 1KM4A 2A0NA 5HDRA 4IPIA 3STGA 1UCWA 3MDWA 2EPNA 5TD4A 1XIHA 2ZX6A 2H8XA 3AZRA 3W37A 1UUQA 4FIRA 1JDFA 3VOFA 2P88A 4JZ5A 5I77A 5DBUA 3AMDA 3M16A 1Z6KA 3UG5A 4KRZA 1QBAA 2PDFA 1EZ2A 3DFYA 4INFA 1ZB5A 3PWIA 3EEGA 2WNZA 2X09A 1E3XA 3MYPA 5A8MA 3GTXA 3HM7A 3RU6A 3VD9A 3WUBA 4UCFA 4LBUA 4QG9A 1V02A 2O9RA 2DVUA 2DY3A 2CBVA 3FFSA 3GHSA 1EJ7L 4E0CA 2XIQA 3MSGA 2J7EA 3VC5A 1JFHA 1UC5A 1UOKA 4QEHA 3A64A 3SEPA 2Y61A 4O15A 4F79A 2YCJA 4JEJA 4QEEA 2BP1A 1XYCA 3LGEA 3VILA 4LV4A 4RE2A 2OELA 4AX7A 3H2CA 3IGSA 3BCFA 2VZVA 3S1VA 1VJZA 4U31A 4CNOA 3VCCA 1UWTA 1DPMA 1Q6DA 1XLMA 1S2WA 4JX5A 2YW4A 3CQHA 5FL1A 2VEMA 5EL1A 1Y8BA 4PSRA 2GGGA 4UCGA 4JX6A 2G5WA 4FHAA 3KP0A 1M01A 2RKXA 5A3HA 3DYMA 4H9UA 1A3XA 4O1FA 2CZEA 2C14A 1J2WA 2PEVA 3C8FA 4PCPA 3WLIA 1BXNA 2LLEA 2ZUMA 2MNRA 3EWZA 3NDZA 3SGZA 1X1NA 1TR9A 4UR9A 2FVKA 3WH5A 2ACSA 1K6WA 1UD3A 3GNRA 1R0MA 2HSAA 2R24A 4IJRA 4I6VA 4XX6A 5C71A 3WJXA 1D9EA 1WV2A 3TROA 3W7PA 2BDQA 4XKMA 1QU4A 2A3BA 3MP4A 1JXKA 1SQ7A 4OV9A 3MTWA 2Z24A 4Q8QA 5EFFA 1XHGA 3V1HA 4D1IA 4B4FA 3GQYA 4O1DA 3WLNA 1OX6A 2A7NA 2XH4A 2I14A 5E0CA 1W1YA 3MZ2A 5CAKA 4G5DA 1BWKA 2VRKA 3IRDA 4IH3A 4EWJA 3SGGA 2CW6A 4N6FA 4HHMA 4UNLA 2HPMA 1UKTA 5K3VA 4K38A 3U8GA 5CH9A 4IIBA 4ZOEA 2ISVA 3VGHA 1NOUA 2Y89A 3WEOA 3S2LA 4MB1A 3JZUA 2VMFA 1ONWA 3LS9A 3TNOA 3GXPA 1V6TA 1R3TA 3ME3A 3HO8A 3EKGA 5CPLA 1BXBA 2EPKX 3MWAA 3I4KA 3NQ2A 1TJ1A 2X1TA 4FR6A 3K8LA 1QHPA 4XZNX 2CXEA 3EMZA 4X22A 4JS3A 4CD5A 3VDHA 4XAYA 5HMFA 5D8WA 4GFIA 3ZWTA 4GIEA 3GB6A 2EG6A 4S3BA 3CLMA 4X3ZA 1XKYA 4CU6A 3WUEA 4EANA 3PFMA 4HPHA 4ZBCA 2JGQA 2V82A 1IV8A 2YYUA 3FN9A 2B7OA 1IXOA 5D4YA 2WZIA 4E8DA 3IJLA 2D69A 2OX1A 2Y8UA 3PF3A 3UT0A 1HJSA 3SN1A 1E0TA 4IFOA 2V5DA 5DRIA 2CHNA 1ZAJA 4PUKA 2REQB 4W84A 2VCBA 4KFNA 3QV7A 2B81A 4ML4A 1H60A 1GVIA 5A6BD 1H7WA 4NG3A 3DGRA 5BCAA 2ZX5A 2PLJA 4FNTA 4X2RA 4IGSA 2GJPA 4UTKA 8XIAA 1XRSA 2VRQA 4GFSA 2A6LA 1R2SA 2H9AA 2OT0A 5K9XA 1UJQA 4ADSA 2YYTA 2ABBA 4DO4A 3BUVA 1XW8A 2BGNE 5C55A 4AD5A 4MFEA 2DZWA 2GJLA 4GVHA 1PO9A 2DQXA 3B97A 4LAKA 3UZ5A 4H6EA 1DTNA 5AC7A 4BY3A 3LU2A 2VVNA 2W66A 1TZ9A 2CLIA 2QYGA 1VKFA 3NQ7A 2HE5A 2PRMA 5GJPA 1M5WA 1WDSA 3E0IA 4LBSA 1JPHA 2J79A 4HYRA 4IISA 3ZT6A 4YN5A 4WXYA 2ODOA 3JZEA 1J18A 5GJNA 3I6TA 1GHRA 3HPFA 4DELA 2XISA 4YU1A 4PBFA 1IXPA 4QDWA 1M68A 3M9YA 4ZA0A 4QE4A 1VIWA 1Q6QA 3D46A 1XRTA 3Q37A 1PPIA 3WD0A 1JCTA 3CLWA 4CEUC 4ZVJA 4IWWA 3EDDA 5LHFA 2GGJA 1VFLA 1W3HA 3FHQA 4MOZA 5D9OA 1TQXA 2WCGA 3TXVA 3CO4A 1UKSA 3A4XA 1OQFA 2WZMA 1W9PA 4EAMA 2QMJA 3NQMA 1XLLA 3AUJA 1T8XA 4DNMA 3BLEA 2AOSA 3UW6A 3JRKA 2DSZA 1TQJA 2PDCA 3GC5A 1UD4A 2G8ZA 1HG3A 3SN4A 1NARA 4P7OA 4WVXA 1XDLA 3W7KA 3BGAA 2E67A 3WK0A 4E8GA 2ACQA 3T09A 5FIPA 2WB5A 4IFKB 4CU8A 1Z48A 1YQ2A 1YADA 3LHTA 3G22A 3LXAA 1MDLA 3DHPA 1WX0A 1M65A 2VX5A 2Q8ZA 3VGEA 3WLPA 3O15A 4L6HA 1NWUA 5CXPA 2E25A 2YDSA 2G0WA 4OBSA 3N9SA 1PTDA 4BQ3A 3GHTA 1LUCA 3TSDA 2HVOA 3FJNA 2PGWA 1KTNA 1T7LA 2V5KA 1FWTA 4I7WA 3SO7A 2ZZ7A 4Q6XA 4JTHA 3BG3A 5C7HA 1Q4WA 3LY0A 3HG2A 1T41A 1CGTA 1JVNA 3UVIA 1FKXA 1Z89A 4US5D 4K8EA 1GZ1A 4HU4A 4PL1A 1E6XM 3QMTA 2B7NA 3B04A 4ML9A 4K68A 3L5AA 4HNOA 4HSHA 4TU1A 5HNNA 3VO0A 2A3AA 3R6IA 2BZNA 2X30A 3RM9A 4IXXA 4YTTA 2X42A 1KCKA 4W88A 3UWZA 1E71M 2WCSA 4GJ1A 4FLSA 3ABSA 1AVAA 4XVDA 3OGSA 4U3AA 3WLJA 3P0WA 4LGXA 3EMCA 4RLIA 1BYBA 3XIMA 3W7LA 1QDSA 1TV2A 2QQ6A 4J3XA 1YX1A 2YKKA 1V7YA 4ZO8A 2VTFA 5A6AA 3DG3A 1NFPA 3LYEA 1JZ2A 1UKOA 4C1KA 1YEYA 2QF8A 3MUCA 1BSLA 1KM6A 1XLKA 3THUA 1OFPA 1QW9A 1TV8A 2ZA1A 2CBUA 1ALDA 1R85A 5DMMA 3AYTA 3GH5A 3C2OA 1FP8A 3ABXA 3WL1A 2WM1A 1M53A 3EAUA 3XINA 3E38A 1WXYA 2V5LA 1IHIA 3S1WA 4DLMA 3UA3A 3DH7A 4D8LA 5KINA 4LCSA 2X7WA 3NL5A 5DQPA 1ENUA 3TTQA 4PMNA 3CPUA 4IMDA 3NURA 1OZMA 1R7OA 3RF9A 3KWSA 1IT7A 2DSUA 4GI9A 1UH4A 1F8MA 4HMEA 1NM9A 2J8FA 2NX1A 4PZVA 3JW7A 3PBMA 1E43A 3NEHA 2RDWA 1F6YA 3TN5A 4ERIA 3A22A 2CPUA 5A2BA 4LS2A 4DBSA 5KTLA 3ID7A 4XG1A 2KAUC 3NQEA 1PKLA 3I6RA 1C93A 4LEQA 1MI3A 3UNTA 3AZSA 1F4HA 4NVTA 4NNBA 4O14A 1W1VA 2I5IA 2WVUA 3KOWA 2QULA 3PUGA 1AA1B 1E5JA 3FXYA 4PULA 1VBJA 3TAKA 3LDVA 3QHMA 3UY8A 5CCZA 2CESA 2FFCA 3OQEA 1EXPA 4YYFA 4PTMA 3M1ZA 3QOKA 2WQPA 4B5SA 1XLGA 4GCXA 3FCPA 4W8LA 3VI2A 1KRCC 2OYLA 4M5PA 2A1YA 2QGYA 1B3OA 3A6OA 4TO8A 2FQIA 1EDGA 4PA8A 1KM5A 3F2DA 4GJJA 2I9UA 5JUVA 3VZXA 2A79A 1P6CA 2WVSA 4GYPA 4LSBA 5A8QA 5A6SA 1UD8A 2HBVA 1TWWA 1I2RA 3UA4A 4IPNB 3P5ZA 4AH7A 3O8AA 3DDMA 1QAPA 3MI2A 1KGXA 4D8AA 4H6RA 3B0YA 3PZ9A 4KBXA 4ATDA 4MUPA 1HL2A 3L0GA 3SRHA 1DWHM 5H2ZA 3WO8A 4GVFA 1VYRA 1K9TA 1JD7A 2HQAA 3PHAA 3TH6A 4IIDA 2BY1A 1QFEA 2VGFA 4ILSA 4LAZA 2DT1A 1FY6A 3U48A 1M7XA 4F0KA 3CUZA 4MNLA 4U2ZA 4GBUA 2BNJA 1PKMA 3LMZA 3N2MA 2VGBA 2QUMA 5CPOA 1QNPA 5C6MA 1E1EA 3V0SA 3HMCA 3LV5A 1LOLA 2VEFA 5K4ZA 4JTJA 3F1QA 2V67A 5E09A 3WBYA 3W7NA 3OP2A 4HMCA 4XZHA 2VGGA 4YWIA 3SURA 4NX0A 3TJIA 1QPKA 5ECVA 1OK4A 1A0EA 4NL1A 4X0NA 5FAGA 2WJZA 4QAWA 4Z2IA 3W7EA 3SGUA 1A5BA 2UY2A 5CC5A 3AXXA 1QOPA 4A3RA 3MP3A 2NVDA 3KRSA 1B57A 1KLZA 4M6UA 4O0QA 4FZIA 1YTEA 4C5ZA 2AQVA 2ZZ6A 2J27A 5DCDA 3AXHA 3XISA 3KHJA 2QLYA 3L4YA 3BAXA 3E12A 2JK2A 1HKJA 5FSEC 1XLIA 2XINA 1JYVA 4O0KA 5HJXA 5C8BB 5BU6A 4MGGA 2DZUA 3M64A 1Q6RA 3EPMA 1XR2A 3CL7A 4O1BA 3AMLA 3GNOA 3GIPA 2G96A 4EOUA 1F07A 1UA3A 3LV6A 3GW0A 3UWQA 3B9EA 2DPEA 2WZTA 1T99A 3T9PA 1OSEA 5AZ0A 2GWGA 1H1ZA 1NU5A 3OZMA 1H49A 3C2EA 3OG3A 1E4LA 2PDIA 1GVOA 3CBWA 3GWQA 3ZR5A 4BFAA 2WM0A 5BZAA 3N34A 2PGEA 5A8OA 1AJ2A 2QXWA 4JFSA 5AHIA 1SR9A 2I5QA 4HNNA 4H1ZA 1GQLA 4W9TA 5JMUA 4JBRA 3SI9A 3USZA 3H4WA 1EOKA 4Z1DA 6CGTA 3QHOA 4YWSA 2DP3A 1M04A 2PWUA 3AC0A 3PTDA 2D0GA 4LF2A 2DT2A 3TR9A 2OGJA 4MKVA 2BGSA 3TONA 5U4NA 3E2SA 5AC5A 1ECQA 3VIGA 1EHNA 4QJ4B 1Q2SA 5F2LA 1XSKA 4FLOA 1O66A 4HK5A 2F8QA 4O12A 4B2DD 4H6QA 3C2RA 1X1ZA 3PUOA 1WDPA 2YW3A 1ISYA 4HD5A 3W28A 4DJEC 5CC7A 3TE9A 2BOEX 4KT2A 4AC7C 2V68A 1NFBA 4PB4A 3E5PA 5IDIA 4GX8A 1KFKA 4MVAA 3KCJA 1R9YA 1F9CA 3BQ6A 2F6UA 4D6IA 3KTXA 1HKMA 1R3QA 1JPDX 3TYDA 2E8YA 1QNSA 3UNDA 4FMVA 1HKVA 3QGKC 5FF0A 3CL6A 4H9VA 2HBXA 4DB7A 4MHBA 1AL8A 3NPUA 2QDGA 2OYKA 1YDYA 3W0KA 1ZJIA 3W23A 3H7UA 3QTPA 3NZQA 1LCOA 3ZJ6A 3G8EA 3T08A 3CZLA 4OUIA 5DMNA 2WC4A 4EK7A 2YFOA 1TYGA 3B8SA 3LCXA 3GXMA 2GVLA 3RCNA 3VGFA 5IHRA 3EXTA 2Z00A 4YIWA 2QNEA 3PZOA 4Z0JA 2E7FA 1P43A 1DL3A 5T9BG 2J25A 4AD2A 2BODX 3FA4A 2OB3A 1HGYA 3UZYA 4AD4A 3NL3A 4IL2A 4C7GA 1OG0A 1SSDA 3ITGA 3RGTA 1TR1A 4UFIA 1JEZA 4HU0A 1C29A 3OA3A 4UTWC 1KR0A 1QASA 3W1LA 2ZRUA 3KRUA 3N3MA 4Y96A 4AW7A 2DUZA 4RE3A 3WNLA 4H00A 3BLOA 7TIMA 1MFUA 3OLEA 1KFLA 1B2YA