4GC3A

Crystal structure of l-histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn and sulfate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
263
Chain Sequence
SLKKLDYHFHSHFSADSEELPRKHVTEAIAHGLEEICFTEHRDFYFPGMDFSLNLPEYFQEINQLQAEFKDKIKIKIGLEMGIDLRFKSEINQFIDSAPFDFVIASVHEIGDIEVYDGTEFYLQKTKEEAQREYLLACLDVVQNFENYNSFGHLDYVARYGPYTDKSIKFAENREILFEILRALASKEKALEINTRLFDDPKTEQFYSDLLINFKRLGGKFITLGTDSHIAKRDWLSIHKARTLIKKAGFHELATFSGMKIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HISTIDINOL PHOSPHATE PHOSPHATASE
publication title Structural and Mechanistic Characterization of l-Histidinol Phosphate Phosphatase from the Polymerase and Histidinol Phosphatase Family of Proteins.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
total genus 108
structure length 263
sequence length 263
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02811 PHP PHP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gc3A00
2R1NA 3GG7A 4PBFA 4J35A 1YBQB 4IH3A 2A3LA 1FWJC 4QTGA 3BE7A 4ICMA 4YIWA 3GTXA 4C6EA 2XIOA 4C6MA 2OB3A 4C6LA 3NURA 3AU6A 1FWEC 1R9YA 3K5XA 1EJRC 2OQLA 3FDKA 2Z2BA 4UB9A 4LALA 2GSEA 1QXLA 2E25A 2R1LA 3QGAC 1A5MC 4C6KA 4C6CA 3GTIA 3GIPA 4H9VA 2O4QA 3MSRA 2D2HA 1UIPA 3OU8A 3LY0A 4C6QA 4HA0A 3UPMA 2Z4GA 1K6WA 2UZ9A 1RA0A 2OGJA 3RYSA 4F0RA 2Y1HA 1J6OA 3G77A 3F2DA 4KQNA 3PAOA 4ERAA 3SFWA 3UF9A 2WM1A 3TN3A 2Z29A 4CNTA 2FFIA 3EWDA 4EP8C 4L6DA 2D2JA 4IFRA 4D8LA 4OFCA 3FDGA 4CEUC 3KM8A 4XAYA 3GIQA 3T81A 4JOMA 4BJHA 1RJQA 4EPDC 1IE7C 2PGFA 4H9TA 4DNMA 4CQDA 1GKRA 3QY8A 4NI8A 5HMDA 3WYZA 1E9ZB 4TQTA 2WJFA 2ANUA 4KEUA 3GRIA 4LEFA 1EJVC 1UIOA 2G3FA 3WMLA 4RZBA 4CQBA 4F0LA 4LFYA 3GU9A 3URBA 1EF2A 2DVXA 4G7EA 1O5RA 1XRFA 3CAKA 3OODA 3OJGA 1KRCC 4H00A 4KERA 2HBVA 4C5YA 1A5KC 1ZZMA 4LCQA 3K2GA 4GYFA 1EJTC 3E74A 1FWFC 4GZ7A 2PAJA 4DIAA 4B91A 2R1KA 4RE0A 4IFKA 4DZIA 2FTYA 2AQOA 1EJWC 1KRMA 3N2CA 4GC3A 3MTWA 3TN6A 4C6BA 4CNUA 1FWBC 4GK8A 4V1YA 4C6IA 4WHBA 2I5GA 1EYWA 3LS9A 2OOFA 3PNUA 1HZYA 1XRTA 1UBPC 3GU1A 2QT3A 2GWGA 2VHLA 4HK7A 3TN5A 2HNHA 4LAMA 3MJMA 4INFA 3WZ0E 2VC5A 3S2JA 4QSFA 1O12A 3OOQA 3RCMA 4XAFA 1ONXA 3B0YA 5CH9A 2YZ5A 2VC7A 4IG2A 4DLFA 1A5NC 4H9MA 5LXXA 1A5LC 2HPIA 1RK5A 1V51A 2BB0A 4H9UA 4NG3A 4GBDA 4H01A 3UR5A 4BY3A 3LSCA 4XAZA 4C6DA 3DC8A 3EWCA 4XD5A 4C5ZA 1NDZA 1WXZA 4G7EB 4GX8A 4V1XA 2PLMA 2GZXA 1EJXC 2UBPC 1GKQA 1RAKA 1JGMA 1V79A 1POKA 3K4WA 4LAKA 3T1GA 3NEHA 3URNA 4NP7A 4DI8A 1DPMA 3B40A 3E38A 4J2MA 1BF6A 2O4MA 1R9XA 4QS5A 2R1PA 3O0FA 1RJPA 3IARA 4LH8A 3QGKC 3F4DA 1FWAC 5E5CA 2WJEA 4H9XA 2HQAA 2FVMA 2YB1A 3OVGA 2BGNE 4KEVA 3MDUA 2Z7GA 4IQJA 3UBPC 4EPKA 4H9ZA 4ZSTA 4UBPC 4BKNA 2GWNA 5FSDC 4IF2A 3A3XA 1XGEA 1FWDC 3ITCA 1FKXA 4DLMA 3PBMA 1ITUA 1A5OC 3F2BA 4HK5A 1PO9A 1YBQA 4HJWA 1K70A 1E9YB 2YXOA 1EZ2A 3LU2A 4C65A 4LCSA 3O7UA 2E1WA 4GOAA 3IV8A 4F0SA 2P50A 2EG8A 4IGMA 3GUWA 2FVKA 3MKVA 2KAUC 1J5SA 2FTWA 1ONWA 5HMEA 2VR2A 4C6PA 4XD6A 4RDZA 3F4CA 4PCPA 3NQBA 4CNSA 2EG7A 4XAGA 4PE8A 2I9UA 3LA4A 4EPEC 3A3WA 2YB4A 3R0DA 3E0LA 3DUGA 1KRBC 3AUOA 1P6CA 3PANA 3F2CA 2QVNA 4DZHA 1NDWA 4LCRA 1NDYA 2W9MA 3GTHA 3LGDA 1A4LA 1UMLA 4RDVA 4C60A 1V7AA 1QW7A 3CJPA 4PBEA 3ICJA 3E3HA 3S2LA 3SO7A 2HPMA 5FSEC 3URAA 5AKQA 4Z42C 1PSCA 4RDWA 4XD3A 3EGJA 4QRNA 3LGGA 4I6KA 3TN4A 3GTFA 4WVXA 3HTWA 4GY7A 1VFLA 4C6FA 3IJ6A 1GKPA 4KIRA 3S4TA 3IACA 1NDVA 3QY6A 1RJRA 4HK6A 4GXWA 4LAOA 1P1MA 1PTAA 1V4YA 2DVUA 4DO7A 3GU2A 3OQEA 3V7PA 3HPAA 4R85A 2F6KA 2PGRA 2Z26A 3URQA 1RA5A 1YMYA 2HBXA 2Z25A 1V77A 4E3TA 2AQVA 4ERGA 2VM8A 4IFKB 2ICSA 4ERIA 5A6TC 3LNPA 1FWCC 1XWYA 2VUNA 2WJDA 4GY1A 1YRRA 3A4JA 2Q01A 3LSBA 4EPBC 1KRAC 3E2VA 2RAGA 4P5UA 2P53A 2QPXA 4QS6A 1M65A 4GX9A 4MUPA 2AMXA 5HMFA 1FWGC 1ADDA 3IPWA 2DVTA 4C6OA 2PUZA 3RN6A 4AC7C 2ZC1A 2R1MA 3HM7A 3CS2A 3MVTA 1YIXA 4DI9A 1FWHC 2IMRA 2Z2AA 4KF1A 4R88A 2Q09A 4IG2B 3B0XA 3UR2A 3ORWA 5G4HC 4DYKA 1FWIC 2GOKA 1YNYA 4IFOA 4ZSUA 2QS8A 4B92A 2Z00A 4I6VA 3ISIX 1S3TC 2CZVA 1POJA 4AQLA 3D6NA 3QY7A 1NFGA 2OODA 4B3ZA 4J5NA 2Z27A 1EJSC 1R9ZA 1M7JA 1ITQA 2ADAA 3ID7A 4CQCA 1P6BA 3FEQA 1M68A 3RHGA 3IRSA 1RK6A 4RDYA 3C86A 4C6NA 3DCPA 4KEZA 3JZEA 4C6JA 1W1IE 1I0DA 1J6PA 3AU2A 2D2GA 1KCXA 4QROA 3T8LA 1K1DA 4G2DA 4M51A 3MPGA 4XD4A 2Z28A 4LANA 4WGXA 3E0FA 4PCNA 3PNZA 3S2NA 4H9YA 4KESA 2Z24A 3MVIA 4IGNA 1WXYA 4R7WA 4CEXC 4KETA 4L9XA 3IGHX 3S2MA 1EJUC 1I0BA 1PB0A 1A4MA 1J79A 1FKWA 4GY0A 2EG6A 4B90A 3MDWA 3TNBA
chains in the Genus database with same CATH superfamily
4MADA 3LBMA 1ZFJA 1FWJC 3AXHA 4Q6XA 4C6EA 1KR1A 1K8XA 1SFLA 1B3ZA 1JYNA 1DQWA 1VZWA 1QU4A 1NWUA 1J0JA 1CXFA 2G5WA 3WK1A 1RQBA 1W1VA 3TYEA 1XUUA 4Z1AA 4R3UA 2GUUA 5KITA 1P48A 4AWTA 4JKMA 3QC3A 5CBBA 3DBNA 3WQ4A 1R3VA 2YIHA 3WLHA 1BSLA 1V3IA 4ZENA 1M03A 2Y1HA 2AGTA 1YPIA 3NDZA 3W70A 4HNVA 3ANUA 4KS0A 3F2DA 3BGGA 1B4EA 2HE8A 3EKGA 4GH3A 4A2SA 4BQ3A 1ZJAA 1DTUA 3TV8A 3TN3A 2PBOA 3E1F1 3NZQA 1UYQA 4ZMGA 4PFHA 4D6DA 3T78A 1DP0A 4MNJA 1VFSA 3BAKA 5K9CA 3T0AA 1RCQA 3U5UA 2G96A 3W7KA 2YBUA 4GCAA 3BDKA 4QFUA 4JOMA 1KKOA 1VKFA 3EZ4A 1QVBA 1Q63A 1H7OA 5HMDA 1W9DM 5DO8A 1V08A 2CZEA 3KLLA 3M0XA 5I09A 2A79A 3MB9A 3NR0A 3FAXA 3R0UA 3B05A 4IJCA 4UFIA 3NTYA 5D37A 1D2KA 3GDTA 4E2OA 3U2EA 2NV9A 3VOGA 3GH5A 4UCGA 4HNNA 4KERA 1KFJA 2DSWA 2CW6A 1PIFA 3K2GA 1TZ9A 3TYBA 4C1NB 1VRDA 1Z48A 3O16A 1NAL1 4M6QA 4LYQA 2UY4A 3BAYA 4K7VA 1X1OA 4ZB5A 4RNHA 4G6CA 4HNTA 3WY1A 5D04C 1OG0A 1F6KA 3NQAA 4FLSA 3SURA 3VGBA 4LV4A 5CKSA 3PJUA 4L6OA 1ZQ5A 3ITLA 2ZXDA 1H49A 2VHLA 2XU2A 1GTEA 4NU7A 1DEDA 2IQDA 4GZEA 3OVPA 1F4AA 4AH7A 3GS6A 4PTXA 1HVQA 3AMKA 5CH9A 3V1PA 4RPPA 2G50A 4DBDA 1UW9A 2B7OA 1OF8A 4JQ4A 3WQEA 3LRKA 5HQLA 3V36A 7REQA 4B5UA 5CJMA 4AIOA 3KWSA 3B97A 4ROPA 5CBJA 2PDPA 5JQ9A 2ZC8A 5BXSA 3PSWA 5LIUX 1PYFA 3KHDA 3DHDA 4XG1A 1P0DA 3L2LA 3NVTA 1HJQA 1UASA 4ATLA 3SGGA 4CVWA 1KO0A 2WKLA 5KZDA 3VD3A 4A8NA 3AISA 4UTJA 1J93A 1V3HA 3R5EA 2OYLA 2D23A 1E4IA 4JIIX 5A6BD 3O0FA 1OVDA 2ZCGA 2HVMA 4NY2A 1C9WA 1SYTA 1R5YA 3ZXWA 4M29A 5E1QA 4KKXA 4J3XA 2HQAA 3ALFA 4Z2LA 2BBFA 2PU0A 1NWSA 3AMLA 4K1WA 4ZO7A 3EWXA 2Q8LA 3MUIA 1QI4A 3PBMA 1ITUA 3STPA 1JYVA 4CLMA 1KM0A 3VCNA 2YFNA 3N4AA 4AVOA 4PCTA 1EZ2A 3HO8A 3R11A 4UOZA 7REQB 4A3UA 3T55A 4F0SA 2J62A 4LC8A 4Q7IA 2FVKA 2WW5A 1XYMA 1Z42A 3QFEA 4LV9A 3F03K 1JZ3A 4I7UA 3ELFA 2IPFA 3AUOA 3TCSA 3HG4A 1OGSA 5CC3A 1D3CA 3WJWA 3ZVHA 2ZRXA 3GTHA 1UMLA 2V69A 1QOXA 4AZCB 1EYEA 4MM1A 2YCKX 4NZCA 4Q4KA 3S1UA 5GNYA 4K6AA 1LYXA 5G1MA 2OEJA 4DJEC 4MWAC 3GTFA 2ZZ7A 1FHDA 5CPNA 5BZAA 1W17A 1B3WA 4AHPA 5I02A 3IAQA 1D3HA 3T6CA 1Q2RA 2X2GA 1TMHA 4LEQA 1GYLA 4MG4A 3C4UA 2VNCA 3O07A 3GX9A 1QWGA 3DECA 1O6IA 1TB3A 3RR1A 2V81A 1TRDA 1X39A 1CNVA 2GFTA 4UIOA 1M6JA 2QJMA 2ZZ1A 4E3TA 2VM8A 4ERIA 3RPDA 5ECUA 2CZFA 3ZVHB 4NZ5A 1Z89A 3WQWA 1O95A 1MQPA 3E5PA 2J7EA 4GI6A 2P53A 3A47A 1M65A 3P82A 3C2RA 3UXIA 4UFHA 1FOBA 4JDBA 4RNJA 1EPXA 4P8XA 4B9ZA 3G3DA 4HOWA 1F6YA 2OEMA 1UHVA 2BXVA 3B8UA 4ORIA 2ZRYA 5DT7A 1X96A 1AQFA 3WLOA 1SPQA 3E96A 2GLKA 3R89A 3WQFA 4ZFCA 1EJSC 1UKSA 3RO8A 3GXNA 1KBIA 1LLZA 3ITYA 1QBBA 1WBHA 3N2TA 3QVQA 1QOQA 3G1YA 1QNVA 3OBEA 3IWPA 1J5TA 2CPUA 3HQNA 1GVRA 1JPKA 3H2EA 5FJPA 2W67A 4W88A 2F7FA 3NL5A 1LL7A 1XCFA 2VEKA 4CNPA 1EZWA 5GVJA 4LVGA 4LANA 4JCMA 3CMGA 1XYBA 4O8AA 1WXYA 3LHVA 3TC6A 2DIEA 3H54A 1UG6A 4HHPA 4HA4A 5BNKA 4PFMA 4AG0A 4W5ZA 3VDBA 4FA3A 3PTDA 1QJWA 5DT5A 4MB1A 4HKPA 1PTDA 1S5WA 4DAFA 2FB3A 1FTXA 4MYXA 3FYPA 2EQDA 3NURA 3W2UA 4RXFA 1K9FA 2OQLA 2A3EA 1YADA 5C9UA 1REQA 4DJEA 2YLAA 4UB9A 4MWAA 1T5AA 3O06A 4P8WA 2OSYA 1SSDA 3A12A 4M19A 3L4YA 1J2WA 3I6EA 4BWLC 1TJ1A 4TIMA 3DGBA 3SZ8A 4C6QA 1YPXA 4FO4A 1A47A 5D9PA 3B4YA 1PX8A 1KWGA 1W37A 4FEZA 4LX4A 3QKEA 1TA3B 3RM9A 3VX0A 1RZMA 1G1YA 4HCHA 5D8ZA 2DZVA 4UNKA 2PWGA 2VFIA 4ZO9A 4JCLA 4IPNB 4OOUA 3F7JA 1K77A 3WDJA 5HR6A 1WQ5A 4TX9A 4B3LA 4MJ2A 4UMBA 3GHSA 2FYMA 1M41A 4L56A 5T91A 2QUVA 5BXRA 3B0VC 5A8QA 3I7QA 3N6HA 4DO5A 1YE4A 3AWNA 5DEZA 1JYWA 4QLKA 3BJTA 2HROA 4WQ6A 3G0SA 1C8YA 1GEQA 2RKXA 3QV9A 3WMLA 4CQBA 2A6NA 5HNTA 1PX4A 2WOQA 3BQ6A 3B9DA 1XUZA 1BRLA 5AHEA 3OJGA 5HNNA 3PN8A 4LWWA 5M5DA 2BDQA 3KXQA 3UNTA 5BRPA 4UOJA 5F1UA 4Y6GA 1K7XA 2PMQA 5I23A 1I2RA 1KM2A 3T07A 4JNZA 1B9ZA 3L4UA 3H8AA 3CUFA 1EJWC 3TN6A 4J3VA 5FJTA 3GNOA 4GK8A 4NI3A 3PNUA 1W32A 5MKGA 4LSBA 4CU7A 4PB5A 1F3TA 2E40A 4RKAA 4H6KA 2ZKMX 2QJJA 3CXOA 3ZOAA 3GNXA 3QQ1A 4AF0B 2OVLA 3KRZA 5K9XA 3XISA 3V75A 4JQAA 1OK6A 4LUYA 2PDMA 3QTGA 3NA8A 4IOTA 1MNZA 1DWHM 1KTCA 4JAWA 3W7JA 1BRLB 5FD0A 5LIYX 2UBPC 3Q65A 1YNQA 2VC9A 3N2XA 1M04A 2QZRA 4M5PA 2FZBA 3SUSA 4CQ8A 1GQJA 1XLCA 3R7MA 3IVUA 1AQ0A 2BHUA 1TV8A 4BWLA 4H9XA 4GKTA 4U5IA 3CM4A 1ZS2A 2XM1A 2HZGA 1LWIA 2V2HA 2BMBA 3TW6A 3OEXA 4IQJA 1E6ZA 4QEEA 4E5TA 5FF7A 4HSNA 1HKMA 3GQYA 1Z6KA 3C56A 3ITVA 3QSTA 2HJPA 2J7HA 3V18A 4LAZA 2Y70A 4HGXA 5HANA 3BTNA 6TAAA 1YTKA 3P61A 1SO3A 2NLIA 5AYXA 5ENLA 3DBPA 4LCSA 1J18A 3W22A 4F66A 4QSHA 2NW0A 1S2AA 3ABXA 1BG9A 3ZFHA 3I3EA 4M6UA 3PULA 4CNSA 1W9XA 3E02A 4DBEA 4GUGA 4IMDA 1KRBC 3IJQA 1VCFA 3LI1A 4Q33A 4UTLA 1JCMP 2HCVA 3BARA 3PZNA 1UA3A 4LUJA 3PB0A 2AOSA 3VC5A 1W9PA 1T96A 4Q8PA 4GD0A 2HPMA 2VVSA 2PE4A 1VGAA 3WMBA 1PSCA 4DBSA 1R0MA 1S46A 2OWWA 4S23A 1VFHA 3VUPA 1Y0EA 5I6SA 4OTKA 3LCGA 3DFNA 4W5UA 2WSPA 3U9IA 3MJYA 4IQLA 2QCHA 5A8MA 5A6LA 1OADA 3ZLFA 1QHPA 4XZIA 5EBAA 3FV9A 3H24A 5BWFA 2DVUA 1F3WA 1K7EA 1UUMA 1XGDA 3GU2A 1H1NA 4GQBA 3W1MA 3A4XA 5A2CA 4HTBA 1KXTA 1V77A 3AROA 5F7UA 2X1TA 2DZBA 2RJHA 3B9OA 3PTKA 3GR8A 3SUVA 4CN1A 2VOMA 2XIIA 4S2BA 3R12A 4LF2A 1BYDA 1JDFA 1I4NA 1FWGC 2ZVRA 1CTNA 4EOUA 5DMLA 5LHFA 4EF9A 2BGQA 5T26A 1C8VA 3VNIA 4AZ6A 3BV4A 3MVTA 3V0TA 4D72A 4LUTA 4KEMA 5C2CA 3S46A 5CLWA 3EDJA 3CGTA 5FF2A 3SJNA 3RK8A 4IFOA 2QS8A 4US6A 2Z00A 4I6VA 5AECA 1FXQA 4DWSD 4US5D 1W1TA 3PJWA 2DGAA 2GK1A 1UP3A 3NEVA 3SCVA 4OU1A 3W7EA 2E68A 3AHZA 2WBKA 4MWAE 3THAA 2E5BA 4C1KA 3C0QA 1P6BA 1TYGA 3QJAA 3VKCA 1FHVA 7ENLA 1OB0A 2QCDB 1JIBA 2DY3A 2C0AA 4LVFA 1QPKA 1TELA 4WY0A 3T2OA 1K7FA 3IS4A 5FACA 2P0IA 3EEZA 2VQUA 3AIRA 1TPC1 1VBGA 3O6AA 3ZLGA 5AB3A 1GVYA 3BO9A 4ZB0A 3G0UA 4UUIA 4I9JA 2W79A 1JNDA 4KETA 4L9XA 1DIOA 1PB0A 1JUEA 5D33A 2R1NA 1E5JA 2QYGA 4W85A 3AAMA 1R8LA 3WLRA 3R4IA 1OCBA 3LDVA 4R7OA 4C6LA 4C7FA 1FCVA 3NZ1A 3GH4A 3GXFA 1UH3A 3HJZA 4W4QA 5F2LA 4PB3A 2GK1B 3LMYA 2VX6A 2V3EA 1LG1A 2IQTA 3C2EA 4AD5A 1UR2A 2PA6A 3P8JA 3VE9A 3GIYA 1E51A 1QK2A 2ZTJA 3AIEA 3P67A 5CSSA 4KWWA 1KW1A 3LRMA 2B81A 1QBAA 4GZIA 4PA8A 2F61A 2XVPA 3LCLA 4YL2A 1Z9AA 1V8EA 2PP1A 1DVJA 2V5BA 3IGSA 3G77A 3I65A 3PAOA 2PTDA 3PPHA 4CD5A 5IDIA 3TNOA 1BHGA 4ZODA 2Y6ZA 1E40A 3DEQA 2BHZA 2D2JA 4AW7A 2FHBA 3W6MA 4FR6A 2BNJA 4M7TA 3KP1A 2ANUA 4PUWA 1TCMA 5CG0A 1D8CA 1W1ZA 1DJNA 2WLYA 4I9TA 4G5DA 2BHYA 4ORMA 3H55A 4Q6JA 3M0LA 3C3UA 2GSHA 5BRQA 2XGBA 3EA1A 3KTXA 2E9BA 5IM51 2QJGA 2CLOA 3MV11 1GQKA 5DLCA 3CYJA 4L4MA 1CW2A 3OW1A 2QCNA 1ZJBA 1FHLA 1RQHA 4GMEA 3LCIA 1L2QA 2C7FA 3HFYA 3C8FA 2ZICA 1DWGM 1GG0A 1EPVA 3GU1A 2WCGA 3GNNA 3WJZA 3M0KA 2J7GA 4QISA 1R3TA 1TTIA 3H23A 3ARPA 3E9AA 4GG9A 1OK4A 3EPMA 4XAFA 3CV1A 1EH9A 3GB6A 4MB5A 1J0ZA 4BEQA 1KR0A 4PZVA 3G1FA 3WH8A 4Q7NA 2XIBA 3HBLA 1I1XA 3GXMA 3DC8A 5D2TA 5BXTA 1ZLPA 4Y9NA 5JVLA 2JGQA 3RM4A 4NRSA 6A3HA 4DB7A 5KMYA 4DXVA 4DUOA 4JIRA 1H09A 3IJ8A 1W3LA 1CWYA 3E5BA 4WJXA 3W2MA 1SSGA 1AW1A 3MANA 5EKYA 4DI8A 2G8ZA 9CGTA 2D69A 1BF6A 3GYEA 4LYKA 3BPWA 4OT7A 1S39A 3F4DA 3R8RA 5I7GA 1AA1B 1AZ2A 3OA5A 4AU0A 1ZRQA 2O9PA 2BGNE 2Z7GA 2VUYA 4POCA 4BEUA 1XBZA 5FCZA 2NX3A 3KBJA 1N55A 3COTA 1H7NA 3EWZA 3RLGA 1THFD 1GEHA 4GNVA 4MUZA 1AMYA 1LUCA 3P60A 4Z1YA 3POHA 3CV2A 2PGWA 1NQ6A 1VFOA 4QG9A 3QW3A 5FOOA 1XLDA 3D3AA 4NYYA 5I2UA 3MWAA 4JFUA 4PYSA 4IWWA 1EHNA 4B4HA 4UTUA 1J5SA 4LXFA 2FTWA 3VZZA 4E8DA 1XC6A 1KFLA 1ZNNA 3WQPA 3T4WA 2XZ9A 4XISA 2YB4A 1HL2A 1G4PA 2Q3RA 1H7PA 3F2CA 3VNJA 3UPBA 2C3ZA 1QPOA 4JTKA 1VLWA 2XGZA 2ZZ4A 4G7FA 1XLHA 4S3BA 3GY1A 1NOUA 4PBEA 1U1UA 2VEPA 2NUYA 4UCFA 4PMQA 1Z3NA 3SY8A 2B4GA 1JCLA 3T9PA 4UTKA 3E0VA 4DM2A 1MUWA 3EGJA 1TR1A 1B57A 4D8ZA 1OFAA 2GGGA 3F4NA 5CZSA 3SW6A 3PBVA 3RAOA 3I3BA 3W38A 1GVFA 4NX0A 2YPIA 5CGMA 8XIAA 3WH9A 1WUEA 1IWBA 4IQEA 2EO7A 2HK1A 1VBUA 2WVVA 2NT0A 3OVRA 1CXLA 4U3CA 2PFHA 5D9NA 4V28A 3PS7A 1W31A 5F4XA 5LIWX 1YRRA 5J04A 4PUMA 2V5LA 1MUMA 2VD8A 3EB4A 4LNCA 1PVNA 3IPWA 3UT0A 4C6OA 1AQHA 3W0KA 1E70M 2SFPA 2R9RA 4I5XA 4YMZA 3EDEA 2OO0A 5G2IA 3M0JA 4GYPC 4S3KA 1YXCA 4DYKA 3P2VA 1NWRA 4AD3A 2VTFA 4HZMA 3B9NA 2CZVA 3D6NA 4CUCA 2DQWA 3EXRA 2Z1XA 4DUXA 4D6HA 2OEKA 4AWSA 1XYCA 4Q32A 1GOXA 4EVZA 2J77A 2WHJA 5FA5A 1TQJA 3W7QA 3ITXA 3EOUA 3CHEA 4RDYA 3G3MA 3JZEA 5REQA 2PP3A 1F05A 2D2GA 1WCGA 2WBGA 3H53A 3DHUA 3N12A 4XUGA 5CSUA 2E7FA 1GW9A 1UWIA 3SY5A 1PKLA 5ABTA 2INZA 1U5HA 3NQEA 2QGHA 5D2WA 2G3JA 4Z2KA 1TJ0A 1V93A 3W74A 1OX4A 3N4FA 3R94A 1IEWA 3CK5A 3S1XA 3CTLA 1R2SA 2GJXA 1IXQA 4NZ3A 2A3CA 3HGJA 4IP5A 2QIIA 2XIOA 3IVTA 2IUZA 3L67A 3WLIA 4MY1A 5DX7A 3UY8A 3VOFA 2ZX5A 1X1NA 1XISA 1QO2A 1B54A 3A3HA 2E25A 4XVDA 4HMCA 4LBSA 3PFRA 3SM0A 1UJPA 2QIWA 3IIZA 1JCNA 1WDDA 3LRLA 2O9RA 2XIQA 1OYCA 3QSRA 5REQB 3VMOA 3A64A 4KWVA 1HKIA 2HXTA 3VIHA 3A21A 1DE5A 3HFTA 3KVJA 3LBCA 1UD6A 2GVEA 5B7YA 3N13A 1XYLA 4KQNA 1W5NA 4M81A 4ERAA 3UF9A 2WM1A 1CB7B 1EGZA 2AL2A 4M7SA 1ZPTA 2WHMA 5BYWA 2OLAA 4DUWA 1TUFA 4GNKB 4MHBA 4ECLA 4I3GA 3GAYA 5A6BA 4H9TA 4DNMA 1I6NA 2J88A 2YSWA 5E6YA 4LEFA 3LQLA 5L9FA 1RPXA 1YDOA 3CZGA 3T0DA 1Q6FA 4Z1DA 3CAKA 1ADSA 5M17A 4AZHA 3A5VA 1TX0A 4GYPA 5BU9A 2QCGA 2VCAA 4FX7A 4H7CA 2VX7A 1JULA 2PWEA 1L0PA 3LCXA 3LX9A 1A49A 4XV0A 3NQMA 3S83A 3WQ8A 1HP4A 1ZTVA 1H1YA 1EJTC 2GJLA 3SCUA 2RJGA 5F2IA 3LB0A 1DKWA 1ECQA 3K4AA 1EHAA 1OABA 4RZ5A 4U4MA 3THQA 3N2CA 2J7FA 3M6DA 1CYGA 2OQYA 5CZJA 4HCLA 5CSYA 4WOZA 3DG3A 1E0XA 3P8IA 2PDJA 2J9ZA 4DF1A 3DI0A 4HZ7A 1ODUA 4ZA0A 1C93A 3UETA 4Q8TA 2G37A 1XX1A 4QAIA 3FSTA 4WDTA 5KZ6A 4JL2A 1LLOA 2WNWA 2YZ5A 3N2OA 2WM0A 2NV2A 5C9RA 1OT2A 3EWCA 4LY8A 4GX8A 4AEEA 1BAGA 3UZYA 2QCCA 5FJJA 1HTIA 1V79A 2O92A 4J4KA 1W54A 3CHDA 4F4RA 2ABBA 4P61A 3CZKA 3ITOA 3TXVA 4F2UA 1MO0A 3P0WA 3N25A 1TWDA 3MO4A 4XTDA 1J96A 1XRVA 5DY2A 3WLQA 1VFMA 1OJXA 3M64A 2G97A 2QUTA 2YB1A 2E8YA 3NCOA 2OZ3A 1IGSA 1K9TA 3QZEA 1XIIA 4GVHA 2OU4A 4R34A 1IR2A 3E49A 1M9HA 3PUEA 2VZVA 1I8JA 3W76A 2ZZ6A 1H3GA 1BKSA 2V3DA 3FX4A 4M82A 1FH9A 2EPLX 4GUFA 3NQ8A 4GOAA 3SN4A 1JQXA 2UY2A 1CIUA 1E6NA 3DYMA 1Q6GA 3CZLA 3DFOA 3ZYZA 1W3JA 3G1SA 3IJLA 2E5DA 2Y8VA 4PE8A 3LA4A 9RUBA 3UGVA 2C16A 2PTZA 1Q7ZA 3LLDA 4LPCA 4AWUA 4LCRA 3LGDA 4YCOA 5FL0A 3ZWTA 1E0TA 2NUWA 4FNPA 4GVFA 2ZX8A 2RH9A 2TYSA 4PUKA 2F8QA 1LOQA 3AHVA 1CDGA 1TPH1 1CGYA 3LPOA 2B7PA 5XIAA 5LNUA 4DJFD 4J40A 2RDUA 5GQBA 5C2GA 2QDDA 1FX6A 2YCLB 2I57A 3UA4A 3CASA 2A1YA 3EOEA 1V4YA 3E0IA 3HQOA 4FLOA 1JUKA 4HJFA 4OOZA 1OBAA 2DZTA 3CL8A 1MXGA 5M1TA 2OPJA 4HCDA 3NGFA 1U1JA 3LNPA 1FWCC 2WJDA 5DFAA 2MUCA 2A85A 3B0PA 3BG9A 3WJYA 1ZSXA 2BWGA 3KEHA 4GX9A 3W1UA 3GFZA 4QXIA 3RN6A 3MZ2A 2NSXA 3S5NA 3WJXA 1DQUA 4GFSA 3L2MA 4MOZA 4V15A 3S5YA 2GUYA 2OMAA 1LCOA 1UD5A 4MKVA 4E0CA 1VEPA 1QNRA 5BW6A 4FI4A 1V02A 1XJBA 1KBLA 3BOFA 2ZA3A 4J9JA 1AL7A 3AS0A 3SCTA 1JD7A 3CZJA 3ZT6A 4ZQNA 1AUSL 5A5WA 4A3RA 2XUCA 4XSLA 2QVHA 4OWGA 1H7RA 1CGWA 3SDOA 3DCPA 3QPYA 4Q4RA 3W28A 5DANA 1WBJA 1Q6LA 3YPIA 1ISYA 4X63A 4H1ZA 1R3QA 4OUIA 2PS2A 1A5UA 3WUFA 1TMLA 4AD4A 1UWUA 1V3KA 2DPEA 1Q7QA 3UWUA 4CEXC 1XHGA 5M03A 3IGHX 1OEPA 2PDLA 1SFJA 2EJAA 2Z2UA 4Z17A 1W9UA 1LROA 4WIWA 3UCCA 4IH3A 3WH7A 3SCOA 3L7RA 3QPEA 2FH6A 4OHQA 3WQCA 1I1WA 1N2VA 2CHOA 3M7WA 4IMAA 4NUWA 5I3GA 4FXJA 2YJQA 3HJEA 2VRKA 3M07A 2A3BA 1YQ2A 3VINA 3B8WA 3IK4A 4C6CA 3NYZA 3PBYA 2O4QA 4EAMA 1PE1A 2PDCA 1DORA 1TE1A 1R2RA 3FNDA 3SN0A 1WKFA 3SI9A 1GCYA 5A8GA 4A3YA 1V0NA 1EFZA 1L6WA 3P0XA 1H1ZA 1ZALA 3SFWA 2R82A 3AXXA 4W7VA 5HMSA 1JPHA 2HMCA 4QLJA 5CQ1A 3FCPA 2XSAA 3U7BA 3AICA 3DX5A 1IE7C 1GKRA 4LF1A 4W9TA 4KEUA 4RZ4A 2NQJA 4JTSA 3S6OA 1IEIA 1GVOA 2G4FA 4DWSC 1WUFA 5AHMA 3H2FA 1R87A 1XRFA 3GC5A 4XSMA 4JIHA 4ZOBA 4NF7A 1ONEA 1W91A 3AIWA 2O9TA 3CAQA 4XQ6A 5FKYA 1MVYA 4RNIA 5AC7A 4JR5A 3VNKA 2FQIA 3Q67A 3PY2A 2GDVA 2JEPA 2VOTA 4IICA 4OBTA 3T8QA 4O52A 1KCZA 1RR2A 2PZNA 4AYSA 1OZQA 4D1IA 2QT3A 2D3LA 3HGRA 1ZBKA 3BW2A 3ABQA 4RJEA 2CKRA 2YDAA 3THCA 3WFAA 3MJMA 1QCWA 4MJMA 3PJXA 2VC5A 1EA0A 1AFSA 3MU7A 3V5OA 1O66A 3B0YA 1ISVA 2VC7A 2PWFA 1A5LC 1YDNA 1AJ0A 4H01A 3LSCA 1XL9A 1E15A 2Y7FA 3GD6A 2DZPA 2PTYA 3WO8A 1JDDA 5JXQA 1LRTA 1JCJA 4JTAA 5T8GA 1XLEA 2GJRA 3PZ9A 2EAWA 1E55A 3D5HA 2OZ8A 3TOYA 1XW8A 2EHHA 1DPMA 4D6JA 2R94A 3EOLA 4ZGYA 1XD1A 4JN7A 2ZZ3A 4IMCA 3HZ3A 4O50A 2DSKA 3BLLA 4JN8A 2VENA 3CPUA 4LS1A 4LYPA 3WSUA 3CUXA 5JH2A 1Q5MA 5BOFA 3IJ7A 3M5XA 4JNYA 2DEPA 3DERA 3UZJA 4LJ3A 3NOYA 4MY9A 4XZBA 1PO9A 3VAVA 2AL1A 4IIBA 1HKVA 5G2WA 3FSUA 2BVWA 3R58A 5BMXA 1NARA 1E0UA 2C19A 2J6XA 2KAUC 4QG8A 5HMEA 4MB3A 3H12A 3C8NA 3R1ZA 1M1BA 6REQA 2HNEA 4HIBA 3FA3A 2FFCA 3WLSA 3E0LA 3N04A 3L66A 4TMBA 3WJSA 1W1PA 4L5ZA 4DWSA 1YXYA 4ZCWA 4US5A 3GDRA 5JBDA 4AD0A 4YVXA 3QLLA 5A8OA 1XCWA 1BKHA 1GJPA 5CPLA 4IL0A 5D8WA 3SO7A 2YX0A 3URAA 4MNMA 3EKLA 4GI9A 1HL8A 3Q37A 1HUVA 3NXFA 5KTLA 2I9EA 1TPFA 1J12A 3KBSA 1HW6A 1A0EA 3VZXA 3RX4A 2A6LA 4OKDA 1V02E 3NOEA 1KGUA 1DE6A 1GW1A 1JUBA 4UTFA 4TV6A 4ZXOA 3WDPP 4WKFA 1B3XA 4YTUA 2FJKA 1BFNA 3TTQA 3EMZA 3KAOA 1QUMA 3N73A 1FCBA 1J11A 3T05A 3QMSA 1OD8A 1Y65A 3TWAA 3GFYA 6REQB 1VBJA 3RM8A 2AQVA 3NQGA 3VKDA 3W3OA 7ODCA 2XIMA 2J7BA 3E2VA 4P5UA 1V6XA 3WDRA 1DHPA 4ML4A 4MPQA 4AC7C 4D6CA 3JW7A 2Y5JA 2BY3A 2QPSA 5TF0A 1G67A 4EANA 2ZXQA 2IMRA 1I2OA 2V2CA 3PZIA 1R30A 4HNLA 1CLXA 4QITA 2OKOA 3UZWA 7TAAA 2FZ8A 3AC0A 3DIPA 2FPVA 3HG5A 3ARSA 1LQ0A 2X1RA 5ABFA 4O17A 3RXZA 4ONVA 4O16A 1OCNA 1W1IE 6PTDA 3SQMA 4IJRA 2CLEA 2FGBA 1YYAA 3MMUA 4RE2A 4GI4A 4AMAA 3QV8A 4H41A 1OFDA 3GM8A 3AOFA 3C3NA 1RUSA 1BYBA 4BR1A 3SBFA 1UR3M 1GOMA 3BAJA 5HJXA 1A4MA 3NQ7A 1VBRA 4HOZA 5FF4A 1V5XA 5FF3A 4PTVA 1MW2A 3FJNA 4YIWA 1TWZA 3RLHA 2VX4A 7PTDA 1GORA 1AJZA 4DNHA 5D32A 4H8VA 3UGRA 3FFSA 4NRRA 4NZFA 2V2DA 5FAGA 3T2PA 2VD9A 1CZ1A 1WNOA 3T0CA 1JEZA 3GG8A 4PUJA 1OHLA 3A4AA 4QP0A 3NPVA 2ZWZA 2YCJA 1GHSA 1DXFA 1L8PA 4W8AA 4FLQA 4AY7A 1KQZA 1Q4WA 3BK0A 3PZOA 4YPJA 3LGEA 2WNZA 1O1HA 2J25A 4DN1A 1QASA 3B3DA 4NZ1A 3VKBA 1C7TA 1LWJA 2POZA 4DY1A 1PIIA 5E9AA 4IIFA 4NT0A 2WLZA 2YL8A 3VDHA 1WZKA 2CCRA 3P6LA 3AI0A 1DYSA 3PWAA 3H2AA 2PD5A 1GOOA 4PTWA 3GIQA 1QI3A 3I68A 1O5QA 2D20A 2W91A 4BJHA 5C9WA 5LZLA 3NNTA 1TZZA 3OBKA 4IP4A 1HIZA 1XC4A 2NXHA 2VRJA 1NP2A 1E9ZB 1NVMA 4GHRA 4TQTA 4JGDA 3UY7A 4O53A 4XZHA 3RIKA 1G7UA 2ZA2A 1NELA 1UH2A 4XUYA 2HRWA 3TDFA 3O6DA 2QQ6A 3WELA 4WJEA 3HA1A 4EE9A 4ICCX 2BOFX 4R9OA 1VHCA 1FWFC 2QCEA 4GZ7A 1TWSA 2DIKA 2OXNA 4YHGA 2JKEA 3MTWA 3ARZA 2A3HA 4DYJA 2A4AA 5CEWA 1PAMA 1B9BA 3TLQA 2WKJA 3CUJA 2WSYA 3TN5A 4O1DA 4LUSA 5B7ZA 4KGLA 3RJYA 3BJSA 2BVDA 1M01A 4HPJA 3GXPA 5FJRA 1TPB1 2JF7A 3ZSSA 1NDZA 2VO5A 1AODA 1FHUA 3Q45A 1E6SM 1RSCA 1EJXC 1LBLA 2ZXAA 3BSHA 3TIMA 1UC4A 3TROA 3WKZA 4LVDA 3HB9A 1KFWA 1OFBA 4K36A 2VZSA 3LEPA 4E4UA 5A8PA 1OX6A 2XGIA 4IIHA 5DY3A 4IMGA 2EPMX 2O4MA 5E0CA 2WVUA 3OPSA 4P8UA 1AW5A 2HTMA 2NVAA 1EXPA 4HN8A 4EXQA 2DFAA 3DZ1A 2Q71A 3GSMA 4AVNA 1IIGA 4UNIA 3BC9A 3VGEA 3AZSA 2GL5A 4IF2A 3SRKA 3BW4A 3VOIA 2PSNA 3F2BA 1A5OC 1YDVA 3PPCA 1BXCA 3RLVA 5EGRA 4FB7A 1PKMA 2QUNA 3STCA 3EA2A 3NDOA 3M0VA 4UR9A 1TV7A 2EKCA 3ONCA 3RJXA 3O7UA 1PV8A 4PGLA 1ZAHA 3EX3A 8RUCA 2VR2A 1XFCA 1YPFA 1EIXA 6CGTA 5EL1A 2VGGA 1MNSA 3VD5A 3DN5A 3PSVA 2CETA 3LTSA 2CLHA 4F48A 2QVNA 5TQLA 2XVNA 2DQXA 3TA6A 3CPGA 4M1BA 5D38A 2CLFA 4KBXA 2C71A 5AHFA 4BF9A 1XH0A 4N6EA 3WNLA 3ICJA 4JTJA 5B80A 4H8NA 5AKQA 2X1UA 2WKGA 3ERPA 1DIDA 3VIFA 2VR5A 2Y61A 3AALA 2PWDA 3PG9A 2VEFA 4IQDA 1KM5A 3UYIA 1XDJA 4JQ2A 3L0NA 5AC6A 1LRQA 1E1FA 4QLLA 3R6IA 3G6LA 1MW3A 3EKZA 3LM3A 4TX8A 1XIHA 4HYWA 4ADUA 3W02A 1YX1A 3RMEA 4P7QA 4LU0A 3ITGA 3V7PA 4P8VA 3HPAA 4F0KA 2H8ZA 3STGA 2C18A 3WD3A 4J3UA 4PRWA 4AX6A 1G0CA 7CGTA 2WZTA 4MFEA 1W1A1 4RLIA 1BLIA 1V0MA 3N3TA 2V3GA 3LSBA 4GXMA 2X16A 3BAIA 1TTJA 1KBJA 1YXDA 2DDXA 2NSOA 5HMFA 3KUMA 2DVTA 3IAPA 2R1MA 2VDHA 2W4XA 1NSJA 2J75A 3VFLA 2PDFA 1QATA 4YYFA 3T4CA 4S3GA 1Q2SA 5LA1A 3FY1A 4JX4A 1S3TC 4DM1A 4AQLA 3S0CA 1VCGA 2BZNA 2GOUA 1E0VA 4G1KA 3R8GA 4PH6A 3PUOA 4WSJA 3ZWSA 1K3UA 2ZX6A 5C7VA 1V6WA 2WYSA 1SVDA 4MZ1A 3SADA 3VZYA 3JS3A 3W24A 3UWZA 1XLGA 3LV5A 1LL4A 5DXXA 3NSXA 2ASHA 2ACSA 2JKAA 1UD3A 1VHNA 3N3MA 3KL0A 3VI2A 3M41A 3IUHA 1Q65A 3DFYA 3RCYA 4MNLA 1H60A 1G4SA 3E0FA 3KZSA 3WF4A 1SUXA 4KESA 5C9ZA 2QJIA 2DSZA 1I2PA 5LNSA 4PUEA 2CXGA 3EOSA 3MDWA 1UQZA 2YOCA 5H2ZA 3BANA 1NY1A 3LBOA 3FJLA 3GC4A 3AU6A 4DJFC 2AAMA 2ZQ0A 3VABA 1EJRC 4E8GA 3ZM8A 3CHCA 4A4AA 4RK8A 2V67A 4UXDA 3FHQA 2PTWA 2EKGA 2JQXA 3GVRA 4IJBA 2PDUA 2YFOA 1UWTA 1E71M 4ADSA 1F9CA 5EPDA 4DZAA 4QE5A 2WZIA 3MUY1 1J0YA 5FJOA 4CN6A 1EBGA 3UPMA 1PZ1A 4AMCA 5AYZA 2OGJA 1FDJA 2Y8KA 4HYRA 4PEKA 5C9XA 5EYWA 4PRRA 1N7KA 5E09A 2ABAA 3NQVA 3BSGA 2XPKA 1W0MA 3UZ5A 4ZOAA 1XLJA 2GDQA 1P4CA 1XLBA 3VIGA 3VIJA 1UMYA 2UWFA 3M44A 3O05A 1ECEA 3MSYA 4QGCA 3WF0A 3RRAA 2XYLA 3M47A 3BJFA 4OFCA 5I03A 2PB1A 3ARTA 2H3BA 5EA9A 3VXGA 1MZRA 2H9AB 3B8VA 1UIOA 5F2MA 5CLTA 3G1HA 4QHRA 1TJPA 2X0SA 3OODA 3FKRA 1RBAA 3SR7A 1ZU8A 1P0KA 5IBXC 3S5OA 3WBEA 5I3HA 2CC0A 1V6YA 8TIMA 4JTEA 4WDWA 1BTCA 4GLEA 4V33A 3CUIA 2PAJA 1E73M 2R1KA 4RE0A 1W8GA 4Y90A 4KCUA 3IIVA 1XSIA 4L7ZA 1GOWA 1FWWA 1HKJA 4DXKA 4FS9A 4V1YA 3W07A 3FJ4A 3NUKA 2I5GA 5BCAA 4B5XA 1UBPC 3K46A 1BWLA 3H7UA 3GWQA 2VR4A 2OGYA 3TSDA 4NHVA 4AYGA 4FF5A 3DG7A 2HNHA 3NSMA 4LAMA 5IXEA 3WQ5A 1IT7A 3BLFA 1E3ZA 3OOQA 3WNPA 5C54A 2C15A 1GZJA 2DJLA 2G3IA 5A2BA 3IIPA 3W73A 4BY3A 1US0A 3CB3A 3VK5A 5I3IA 3GKAA 1XINA 2VGBA 4AD2A 3ARUA 4N02A 2G4JA 3WH6A 4H4IA 1TPDA 1JGMA 1KBBA 2F9RA 5EMJA 3TMQA 4A3QA 1EO7A 1GVIA 2PZ0A 2P88A 4DJFA 3ARWA 3FA5A 2YW3A 2VVNA 2PF8A 3HPXA 2CZ5A 5FAJA 1F8MA 3AMCA 3E2RA 4HD5A 4GNJA 3IGUA 1PX3A 1A50A 4IPJA 3IJDA 2EPOA 2INEA 4F0HA 3N15A 1B0IA 3IEBA 4GYKA 3TFXA 3N2BA 4UBPC 1XYZA 5FSDC 4ZTXA 2RUSA 4GH1A 1EDTA 4K1GA 4UTTC 2Q8ZA 3CHFA 4DLMA 4K8GA 1OFQA 1F6PA 2CYGA 4YVPA 3DI1A 5GJNA 4HSOA 5LSMA 2JE8A 4K37A 3VIOA 1UWSA 3OO2A 2Y24A 1LLWA 2QAPA 3W7CA 3PUGA 4O4VA 2OOGA 2YCIX 4Q8QA 1JDEA 1IIHA 1SJCA 4JHMA 4GGBA 5DMYA 2Y7GA 1Z32X 3UJEA 1H41A 4KFOA 3VOCA 4AX7A 2ZUTA 3WEZA 4XAGA 4A05A 1A3HA 3K1GA 1SO4A 4JZ5A 3J7HA 1MWOA 3BWWA 5AHNA 2XFRA 3MQTA 3MI6A 3HF3A 4O0KA 1NDYA 2W9MA 4PODA 5CZKA 3CUHA 4WY0F 4C60A 2VFFA 3DYPA 5IBXA 4XVEA 1M53A 2PI6A 4FXFA 3IIXA 1AD4A 2JK2A 4XD3A 3W37A 2YYTA 3W86A 3OYZA 4IPIA 1BTMA 4GY7A 4C6FA 1K03A 3IACA 3MBDA 5HAOA 1PS9A 3EDDA 1DIKA 4N0RA 3UFYA 1X6NA 4CU8A 4BQ5A 3L23A 5A6SA 3TE9A 4I90A 3H4GA 4EKJA 2VWSA 1QRQA 2WNNA 4R85A 1XIJA 1JI1A 1LT7A 4QE4A 4N7QA 1QWKA 5AZ0A 4UQAA 1XYFA 4IFKB 1DOSA 5CPQA 2E6AA 4AIUA 4TOQA 1GGOA 4C1NA 4DF2A 1UZ1A 3EX4A 1ISWA 3WQGA 3PHAA 1Q8JA 4DQWA 2I7GA 2WHLA 2ZC1A 4A2RA 3HPSA 3UYCA 5J5RA 5BRBA 1DTNA 2W6RA 4KF1A 2Q09A 4JHOA 3G1AA 1JR1A 3OGRA 2ZZ5A 4Q7BA 5ABGA 5D03A 4B92A 3ISIX 3W1NA 5K9DA 3VGDA 2Z1BA 2GVLA 3LTPA 1BPLB 4HMEA 1LF1A 1QDSA 1RVGA 3KRUA 4AWEA 4IXXA 1R9ZA 4HZ6A 4Y7EA 4UTTA 3EAUA 4WKAA 4NVTA 2BOEX 4RNFA 5TAOA 2H6RA 5GNXA 3RHGA 4AY8A 4FK9A 3C86A 3TXZA 3WIJA 1QR7A 4IGSA 3W26A 2TMDA 4OVXA 1E9LA 2I5IA 3M6YA 3O6YX 3PNZA 1ICQA 3GW3A 2BXYA 2G0WA 1FKWA 3TYCA 3VD7A 2CHNA 1GG1A 4W86A 4B90A 5IHSA 1J0HA 1XDMA 3LK6A 4LT9A 2NXIA 5CJNA 5H6HA 1JZ7A 1L2UA 3I4KA 2ODOA 2WMHA 1EF3A 2TSYA 4GBUA 2OB3A 3TK7A 1SJAA 4TVCA 1V03A 1PKNA 2ZRVA 1DIEA 1HF6A 1C29A 4O11A 5I78A 1ZBWA 3VIIA 3QGAC 4J28A 3E2QA 4PMDA 3UA3A 4C6KA 2YA1A 4PC8A 5I06A 4HVXA 2Z4GA 2EPKX 2V3FA 1VAHA 2P0OA 4GIEA 2PDQA 3L5MA 4N9CA 4QIUA 1J6OA 3H2OA 2VDIA 1RPKA 5HPOA 1P5BA 4B5TA 4J3TA 3MW7A 2FJUB 2V5KA 4Q4PA 1A5SA 1I2QA 2ZTKA 1IQ8A 3QR1A 1XPGA 4GXPA 1P1XA 1UUOA 4AZCA 5TD4A 1OC6A 4J2PA 2D3NA 4ATDA 5JU6A 2WCSA 3QMTA 3KCOA 2F38A 4EPDC 3EXSA 2PDIA 2WJFA 2GQ8A 4Y9AA 1EF2A 4GKLA 3QM3A 1FWRA 2DVXA 2FZNA 4YWSA 1RY8A 4BHYA 1N8IA 4L65A 3U57A 3CQJA 5LIKX 1PPIA 4IMFA 4H00A 1TV4A 1FVPA 5L6UA 4BA0A 1B90A 3T40A 3VA8A 4NL1A 4PBGA 3OZYA 3P81A 1TZ7A 3RRXA 3OLEA 1D9EA 2W27A 3E74A 2GVJA 3SIMA 3UWYA 4Q8OA 1EUNA 4DIAA 4B5WA 4HHLA 3N11A 4LGXA 1M7PA 1UWRA 4NYUA 1VIZA 4N4QA 1F2JA 4BS0A 2OOFA 1ISXA 3Q4DA 1KGXA 1IEQA 2CESA 1R7AA 1F4HA 3VCCA 3DFTA 4FNSA 2WSKA 3GHTA 5AOUA 3NZRA 1I60A 1XPYA 3S47A 1HN1A 3WD0A 2BFGA 1OC5A 1P7TB 5E0FA 4H9MA 1RK5A 5CPOA 3BV7A 5CC7A 4D71A 1M5WA 1MDRA 3HN3A 1B1YA 4HA1A 1T8XA 2PDXA 2H90A 5HA7A 4KMQA 1P43A 3U48A 4XWUA 4MVAA 3CB8A 1DJQA 3C2FA 5IHRA 1A3WA 3APGA 3W7NA 4J2MA 1S2TA 5KZMA 2Y63A 1FCQA 4JTCA 3B9AA 1W5OA 3W1QA 1T99A 3SY1A 2LLEA 4PN2A 3PWIA 5JUVA 1PWMA 4HYVA 3LD5A 4EPKA 5MHBA 4BKNA 3H2CA 1XGEA 1J0IA 3E12A 4D9PA 1MSSA 1UKTA 1FKXA 1UOKA 2KZHA 4X0VA 2QR6A 4H19A 3A13A 1SQ7A 3TWBA 5DMNA 3LPFA 1FWSA 4MJ4A 3ES8A 2EG8A 3MKVA 4K3ZA 2FZ9A 3DENA 4MDOA 3EWWA 3VMPA 1KFBA 2VEMA 3EWYA 2VWTA 3NAVA 1EP3A 3MCNA 4IUGA 5CZ0A 1WXJA 4DZ5A 4XBKA 5LGZA 2ISDA 4X9YA 4EPEC 2WMGA 3TQ0A 2XVLA 1P6CA 3EDKA 3PZTA 3QLDA 1DJHA 2O0TA 3OLIA 2QJNA 1ZGDA 3KOYA 2IW0A 1EKOA 1LORA 3R25A 4AISA 4RDVA 2RFGA 3BG3A 4MWAD 3EMCA 2W66A 2OTDA 2YXXA 1TA3A 1KCKA 1WDPA 4U31A 1NWTA 1B3YA 4QRNA 1FP9A 3OHMB 3WH5A 4YN5A 1JAKA 4ADTA 1OX5A 4A8LA 3HU7A 5J8LA 1TVNA 3MUCA 1ZUAX 3RILA 3UJ2A 4OBSA 4Y2WA 3KWXA 3DFSA 4U2YA 1TREA 1RJRA 5FIPA 4HK6A 5HWMA 2ZIDA 4LAOA 1P1MA 1UKPA 1W9BM 4BQ4A 2QF7A 2OX4A 1RV8A 3BOXA 3FJ6A 3G1RA 3LENA 2J8GA 5KZEA 1Q85A 4X3ZA 2Z26A 4JTGA 1KKRA 4X9SA 3WENA 3HPFA 4R53A 4NKCA 4ERGA 1RHCA 1TUXA 3QHMA 4F2BA 3N34A 3USZA 8CGTA 3W7OA 2WMIA 2PLKA 3REQA 2AMXA 1H61A 1OFRA 5LA0A 4IPPA 2HK0A 2WWDA 1ITXA 1YIXA 4HPNA 2BTMA 4DI9A 3WLNA 1A80A 2PDBA 4M6VA 5C2XA 3AXIA 2J8FA 1YNYA 1VPYA 4MKSA 1EB3A 4JDYA 4AF0A 2X1IA 2V63A 4HZ8A 2DSVA 2MNRA 5A3HA 3CZ8A 3DESA 1JZ6A 4UQDA 4MKNA 1KA9F 3ZR5A 3LXAA 1C92A 3SCSA 1V6TA 5I79A 5C0QA 4WSKA 2FB2A 3WBWA 2I5QA 2D24A 4AZ5A 4C1LA 2B0MA 3EPOA 3L21A 1EC9A 2V6AA 2X8RA 4F79A 4LB3A 3BUVA 4Q3MA 4K8HA 2P1FA 4JFTA 2DP3A 2HDJA 3KBWA 2ZADA 3QEZA 2WMIB 1DBTA 4EACA 1RXOB 1BXNA 1VP5A 3REQB 4PCNA 3NGJA 4QX4A 1V3LA 4PL1A 4TMCA 3QV6A 1DJGA 2ZVIA 4R7WA 2HXUA 1HXJA 5LKYA 4IISA 3NVDA 1Q6RA 2I56A 1W6TA 1YBQB 4JTRA 4NQ1A 1S5VA 3EYPA 3U6WA 5ABHA 1VENA 4CVUA 2UY5A 4FNRA 1PHWA 4AIBA 1XICA 4BI6A 2WCAA 1FY6A 4A22A 3UEQA 4NXKA 3CIVA 2ALDA 1U5VA 4AB4A 4H9VA 4UTWC 3VDAA 3U2CA 3UCQA 2DUAA 3C6CA 3WEOA 3GHUA 3WF2A 1H63A 2X2YA 4FXSA 3OHIA 1JCYA 3QQWA 4YTSA 4L6HA 3PBWA 2CKSA 3TCEA 1F76A 3AYSA 5FI8A 1RLDA 1X97A 3R2GA 4AAJA 1MQRA 2ZBTA 5HK4A 3N9KA 2DT3A 3EDFA 1OINA 2PLJA 1CENA 3EWDA 3ZO9A 1FDZA 4MB4A 1YHTA 5D2VA 4EF8A 3T81A 2J6VA 2FPTA 3ALGA 3L0GA 2O7QA 3OIXA 4FALA 4QR6A 2DW7A 1U2YA 1DWIM 3MUXA 3GU9A 3EPNA 1TWWA 5DF0A 5C6MA 2FH8A 3TQKA 3VDCA 3V0SA 3OG2A 3KW3A 1WAWA 3I10A 2Y5SA 3AYRA 3CTTA 1Y8BA 2NWRA 4J3SA 4C5YA 1ME9A 1XD0A 5HDRA 3RR4A 3AIVA 3EXTA 2J8TA 3SQLA 1CGTA 4GO8A 1GT8A 3TLLA 5GPRA 4CNUA 1JF5A 1BVNP 5A6AA 2QDGA 5A2AA 3AFBA 4WDXA 1FWTA 5IRPA 4A29A 3LI0A 3WZ0E 1GUVA 2FTPA 3RCMA 4TO8A 3RNDA 4BI7A 2Q3OA 2ON3A 4NG3A 3N14A 3ZJ6A 4CKQA 4XAZA 4JTLA 2XJ7A 1XYAA 2F6UA 3W7MA 2PLMA 1UROA 1VFUA 2GGJA 1VR6A 3VNZA 1POKA 1PZ0A 3APTA 3ZQ9A 3TAKA 1TPWA 3B8SA 3ZS4A 4AFYA 1K4HA 2VEIA 2Y7DA 3MHFA 1AH0A 4EWJA 4S38A 3VD4A 1E4LA 4JIEA 5K3VA 3WMSA 1QHZA 4PMYA 2BODX 1EP1A 2QCDA 1B3OA 2WQDA 1FWAC 1TPUA 2HS6A 4H6QA 2DT2A 4UTWA 4O13A 5DRIA 1PTGA 3SEPA 4JD4A 4HP5A 2VJXA 2AKZA 1QI0A 4TX6A 2ZUSA 3ZSTA 3EX2A 4M6PA 4ZO6A 4RW5A 2WPBA 3MHUA 4QQ3A 3GVGA 3KS5A 2WANA 2X09A 4GJJA 1IR1A 1KM1A 2D0GA 2NX9A 1UR8A 1U33A 4PMZA 2J9YA 2E1WA 1TQXA 2B7QA 2PP0A 3BCDA 4IGMA 2WSQA 4FNQA 3TTYA 2PC4A 4P7OA 4RDZA 2X42A 5AHLA 3NO1A 3WDQA 1BVWA 1QFEA 2EG7A 1BWKA 3L2IA 3ZT5A 3A3WA 4WOQA 3SSZA 4AIEA 3GVWA 4JYEA 4MLRA 2R8WA 2DIJA 4LAUA 3FK4A 7TIMA 1H0IA 1U5JA 2P76A 4FAMA 4I7VA 2ZUVA 3L68A 3WD4A 4CCCA 4D6EA 4Q8NA 2C14A 3E3HA 1W5MA 2OSXA 5G1TA 2VX5A 1KGWA 5BWAA 5HJYA 1GOKA 5BMWA 3VGHA 4IHCA 1GOQA 1K4GA 3FXYA 5CPSA 3BQ5A 5EB8A 1EDGA 1W3KA 4RW3A 4QJ4B 3M4HA 4Q8VA 5HNRA 1IZCA 1EBHA 4L61A 4E6MA 1W3TA 4NJKA 5A6KA 3VKAA 1J4EA 1DXIA 3UD6A 3KTSA 3VOHA 4EK7A 1W56A 3BMWA 3PAJA 2J13A 4NJGA 1UKOA 1NP0A 1C8XA 1HGYA 1RA5A 1RQEA 3ABRA 2R14A 4ZQRA 4O18A 1SM9A 1WKYA 1GYNA 2E6FA 2EPHA 4RPQA 4Z2JA 4KWUA 1VJIA 5K2ZA 1WZMA 4H8HA 5EU9A 2WWCA 5D09A 4MUPA 1IF2A 2QF8A 3L4TA 3CMJA 4FX8A 3TC3A 3QH2A 3MY9A 1G7VA 1QI2A 1MMFA 1SZFA 2BLEA 2OG9A 1A53A 3SJ3A 4IG2B 5G4HC 4O15A 3E6EA 2C0HA 3MC5A 1GZ1A 3CHVA 3T08A 3KZPA 1XFBA 1POJA 3NQFA 3BW3A 1NM9A 2WNQA 3I6RA 1QAPA 1N82A 4J5NA 1HO4A 4MF4A 2GVYA 1QPQA 1UP2A 4HU3A 4FZIA 2ZXBA 1RK6A 2BP1A 1UD4A 1GNXA 2ACUA 3Q58A 3NPXA 1J6PA 1KCXA 3T8LA 1IYXA 4U5KA 3VIMA 2DZUA 2YR1A 3TJIA 1JD9A 1A5CA 3GBDA 3VM7A 1OIMA 4M0XA 4HNCA 3GXTA 2DZXA 2IQ0A 3EWUA 3W29A 2OKTA 1WOBA 4IGNA 2QV4A 4HPXA 4ROQA 1J79A 1SGJA 1TJ2A 2BV9A 3NL6A 3HQPA 4JN6A 1QNOA 4IPLA 2A3LA 1H0GA 1UKQA 4DXXA 5H8MA 3WLKX 2PPGA 4TUFA 3VD9A 5EFFA 2PDHA 3ARQA 3W7RA 2MANA 5RUBA 3P5ZA 3NG3A 1E6PA 2Z2BA 4LVBA 3T44A 3AHXA 3DYOA 4BF7A 2R1LA 1ME7A 3BICA 3GIPA 3O2LA 2QULA 2Q02A 1MRAA 5DCEA 1K6WA 4D8AA 3GO2A 3VIKA 4U33A 3RYSA 2O9OA 4ASTA 2QHAA 5F4SA 4FOKA 3P62A 2FMOA 1AZ1A 3MMTA 2V38A 1E4MM 2OLHA 3ARYA 1TJRA 4OBRA 1NOWA 3AO0A 5E70A 4CCDA 3LNMA 4L9ZA 4E4FA 2DSUA 1IT8A 1LDCA 3MYPA 3TW7A 4JY9A 4WK9A 3ENLA 2PWVA 4TVUA 2FFIA 4M80A 4IFRA 4D8LA 3DXIA 3NSNA 1LG2A 5DCBA 1JYXA 5F4WA 4WXYA 2YA0A 1O4UA 3O9NA 5D9MA 1CXHA 3QY8A 5HQEA 3BZJA 1E56A 5CG7A 3NXLA 6XIAA 5CC6A 4XKMA 4S3CA 5CJ5A 3C0SA 5SWUA 2REQA 3URBA 4GJIA 2C1HA 4Z1BA 3UR7A 1ZENA 4W7UA 5CAKA 1UZDA 3V5CA 2W63A 3O1NA 4PMRA 2D22A 3CWNA 5CC5A 5CPMA 2I17A 1BQCA 4PMVA 2XFWA 2G41A 1QI5A 1WAUA 4F0MA 1SZRA 4H3DA 1OFOA 4NNAA 3V4BA 4B91A 5DQPA 5KINA 1AH3A 2FTYA 1E5NA 4FR1A 1KRMA 1R85A 3VC6A 1WKDA 3RDKA 2ZDSA 1EOKA 4C6IA 4PCSA 1JAEA 4Z1CA 1UZHA 1EYWA 2Z6IA 2D73A 1E43A 3S1WA 3ATYA 2GWGA 1MXSA 3WFZA 1V6UA 1CX9A 2OT0A 2OWCA 3SCRA 1VF8A 1P6WA 1B2YA 4XZLX 4HU0A 1WZLA 2QW5A 1O94A 2B31A 4HHMA 5LXXA 4HBKA 3QHOA 1H7XA 3UR5A 1XDLA 1MXDA 3W4RA 1S1PA 3F5JA 3GXIA 2REQB 1ZP4A 3AWOA 1AQMA 2WMJA 3CEPA 1ZJIA 4AHQA 1RAKA 3WQOA 4I9AA 1B3VA 4FXRA 1FA2A 5D2YA 4DO4A 4Z2HA 3RF9A 4WRHA 2XG9A 3E38A 1DV7A 3LOTA 4LH8A 2ONEA 4BK9A 2D1ZA 3W01A 1KFCA 5D02A 5A6MA 1GQNA 3H70A 3N6QA 1TV5A 5EMUA 1MRQA 2QCLA 4RL3A 1UWAA 1XLMA 1GJUA 3TKFA 4UQCA 1DWFM 3L5AA 1ICPA 1O5KA 2G95A 1H62A 3S5ZA 4MSSA 5IFTA 4TR9A 1GQIA 1K70A 1JXJA 1HO1A 1VEOA 4PUNA 4R5EA 1E9YB 3LU2A 4C65A 1NF0A 1ADOA 3M43A 1F73A 3GUWA 5AYYA 2PD9A 4C6PA 4XD6A 3BL3A 1IEVA 4AEOA 5HPCA 3NQBA 4PL2A 3PUDA 2I14A 1JG9A 2ESCA 1EUAA 2Z1VA 3Q2DA 3FKKA 3CLWA 3P3BA 4NX5A 5IOBA 3GBEA 1W5PA 1XIFA 5LIXX 1A4LA 3WN6A 2CU0A 2J7CA 4B5NA 2CXEA 1DHKA 2X30A 5FSEC 4JNMA 4Z42C 4WSHA 5CGTA 1VPQA 3CQKA 3SUUA 1Y5VA 1RLCL 3WD1A 3HTWA 3TX9A 4OJYA 3FHAA 3BGJA 3IJ6A 3CQ0A 2V5JA 4J1OA 3QY6A 2E77A 1XQLA 1XIBA 3U3HA 1IGWA 3PBGA 3APYA 3WNOA 3SGUA 1GTHA 1LQAA 2X41A 3CPRA 3VIPA 1LZOA 3FA4A 4DVOA 3V1HA 3OQEA 2TAAA 4UTHA 1OF6A 3SAZA 4NAFA 3MA8A 2A5HA 1ZHAA 2NUXA 1JCXA 3SCPA 1CGUA 3H4WA 3ARRA 4FOJA 5XIMA 4O14A 1EJ7L 4GPNA 3V3WA 1AG1O 1W8SA 4XZNX 3PBUA 3ZJ7A 5LHEA 2PTXA 3GG0A 4DBUA 3O6CA 1GVEA 3ME3A 3MSGA 4R33A 2XHYA 4Y8FA 3INPA 3K13A 1U30A 1PHQA 3CBWA 1JRCA 2V30A 2Z2AA 4R88A 2WK2A 3IRDA 4QNEA 3SRFA 1Q6EA 1EDQA 2V5DA 5HINA 5AY7A 3B4UA 2Q6ZA 3QY7A 2GJPA 3N9RA 4UC5A 1JZ2A 1SFSA 2XSXA 3EEGA 4FOUA 4ZR8A 2NVCA 4XO7A 1O68A 4QJ5B 4Y8EA 3TYUA 1S2VA 1W9VA 5D05A 1XH2A 4JKLA 3V0UA 3AYVA 4MZYA 4NAFB 1DQXA 2FGLA 8XIMA 2PDKA 2J74A 4DWDA 2Y89A 3G2GA 4G2DA 2QDEA 2A3AA 2PDGA 1XSKA 1LQ2A 1D8WA 4KCVA 3SRDA 3MVIA 4S3JA 3L5LA 1GJWA 4PMOA 3GC2A 3S2MA 3PPGA 1WV2A 1T7LA 2XWEA 3S9ZA 4P2VA 1O1ZA 3TR2A 2Q8XA 4RV3A 4NAEA 1MEHA 3KFTA 3PFMA 4LC6A 5A95A 2E1DA 1GVSA 5LNVA 1R9YA 3N17A 2RGLA 4PRTA 3MSDA 1KM6A 1XSJA 1F3EA 1S2UA 3TJXA 1GK8A 4AVFA 3RPTA 2EXOA 3MSRA 4ZQPA 1XRSA 4S2CA 3OU8A 5F1VA 4HA0A 3RMJA 3JZUA 1VEMA 2H3DA 1TPEA 2C6QA 2PRHA 2QUUA 2UZ9A 3QMRA 1OFEA 4UNLA 1VJSA 1SZGA 4X2PA 1P0BA 3U8GA 4F0RA 4WD0A 4UFJA 1XIMA 4D6IA 1SZNA 4Z2GA 5ECVA 5DMMA 3I3DA 5KSWA 2WQPA 3TA9A 3LV6A 4ZOCA 3VTRA 1TV3A 4L6DA 1UPPA 4DF0A 3WD2A 2XH4A 2YL9A 2Z6JA 4NAEB 4L64A 4GUHA 3GAKA 3OGSA 4CQDA 5HXMA 2CWNA 3WQ6A 1KLZA 3GE7A 3GRIA 1EWEA 2YCLA 1QO5A 1WKEA 4F0LA 4LFYA 3G5EA 2CWXA 1WPCA 3DDMA 3I7SA 5HWJA 4KPLA 1HJWA 2ZUUA 1RY0A 1EX1A 1KRCC 3OZOA 4IGHA 2PWUA 2HBVA 3AIQA 3WEMA 2Y4SA 3H22A 5G2HA 2XN1A 4LCQA 1UR4A 1L6FA 3U2ZA 4J27A 3DC0A 4OQVA 2DZSA 3TTOA 2AQOA 1S5NA 4CQAA 1RH9A 3CV6A 3B04A 3QKZA 3FGCA 1M7XA 2CZDA 3SUWA 3WUBA 3PTQA 3QHNA 3VM5A 3W23A 2F2HA 2QDHA 3L65A 1E0WA 1E4NA 3S2JA 1UD2A 4NZJA 2POTA 2VFHA 1LBMA 3WNKA 3W2LA 5JIWA 2YDSA 1R3SA 4M56A 4O10A 3W1XA 1NF7A 4FPSA 4C6DA 3D0CA 5EMLA 5ABEA 1OZMA 1Z41A 1UR9A 4JX5A 4F2TA 2WV8A 2GQAA 2V82A 3UG3A 1QMLA 3U0HA 4LAKA 3T1GA 4NP7A 4LVAA 2I16A 4YLWA 3HMJG 3GDMA 1RJPA 1PJ9A 1TV2A 1UJQA 1CEOA 4ZL1A 5DN1A 1SMAA 2PDNA 1KD0A 2UY3A 2GVGA 2WJEA 3D3FA 4I5UA 3FGCB 3G0XA 4QQUA 1YNPA 2WC3A 4KWSA 4W84A 1G9HA 1SFTA 2X0YA 1SO5A 4GVIA 2NX1A 3KTCA 4ZBCA 4X60A 1XKYA 3CUZA 1KLYA 1FP8A 1Z69A 4O4WA 1REQB 4HJWA 4MWAB 3O15A 4GGHA 3W7HA 1DXEA 4S3EA 4Z2IA 3M7SA 4N4PA 2P50A 2R91A 3ARXA 3OA3A 4EIVA 5TIMA 5DBTA 1L6SA 2VELA 4RXGA 3W2JA 3P14A 2XFFA 1RD5A 3F4CA 3RU8X 3HQ1A 3MMDA 2Y0FA 3T09A 2QPUA 4PSPA 1BEUA 3M0ZA 2DT0A 3MUZ1 4D2JA 4DZHA 4B5VA 2A2IA 1JJKA 4LTSA 5DCDA 3WLJA 2QNEA 4GWEA 1E3XA 1F8IA 1JL8A 1U1HA 1S1RA 5AVHA 1UBSA 2ZA1A 5C70A 2XFYA 3M16A 3SCQA 1W3HA 4ZOEA 1V6VA 3C2VA 3ZZ1A 2XH2A 1Y7VA 2J27A 3S4TA 1GKPA 3TTEA 3QPZA 4AZBA 2Z1WA 1NFBA 3BLKA 3BVJA 3UWQA 5CCZA 1ODZA 1C90A 3ZT7A 3CWHA 1PDYA 3IK2A 2E4TA 3UZXA 2F6KA 1TCDA 1H51A 1SZEA 3LCHA 3K30A 1GONA 3URQA 3P7YA 3GVVA 1EWDA 4HNOA 2O55A 5BU6A 3H21A 4HTYA 4O12A 4YXGA 3C0LA 3RUBL 1F74A 3A4JA 5FJUA 1KRAC 4GFIA 3THUA 1R3RA 4KFNA 5MKGB 2BASA 2QMKA 3G8EA 4L9YA 1YKWA 4C7GA 1ZCOA 1ZBCA 2V8ZA 2TRSA 4LYRA 2CERA 3CS2A 4JTTA 1AJ2A 1ICSA 3WUEA 5H8PA 1FWHC 2P8BA 3NPWA 4L80A 2NWSA 3AXKA 2YGYA 1IV8A 4NASA 4AXNA 4M3PA 2GGEA 2NQHA 4NJHA 2GOKA 3W81A 3UXLA 5AC4A 4U28A 3A5FA 4GQQA 1W1YA 3R8HA 3DG6A 4B3ZA 2Z27A 2J7DA 5TBOA 4B15A 1D7KA 2Y2WA 1ITQA 3N6JA 3S5SA 3MP3A 2JALA 1C91A 5EMYA 3T0BA 2TPSA 3NQ6A 4N9EA 3R10A 2NQLA 2WSRA 1XIGA 4EWND 3M0MA 5C71A 1UH4A 1K1DA 3QOKA 3IIOA 3CQIA 1LM1A 2D0HA 2GUBA 3S9IA 4XD4A 3QN3A 3KLKA 4XB3A 2PLCA 1QPNA 3TJLA 3MCOA 4Q4OA 1I0BA 1KFKA 3B03A 4B4FA 2CBUA 2VXNA 4KCWA 4UQBA 4HN4A 3VOJA 1WA3A 4QTGA 3KCLA 4Q8MA 1CGVA 2OSWA 1DJWA 1NIUA 3LTYA 5HUOA 2YBVA 3L9CA 1PUDA 3RX2A 5CPTA 1OSEA 1RD6A 2GSJA 4Q4QA 1C3FA 1TVPA 4YVVA 1BYAA 1VB9A 2VMFA 5AVNA 1DJYA 3B8IA 1XIDA 3O63A 4OZOA 5JBEA 1MFVA 3C52A 3LZ5A 5LNWA 4NSBA 3W9ZA 4EXBA 3KP0A 1CBGA 1W3IA 3TMLA 3QTPA 2JKPA 5EBUA 3UESA 1ZL1A 1BD0A 4ACYA 1JDCA 2IKJA 3NPUA 3SB0A 1EX5A 5KEZA 4HA3A 4E8CA 3H7VA 4N42A 5EY5A 1KTBA 4CNTA 3LN3A 1KWKA 3NZPA 3N4EA 3FDGA 3XIMA 1RJQA 4NNCA 1XQKA 2I1OA 1VH7A 1IWAA 1A5BA 3PZMA 4ZTYA 2FZMA 2JIWA 1HKKA 2OT1A 2YZRA 3FEMA 2CLMA 2VP8A 3BMXA 2VL4A 5LXEA 3HV9A 2NV1A 2CFFA 3PPFA 1QTWA 1A5KC 1WO2A 1X98A 1G4TA 3VNLA 4P7RA 4DYEA 1CT5A 3WCZA 2DJXA 1B5TA 1O7AA 5U7SA 2OJPA 3CIXA 4C6BA 4CD7A 1PKYA 1HJXA 4LUTB 1EQPA 1KV8A 4W93A 3FS2A 2QLYA 2V68A 4U2ZA 1PZ3A 1TTQA 2D0FA 3W53A 2P5NA 3OLDA 2WO5A 2X05A 3SCNA 1GOIA 3LZ3A 1TX2A 4N9DA 1BF2A 2HPIA 4P7LA 5AC8A 3O0KA 3NM3A 4Q8UA 3HG3A 3VKJA 3E2SA 3POCA 5GJPA 3BZGA 4W8BA 2E5CA 4KW2A 2BX7A 1GKQA 3PC0A 3B9EA 1EP2A 2QKFA 4WY0B 1MW1A 1FBAA 4O1EA 1JPMA 1IZKA 3UVAA 1CCWB 2EGZA 1Q6DA 3CT2A 1CLVA 4DPQA 5C7HA 4LOCA 4Q8WA 1XLKA 5E5CA 5I00A 3VFCA 3TTSA 3W72A 3GK0A 3OYXA 4D6FA 2OZ0A 3UBPC 2HVOA 3G22A 3QC0A 1QOPA 3W7DA 4O57A 3A3XA 2RHGA 4CCZA 4R9XA 3GDKA 2KX9A 3IGXA 2BG5A 3EBVA 1NTHA 1HKWA 4XTIA 4ZO8A 1HNYA 4QDMA 4K8EA 4DHGA 5FEZA 2E28A 4GQRA 2YW4A 1DWAM 1JQVA 3HV8A 1BQGA 2QCMA 7A3HA 1NU5A 1Q6CA 4W8LA 3W1LA 4C90A 3GW0A 1E9IA 1BG4A 4G8TA 2YDQA 3IANA 3PVFA 2QAFA 4ZEPA 3KVLA 3WF1A 2DT1A 5I3DA 2YBTA 1UOZA 1JNEA 2ALRA 4MIMA 4WXZA 4XZWA 3W1PA 3H7RA 4PR4A 4JYDA 1YE6A 2FKPA 2C13A 3S2LA 1G5AA 2OCZA 4PMJA 3CYVA 3W27A 1CGXA 2WB5A 4JFSA 4S3FA 3TH6A 3WL0A 1UWQA 4RDWA 4YTQA 3PZVA 3TYAA 1WZAA 3IUIA 1R6WA 3UG4A 2VQTA 3WDIA 3QYSA 1GVQA 4UOQA 3EX1A 3ATZA 4YTRA 2VZOA 3Q94A 1IZJA 2FMNA 2XVGA 4Y96A 3A24A 4Y9OA 4B3KA 4FSAA 1BVZA 1OC7A 3UXDA 3MKCA 1VJZA 3GDBA 3NQCA 5CSRA 4DO7A 3BURA 1TIWA 3VU2A 1M3UA 1XH1A 1VYPX 3G1DA 3L0KA 4QCFA 3BLDA 4YYCA 1QNQA 3P5YA 3P84A 1VCVA 2YL6A 4DPPA 1XWYA 1ZAJA 3EA3A 3ECQA 3W1AA 4DAIA 2XSBA 3OLGA 1KQYA 1MI3A 1HJVA 1P0NA 3F4WA 1GPFA 3MP5A 4UZSA 4OUEA 2CIPA 1R47A 1X7FA 4XK2A 3F1QA 1TG7A 2RDWA 3NJ3A 3WLMA 4PTDA 3JR2A 4H83A 4GCXA 3K8MA 4ILSA 4RUBA 1V3JA 1EOMA 4IL2A 3DFPA 3DHPA 1LTDA 2IPGA 2DORA 4ZSUA 2D2OA 1OGGA 4JS3A 2PCEA 4O1AA 1OWQA 4JTQA 1LP6A 1OQFA 1UPMB 4CCEA 5H91A 4IIGA 4H6EA 1M7JA 5FF0A 4ATWA 3VNDA 5JIPA 3ID7A 1U22A 4QM1A 5BOEA 3CUGA 1M68A 3EMQA 3IRSA 3MYOA 4GI8A 1R2TA 3OIHA 4C6NA 1XG4A 2JF6A 3W7PA 1I0DA 1H7WA 3CL7A 3LM7A 3C61A 3UJFA 3N1AA 3MPGA 2Z28A 4JTUA 3PP7A 2FZDA 2Z1SA 3H4XA 1HVXA 3RX3A 2X7VA 3LCWA 5GJMA 2P3ZA 1LUCB 3TNBA 1PBGA 1QW8A 2V9DA 3BLEA 1XKJA 3PZQA 1B31A 1W3NA 1HT6A 4UR7A 2V5CA 3RGTA 2NQZA 3K5XA 1VPXA 2HWGA 1H5VA 1ME8A 1KFEA 2HS8A 4N2YA 1AH4A 4NJIA 5I07A 4E2DA 2O56A 2P10A 1A5MC 3GTIA 3S2CA 3BGAA 3N29A 3OGVA 1H50A 3GHRA 1UIPA 3LY0A 4WJ8A 1BXBA 1J9YA 3LHUA 4RCXA 1LJYA 4H7VA 4O1BA 3GDLA 4ACZA 1JI2A 3KX6A 3M0HA 1S2WA 4MLJA 4UQEA 1RP8A 2OX1A 3QBUA 1JFHA 4CNNA 3TUUA 3A23A 2A7NA 2DZAA 2UV8G 1WX0A 4PMNA 3STFA 5CBIA 3QFWA 4I9MA 1EXBA 4U10A 3LXBA 3JUGA 1ZP3A 3PJTA 2CLLA 4PUDA 4XAYA 4QG6A 3QGVA 2ZZ2A 4IT1A 3GZAA 4QDPA 3WK0A 4HMDA 3ZMRA 4V27A 2BOGX 4DJDD 3EB2A 1VYSX 1U83A 1XIEA 1H2JA 4IM4A 4QCEA 2EF9A 1EO5A 2G3FA 5M2FX 4RZBA 1AD1A 4G7EA 4B16A 2WVVB 4FIQA 3T0TA 1KB3A 1MYRA 4HNUA 4OV9A 2FVLA 4M1RA 4UZUA 4ACZB 3FAWA 4HPHA 2E9MA 3SSJA 3H2MA 1SW7A 4GC3A 4L1WA 1EQCA 3MHGA 3TP4A 3EOOA 3UJSA 4YJ5A 4GUJA 1S38A 4FP1A 3W87A 1UR0A 3G6MA 1HZYA 1OCJA 3CWOX 1GYMA 4PTMA 3CIWA 4JIQA 3OVQA 1X1ZA 4HK7A 1ZB5A 4MAZA 4RE4A 1XV8A 2E6DA 4CD4A 1I75A 4GA8A 3BSMA 6ENLA 3B8TA 3GH7A 4ZXLA 4KIEA 3A9BA 1GZGA 4H9UA 4EAYA 4WZHA 3GNDA 1TO3A 4XD5A 4C5ZA 4G7EB 4IP7A 5MF5A 3OG3A 1Q8AA 3TC7A 3QR3A 2GZXA 2E09A 2E8ZA 3H6OA 4NIRA 3GNRA 1ZY9A 4O54A 3R43A 4JYFA 5HBFA 1FFRA 1TFVA 1NJJA 2GQ9A 3NEHA 4W7WA 3UWWA 3LPPA 3UZZA 1JPDX 3SGZA 4FF7A 2NQ5A 3NO3A 3F4VA 1WOAA 2WZMA 3FYOA 3CO8A 3KOWA 1T41A 1DJZA 1R9XA 1ISZA 1K9EA 3IARA 1L6YA 5CAHA 3RPMA 2XIJA 4H04A 3LHWA 3AQUA 1UR1A 1WYIA 3AS1A 4YNGA 1VRXA 1H4PA 1Q6QA 3MDUA 3VE7A 1XCXA 4Q4SA 1AL8A 1OX4B 4JQ3A 4ZSTA 2GWNA 2PGEA 2GJXB 1VYRA 3NQ2A 3EWBX 3KVMA 3UERA 3VUSA 2OLSA 3KS6A 5CGQA 1OY0A 1XLLA 1L6GA 2IKGA 3GTNA 3UQNA 3LG3A 1HGWA 1TIMA 4LRTA 4UTMA 1X7IA 1NEYA 3S8HA 3IVSA 1ONWA 2JFEX 1WE5A 3UG8A 1OYAA 5HR7A 1XLAA 1MDLA 2PURA 1KV5A 3B8DA 4JBRA 4PSRA 4F8XA 1NDWA 3TSBA 5FESA 2QCFA 1JCTA 2QUMA 5H8UA 2FDSA 1Q3NA 4KRZA 3LYEA 1QW7A 2AL2B 3TEVA 4JL1A 3GUGA 4UTIA 4R27A 2VEGA 1J0KA 1SO6A 1NFPA 5A6JA 3VYLA 1J10A 4U3AA 4WVXA 1XXXA 5I77A 3TU9A 4FLRA 3GG1A 4AHOA 3L4WA 3CV7A 1EGVA 4LBUA 3AZTA 3OZMA 1EA9C 5G4WA 4UWMA 4UFMA 4QJ3B 3K1DA 4GXWA 3TSMA 2X0HA 3ONBA 2H9AA 1CPUA 1TSIA 1A5AA 2XN2A 5AC5A 1DWJM 1RBOB 3U4FA 2CEQA 2PGRA 3OBAA 1YMYA 3THDA 1E6RA 2Z25A 3JRKA 1JF6A 4B2DD 5DELA 3VNMA 1GQLA 1DJXA 5A6TC 4GY1A 2HSAA 2BY1A 3W82A 4BI5A 3L4ZA 2RAGA 4QS6A 1F07A 1LBFA 3UWEA 3WBYA 1VBHA 5CXPA 5I3FA 2WXDM 3N19B 3W88A 2GYIA 3DOPA 4DEFA 2W0UA 1MQQA 5T9CE 3CNYA 3QZ6A 2DW6A 3UR2A 3CH9A 3R13A 3UG5A 1RALA 4FNTA 2Y88A 3W2NA 4UMAA 3MP4A 2X40A 1AW2A 3EX6A 5DRCA 4V2XA 2BXZA 2AMGA 1RVKA 2PODA 1JZ4A 3JU2A 1Q13A 4PUUA 4B9YA 2FPYA 2Y5EA 3MUAA 4F40A 2JBMA 4URIA 1YDYA 4PEEA 3DFHA 4O8RA 4GIYA 2XTKA 1R46A 4JTHA 2EPNA 1CECA 4AZIA 2IS7A 3M9YA 4C6JA 4K39A 3TYZA 3LERA 3M1ZA 4WF7A 3NDYA 4JHZA 1FFQA 1VD6A 3M0IA 1P0EA 1MW0A 4EX4A 3TVAA 3LPGA 4MMWA 3S2NA 1IXPA 2JEQA 4XIAA 2YA2A 3AJXA 3CH0A 2V0TA 2WMKA 1FCUA 1HJSA 5EMMA 1KC7A 1XG3A 3GG7A 3QOMA 4MYAA 4TTGA 1V0KA 4AEFA 4I8DA 4JEQA 5K4ZA 5DBUA 4ZFMA 3GTXA 2P3EA 4REQA 3STEA 3TQPA 4UFLA 2F84A 3P74A 1MUCA 2VRQA 1K8CA 1ZBVA 4LALA 5JMUA 1S5TA 1NQKA 4I5RA 4JX6A 3ZR4A 4D1JA 1IEXA 1J01A 3VMNA 1BGAA 1D3GA 1Q66A 3PZUA 1XS2A 2W92A 4L1GA 3S6DA 3T7VA 3AMDA 1TE6A 4JQ1A 3GNPA 4FNUA 1FWNA 4GVGA 3N9SA 2A21A 3NYDA 3BAXA 2CLPA 5CZTA 4YTTA 3T42A 1PYMA 2Z29A 3PM6A 3WLLA 4XKYA 3WQDA 2VT0A 4JFVA 5LNRA 1C7SA 1TPVA 5FEXA 1QPRA 1FDYA 1QW9A 1K8ZA 3WUGA 1KCLA 1I2NA 2OQHA 3KM8A 3WQVA 1C8QA 2PGFA 2FHFA 4UFKA 1DJIA 3NFUA 3WYZA 4REQB 4A8RA 2FHCA 3RCNA 4CN4A 4OV4A 2HISA 1OD0A 2G3MA 3BCFA 3VILA 3C2OA 3HGSA 1EEXA 4C91A 1CXKA 1V7YA 1KM3A 1PEZA 2VGFA 2A7PA 3WK2A 3CT7A 4GYFA 4JEJA 4JKKA 1CLKA 4E38A 4H7ZA 4IFKA 4ALDA 1W2PA 1YTEA 2OELA 1FRBA 3MZNA 1X38A 3ZVIA 4XKYB 3GLCA 4G9PA 5BXPA 4YCPA 1HG3A 1VQTA 1L9WA 4GISA 2Z7KA 4TU1A 1ENUA 4YHEA 1CXEA 2FLIA 2VFEA 4G56A 4AUBA 2ACRA 4GABA 1EEPA 4GE8A 1YLVA 2DH2A 4X22A 2YLLA 1V51A 2XWDA 1X8CA 4S39A 4WLCA 3PK7A 2F2KA 4GUIA 1WXZA 2ZE0A 1BWVA 3MO7A 4WDUA 3CC1A 3OP2A 2VYOA 2AAAA 2DZWA 1JZ8A 1VLIA 1OIFA 2EEXA 1IHIA 5A1AA 3K4WA 4GQ0A 1S3HA 1I9CB 4F9DA 1K8YA 2IKIA 4IX0A 2J47A 1ESWA 2ZRUA 3AXMA 4GIRA 3B40A 1R3YA 3AHTA 4EXAA 3CQHA 2AQWA 4C7DA 2YXGA 1JVNA 3F5LA 2CHRA 3HOJA 2E9LA 4NXSA 3KOFA 1VIWA 4KEVA 3OTRA 5E9XA 1R38A 2XZ7A 5LYRA 2DUZA 4NNBA 4OE7A 2AKMA 1QNPA 2ZFAA 3LQGA 2VURA 2XM2A 1JGIA 3ZIZA 4M8UA 1FWDC 1OCQA 1ML1A 3S42A 1J8VA 2QXWA 1L8NA 1JPIA 3WNMA 4WX2A 2W5FA 2YXOA 3RITA 3S3GA 3I7RA 1OFPA 1XM3A