4GCQA

Crystal structure of e. coli ompf porin in complex with carbenicillin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
b'GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
total genus 98
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcqA00
2J1NA 5FVNA 1GFMA 2ODJA 4D65A 3VZWX 4LSFA 2FGRA 3JTYA 6PRNA 1MPFA 2XE5A 4KRAA 1GFNA 1OPFA 1BH3A 1OSMA 1HXTA 2XE2A 3SY9A 4FRTA 2O4VA 4KR4A 3SYBA 4FT6A 3UPGA 2J4UP 3VY8X 3HWBA 3K19A 4LSHA 4RJWA 3HW9A 5DL7A 2Y0KA 2ZLDA 1HXXA 4FSOA 2Y0LA 4JFBA 4GCSA 4LSEA 3SYSA 2Y0HA 5PRNA 4RJXA 3A2SX 4FMSA 1PRNA 3T0SA 3UU2A 4GCPA 4FRXA 3WI5A 2QTKA 3VZTX 3POUA 3NSGA 3PRNA 3SY7A 2PORA 5JDPA 3POXA 4C69X 4D64A 5DL8A 3PORA 3VY9X 2OMFA 4BUMX 4FSPA 3FYXA 3POQA 5DL5A 1GFOA 4AUIA 3O0EA 1BT9A 4FOZA 8PRNA 2XE1A 1GFPA 4KR8A 3SZDA 3SZVA 2PRNA 3T24A 3T20A 1H6S1 3WI4A 1PHOA 2XE3A 4GCQA 7PRNA 2ZFGA 4LSIA 2Y2XA 2K4TA 3EMNX 1E54A 3VZUX 2FGQX 5DL6A 4D5UA 1HXUA 1GFQA 2XG6A
chains in the Genus database with same CATH superfamily
1QJ8A 2J1NA 5D5DA 5FVNA 1GFMA 3DA4A 5AFUL 2ODJA 4D65A 5GTHO 3VZWX 4LSFA 3HOEA 1ZHXA 5E79O 3V8UA 4AFKA 2GE4A 2FGRA 3JTYA 6PRNA 3AA7B 4O3YA 1MPFA 2XE5A 5TISO 4KRAA 1S5LO 1GFNA 1OPFA 1BH3A 1OSMA 2X27X 1HXTA 2MNHA 2W81C 4K3CA 4O4UA 4C00A 2XE2A 5ADXL 3SY9A 5H2FO 2LHFA 3AA6A 2R4LA 4FRTA 3PGUA 2O4VA 4KR4A 1MM5A 3PQSA 2JQYA 3SYBA 3LK3B 3DZMA 4FT6A 3UPGA 1THQA 2KXPA 4XNLA 3UAQA 2J4UP 3PGRA 4N58A 3AAAB 3VY8X 1P4TA 5KAFO 3HWBA 3LK2B 3K19A 4LSHA 4B61A 1ZHYA 3QRCA 3HW9A 4RJWA 3PF1A 4FZLA 5G39A 2R4NA 2R4PA 3KVDD 5DL7A 4K3BA 2Y0KA 3PQUA 2ZLDA 4RLBA 4N74A 1HXXA 4FSOA 2Y0LA 2LFUA 4JFBA 3VE2A 2XTRA 4GCSA 4O3XB 5AFUK 1YS5A 4LSEA 3SYSA 2Y0HA 5PRNA 1G90A 4N75A 4RJXA 4CTDA 3A2SX 4UB8O 5GV0A 1QJPA 4FESA 4FMSA 1PRNA 4QQ1A 3T0SA 2F1TA 4AKRA 2Y7SA 3UU2A 3DA3A 4GCPA 2N2LA 1BXWA 2R88A 4AYDC 4G75A 4Z3TA 4O3ZA 3TZGA 2R89A 4FRXA 4AYMC 3PGSA 4C4VB 3WI5A 1IZNB 4O49A 3BRZA 2QTKA 3VZTX 3LK41 4G76A 5IYUA 4E1TA 4AYEC 3AAEB 3GP6A 5G3AA 3POUA 2IWWA 3NSGA 3QRAA 2X9KA 3DWNA 4F4BA 3LK42 3VE1A 3PRNA 4U9CA 3KZIO 4FUVA 3SY7A 3HOLA 2PORA 2M06A 3AA7A 5JDPA 4N59A 4GF4A 2R4OA 1Q9GA 3POXA 3WU2O 4C69X 2ERVA 3AA0B 4D64A 3C5OA 2KZ7B 5DL8A 3PORA 3VY9X 4O4XA 2N2MA 2OMFA 2F1VA 2JMMA 4BUMX 4FSPA 2WVPA 3FYXA 2R8AA 5G26A 2W80C 1ZHZA 4GHBA 4JCHA 3AA1B 3VZUX 3LK3A 4PR7A 3A0HO 1Q9FA 1IZNA 3POQA 5DL5A 4AKMA 3JCUO 1ZHTA 1GFOA 3AAAA 5B5EO 4AUIA 1MM4A 3LK2A 3AAEA 3O0EA 1BT9A 1T16A 2XTQA 5ADXK 4E1SA 1ZHWA 4FOZA 3BRYA 3DWOX 4RL9A 8PRNA 2XE1A 5GTIO 1GFPA 1QJ9A 2K0LA 4KR8A 4RLCA 4UB6O 3SZDA 2YPVA 3SZVA 2PRNA 2XMXA 1T1LA 3T24A 3T20A 1H6S1 4AZLA 3RBHA 3WI4A 5G38A 4O3WA 5KAIO 4FQEA 1PHOA 3AA0A 3A0BO 2XE3A 4FZMA 5EE2A 4FZNA 4GCQA 7PRNA 2KZ7A 2ZFGA 4AKRB 5B66O 4LSIA 4AYNA 2Y2XA 2KDYA 2K4TA 2MHLA 3EMNX 2WJRA 3AA6B 4PUXA 2IWVA 3AA1A 2F1CX 4AYID 1E54A 4PJ0O 1ORMA 3NJTA 2KC0A 3G7GA 2FGQX 3BS0A 2KXPB 2AXTO 4IL6O 4XNKA 5DL6A 1HXUA 4C4VA 5T5FA 4D5UA 1GFQA 2WJQA 2XG6A 2M07A 2YNKA
chains in the Genus database with same CATH topology
1QJ8A 2J1NA 5D5DA 5FVNA 1GFMA 3DA4A 5AFUL 2ODJA 4D65A 3VZWX 4LSFA 3HOEA 1ZHXA 3V8UA 4AFKA 2GE4A 2FGRA 3JTYA 6PRNA 3AA7B 4O3YA 1MPFA 2XE5A 4KRAA 1GFNA 1OPFA 1BH3A 1OSMA 2X27X 1HXTA 2MNHA 2W81C 4O4UA 2XE2A 5ADXL 3SY9A 2LHFA 3AA6A 4FRTA 2O4VA 4KR4A 1MM5A 3PQSA 3SYBA 3LK3B 4FT6A 3UPGA 1THQA 2KXPA 4XNLA 3UAQA 2J4UP 4N58A 3AAAB 3VY8X 1P4TA 3HWBA 3LK2B 3K19A 4LSHA 1ZHYA 3QRCA 3HW9A 4RJWA 4FZLA 3KVDD 5DL7A 2Y0KA 3PQUA 2ZLDA 4RLBA 1HXXA 4FSOA 2Y0LA 2LFUA 4JFBA 3VE2A 2XTRA 4GCSA 4O3XB 5AFUK 1YS5A 4LSEA 3SYSA 2Y0HA 5PRNA 1G90A 4RJXA 3A2SX 5GV0A 1QJPA 4FESA 4FMSA 1PRNA 4QQ1A 3T0SA 2F1TA 4AKRA 2Y7SA 3UU2A 3DA3A 4GCPA 2N2LA 1BXWA 4AYDC 4G75A 4Z3TA 4O3ZA 3TZGA 4FRXA 4AYMC 3WI5A 1IZNB 4O49A 2QTKA 3VZTX 3LK41 4G76A 5IYUA 4E1TA 4AYEC 3AAEB 3GP6A 3POUA 3NSGA 3QRAA 4F4BA 3LK42 3VE1A 3PRNA 4U9CA 4FUVA 3SY7A 3HOLA 2PORA 2M06A 3AA7A 5JDPA 4N59A 4GF4A 3POXA 1Q9GA 4C69X 2ERVA 3AA0B 4D64A 3C5OA 2KZ7B 5DL8A 3PORA 3VY9X 4O4XA 2N2MA 2OMFA 2F1VA 2JMMA 4BUMX 4FSPA 3FYXA 5G26A 2W80C 1ZHZA 4GHBA 4JCHA 3AA1B 3LK3A 3POQA 1Q9FA 1IZNA 5DL5A 4AKMA 1ZHTA 1GFOA 3AAAA 4AUIA 1MM4A 3LK2A 3AAEA 3O0EA 1BT9A 2XTQA 5ADXK 4E1SA 1ZHWA 4FOZA 4RL9A 8PRNA 2XE1A 1GFPA 1QJ9A 2K0LA 4KR8A 4RLCA 3SZDA 2YPVA 3SZVA 2PRNA 2XMXA 3T24A 3T20A 1H6S1 4AZLA 3RBHA 3WI4A 4O3WA 1PHOA 3AA0A 4FZMA 2XE3A 5EE2A 4FZNA 4GCQA 7PRNA 2KZ7A 2ZFGA 4AKRB 4LSIA 4AYNA 2Y2XA 2KDYA 2K4TA 2MHLA 3EMNX 3AA6B 4PUXA 3AA1A 4AYID 1E54A 4B61A 1ORMA 4XNKA 2KC0A 3G7GA 2FGQX 5DL6A 2KXPB 3VZUX 4D5UA 1HXUA 5T5FA 1GFQA 2XG6A 2M07A 2YNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1N A;  5FVN A;  1GFM A;  2ODJ A;  4D65 A;  3VZW X;  4LSF A;  2FGR A;  3JTY A;  6PRN A;  1MPF A;  2XE5 A;  4KRA A;  1GFN A;  1OPF A;  1BH3 A;  1OSM A;  1HXT A;  2XE2 A;  3SY9 A;  4FRT A;  2O4V A;  4KR4 A;  3SYB A;  4FT6 A;  3UPG A;  2J4U P;  3VY8 X;  3HWB A;  3K19 A;  4LSH A;  4RJW A;  3HW9 A;  5DL7 A;  2Y0K A;  2ZLD A;  1HXX A;  4FSO A;  2Y0L A;  4JFB A;  4GCS A;  4LSE A;  3SYS A;  2Y0H A;  5PRN A;  4RJX A;  3A2S X;  4FMS A;  1PRN A;  3T0S A;  3UU2 A;  4GCP A;  4FRX A;  3WI5 A;  2QTK A;  3VZT X;  3POU A;  3NSG A;  3PRN A;  3SY7 A;  2POR A;  5JDP A;  3POX A;  4C69 X;  4D64 A;  5DL8 A;  3POR A;  3VY9 X;  2OMF A;  4BUM X;  4FSP A;  3FYX A;  3POQ A;  5DL5 A;  1GFO A;  4AUI A;  3O0E A;  1BT9 A;  4FOZ A;  8PRN A;  2XE1 A;  1GFP A;  4KR8 A;  3SZD A;  3SZV A;  2PRN A;  3T24 A;  3T20 A;  1H6S 1;  3WI4 A;  1PHO A;  2XE3 A;  4GCQ A;  7PRN A;  2ZFG A;  4LSI A;  2Y2X A;  2K4T A;  3EMN X;  1E54 A;  3VZU X;  2FGQ X;  5DL6 A;  4D5U A;  1HXU A;  1GFQ A;  2XG6 A; 
#chains in the Genus database with same CATH topology
 1QJ8 A;  2J1N A;  5D5D A;  5FVN A;  1GFM A;  3DA4 A;  5AFU L;  2ODJ A;  4D65 A;  5GTH O;  3VZW X;  4LSF A;  3HOE A;  1ZHX A;  5E79 O;  3V8U A;  4AFK A;  2GE4 A;  2FGR A;  3JTY A;  6PRN A;  3AA7 B;  4O3Y A;  1MPF A;  2XE5 A;  5TIS O;  4KRA A;  1S5L O;  1GFN A;  1OPF A;  1BH3 A;  1OSM A;  2X27 X;  1HXT A;  2MNH A;  2W81 C;  4K3C A;  4O4U A;  4C00 A;  2XE2 A;  5ADX L;  3SY9 A;  5H2F O;  2LHF A;  3AA6 A;  2R4L A;  4FRT A;  3PGU A;  2O4V A;  4KR4 A;  1MM5 A;  3PQS A;  2JQY A;  3SYB A;  3LK3 B;  3DZM A;  4FT6 A;  3UPG A;  1THQ A;  2KXP A;  4XNL A;  3UAQ A;  2J4U P;  3PGR A;  4N58 A;  3AAA B;  3VY8 X;  1P4T A;  5KAF O;  3HWB A;  3LK2 B;  3K19 A;  4LSH A;  4B61 A;  1ZHY A;  3QRC A;  3HW9 A;  4RJW A;  3PF1 A;  4FZL A;  5G39 A;  2R4N A;  2R4P A;  3KVD D;  5DL7 A;  4K3B A;  2Y0K A;  3PQU A;  2ZLD A;  4RLB A;  4N74 A;  1HXX A;  4FSO A;  2Y0L A;  2LFU A;  4JFB A;  3VE2 A;  2XTR A;  4GCS A;  4O3X B;  5AFU K;  1YS5 A;  4LSE A;  3SYS A;  2Y0H A;  5PRN A;  1G90 A;  4N75 A;  4RJX A;  4CTD A;  3A2S X;  4UB8 O;  5GV0 A;  1QJP A;  4FES A;  4FMS A;  1PRN A;  4QQ1 A;  3T0S A;  2F1T A;  4AKR A;  2Y7S A;  3UU2 A;  3DA3 A;  4GCP A;  2N2L A;  1BXW A;  2R88 A;  4AYD C;  4G75 A;  4Z3T A;  4O3Z A;  3TZG A;  2R89 A;  4FRX A;  4AYM C;  3PGS A;  4C4V B;  3WI5 A;  1IZN B;  4O49 A;  3BRZ A;  2QTK A;  3VZT X;  3LK4 1;  4G76 A;  5IYU A;  4E1T A;  4AYE C;  3AAE B;  3GP6 A;  5G3A A;  3POU A;  2IWW A;  3NSG A;  3QRA A;  2X9K A;  3DWN A;  4F4B A;  3LK4 2;  3VE1 A;  3PRN A;  4U9C A;  3KZI O;  4FUV A;  3SY7 A;  3HOL A;  2POR A;  2M06 A;  3AA7 A;  5JDP A;  4N59 A;  4GF4 A;  2R4O A;  1Q9G A;  3POX A;  3WU2 O;  4C69 X;  2ERV A;  3AA0 B;  4D64 A;  3C5O A;  2KZ7 B;  5DL8 A;  3POR A;  3VY9 X;  4O4X A;  2N2M A;  2OMF A;  2F1V A;  2JMM A;  4BUM X;  4FSP A;  2WVP A;  3FYX A;  2R8A A;  5G26 A;  2W80 C;  1ZHZ A;  4GHB A;  4JCH A;  3AA1 B;  3VZU X;  3LK3 A;  4PR7 A;  3A0H O;  1Q9F A;  1IZN A;  3POQ A;  5DL5 A;  4AKM A;  3JCU O;  1ZHT A;  1GFO A;  3AAA A;  5B5E O;  4AUI A;  1MM4 A;  3LK2 A;  3AAE A;  3O0E A;  1BT9 A;  1T16 A;  2XTQ A;  5ADX K;  4E1S A;  1ZHW A;  4FOZ A;  3BRY A;  3DWO X;  4RL9 A;  8PRN A;  2XE1 A;  5GTI O;  1GFP A;  1QJ9 A;  2K0L A;  4KR8 A;  4RLC A;  4UB6 O;  3SZD A;  2YPV A;  3SZV A;  2PRN A;  2XMX A;  1T1L A;  3T24 A;  3T20 A;  1H6S 1;  4AZL A;  3RBH A;  3WI4 A;  5G38 A;  4O3W A;  5KAI O;  4FQE A;  1PHO A;  3AA0 A;  3A0B O;  2XE3 A;  4FZM A;  5EE2 A;  4FZN A;  4GCQ A;  7PRN A;  2KZ7 A;  2ZFG A;  4AKR B;  5B66 O;  4LSI A;  4AYN A;  2Y2X A;  2KDY A;  2K4T A;  2MHL A;  3EMN X;  2WJR A;  3AA6 B;  4PUX A;  2IWV A;  3AA1 A;  2F1C X;  4AYI D;  1E54 A;  4PJ0 O;  1ORM A;  3NJT A;  2KC0 A;  3G7G A;  2FGQ X;  3BS0 A;  2KXP B;  2AXT O;  4IL6 O;  4XNK A;  5DL6 A;  1HXU A;  4C4V A;  5T5F A;  4D5U A;  1GFQ A;  2WJQ A;  2XG6 A;  2M07 A;  2YNK A; 
#chains in the Genus database with same CATH homology
 1QJ8 A;  2J1N A;  5D5D A;  5FVN A;  1GFM A;  3DA4 A;  5AFU L;  2ODJ A;  4D65 A;  3VZW X;  4LSF A;  3HOE A;  1ZHX A;  3V8U A;  4AFK A;  2GE4 A;  2FGR A;  3JTY A;  6PRN A;  3AA7 B;  4O3Y A;  1MPF A;  2XE5 A;  4KRA A;  1GFN A;  1OPF A;  1BH3 A;  1OSM A;  2X27 X;  1HXT A;  2MNH A;  2W81 C;  4O4U A;  2XE2 A;  5ADX L;  3SY9 A;  2LHF A;  3AA6 A;  4FRT A;  2O4V A;  4KR4 A;  1MM5 A;  3PQS A;  3SYB A;  3LK3 B;  4FT6 A;  3UPG A;  1THQ A;  2KXP A;  4XNL A;  3UAQ A;  2J4U P;  4N58 A;  3AAA B;  3VY8 X;  1P4T A;  3HWB A;  3LK2 B;  3K19 A;  4LSH A;  1ZHY A;  3QRC A;  3HW9 A;  4RJW A;  4FZL A;  3KVD D;  5DL7 A;  2Y0K A;  3PQU A;  2ZLD A;  4RLB A;  1HXX A;  4FSO A;  2Y0L A;  2LFU A;  4JFB A;  3VE2 A;  2XTR A;  4GCS A;  4O3X B;  5AFU K;  1YS5 A;  4LSE A;  3SYS A;  2Y0H A;  5PRN A;  1G90 A;  4RJX A;  3A2S X;  5GV0 A;  1QJP A;  4FES A;  4FMS A;  1PRN A;  4QQ1 A;  3T0S A;  2F1T A;  4AKR A;  2Y7S A;  3UU2 A;  3DA3 A;  4GCP A;  2N2L A;  1BXW A;  4AYD C;  4G75 A;  4Z3T A;  4O3Z A;  3TZG A;  4FRX A;  4AYM C;  3WI5 A;  1IZN B;  4O49 A;  2QTK A;  3VZT X;  3LK4 1;  4G76 A;  5IYU A;  4E1T A;  4AYE C;  3AAE B;  3GP6 A;  3POU A;  3NSG A;  3QRA A;  4F4B A;  3LK4 2;  3VE1 A;  3PRN A;  4U9C A;  4FUV A;  3SY7 A;  3HOL A;  2POR A;  2M06 A;  3AA7 A;  5JDP A;  4N59 A;  4GF4 A;  3POX A;  1Q9G A;  4C69 X;  2ERV A;  3AA0 B;  4D64 A;  3C5O A;  2KZ7 B;  5DL8 A;  3POR A;  3VY9 X;  4O4X A;  2N2M A;  2OMF A;  2F1V A;  2JMM A;  4BUM X;  4FSP A;  3FYX A;  5G26 A;  2W80 C;  1ZHZ A;  4GHB A;  4JCH A;  3AA1 B;  3LK3 A;  3POQ A;  1Q9F A;  1IZN A;  5DL5 A;  4AKM A;  1ZHT A;  1GFO A;  3AAA A;  4AUI A;  1MM4 A;  3LK2 A;  3AAE A;  3O0E A;  1BT9 A;  2XTQ A;  5ADX K;  4E1S A;  1ZHW A;  4FOZ A;  4RL9 A;  8PRN A;  2XE1 A;  1GFP A;  1QJ9 A;  2K0L A;  4KR8 A;  4RLC A;  3SZD A;  2YPV A;  3SZV A;  2PRN A;  2XMX A;  3T24 A;  3T20 A;  1H6S 1;  4AZL A;  3RBH A;  3WI4 A;  4O3W A;  1PHO A;  3AA0 A;  4FZM A;  2XE3 A;  5EE2 A;  4FZN A;  4GCQ A;  7PRN A;  2KZ7 A;  2ZFG A;  4AKR B;  4LSI A;  4AYN A;  2Y2X A;  2KDY A;  2K4T A;  2MHL A;  3EMN X;  3AA6 B;  4PUX A;  3AA1 A;  4AYI D;  1E54 A;  4B61 A;  1ORM A;  4XNK A;  2KC0 A;  3G7G A;  2FGQ X;  5DL6 A;  2KXP B;  3VZU X;  4D5U A;  1HXU A;  5T5F A;  1GFQ A;  2XG6 A;  2M07 A;  2YNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...