4GCQA

Crystal structure of e. coli ompf porin in complex with carbenicillin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
molecule keywords Outer membrane protein F
total genus 98
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcqA00
4D65A 4FOZA 1GFPA 5PRNA 1MPFA 3VZWX 4KRAA 4BUMX 4GCPA 3WI4A 2J1NA 2ODJA 4RJXA 1H6S1 1GFMA 1BH3A 3PRNA 3HW9A 4LSHA 3SZVA 4C69X 1HXXA 2PORA 2Y0HA 2FGRA 3FYXA 2XE1A 2ZFGA 3SY9A 3SZDA 4D5UA 4FSPA 4GCQA 3T24A 2FGQX 3VZUX 3HWBA 4JFBA 3SY7A 2XE5A 4KR4A 1HXUA 5DL8A 3K19A 2XG6A 5DL7A 3EMNX 1BT9A 1GFOA 2K4TA 2Y0LA 3T20A 4LSFA 2O4VA 3POXA 2ZLDA 4LSIA 4FMSA 4RJWA 4D64A 3VY8X 4FRXA 4FSOA 3VZTX 1OSMA 3T0SA 3UPGA 3PORA 3UU2A 1E54A 3O0EA 3JTYA 6PRNA 7PRNA 2Y2XA 4LSEA 4GCSA 3POUA 1PRNA 5DL5A 1GFQA 1HXTA 2J4UP 1GFNA 5JDPA 5FVNA 3A2SX 1OPFA 4AUIA 3SYSA 2XE2A 3POQA 2XE3A 5DL6A 2OMFA 2PRNA 3SYBA 3WI5A 4FT6A 2QTKA 3VY9X 3NSGA 2Y0KA 4FRTA 1PHOA 8PRNA 4KR8A
chains in the Genus database with same CATH superfamily
2YNKA 2M06A 4AYEC 3A0HO 3PF1A 4D65A 4FOZA 4G75A 1GFPA 5PRNA 2MHLA 2F1TA 4O4UA 1MPFA 2W80C 3BRYA 4IL6O 4KRAA 2KZ7B 2K0LA 4K3BA 3VZWX 5GTHO 4BUMX 4AKRB 4GCPA 4O49A 2F1CX 2WJQA 2WVPA 3WI4A 4N58A 2XTQA 1THQA 3DA3A 4AYDC 3VE2A 2J1NA 2ODJA 3PGUA 5KAFO 5T5FA 3V8UA 4PJ0O 4RJXA 1H6S1 1GFMA 1BH3A 3PRNA 2LFUA 3PGRA 4N59A 4RLCA 3HW9A 4AZLA 5H2FO 4LSHA 2R89A 3AA6A 5G26A 3SZVA 4AYID 4AYNA 1HXXA 4C69X 4O3XB 2PORA 2FGRA 2Y0HA 4C4VB 3FYXA 2XE1A 4Z3TA 4FQEA 5GTIO 2KZ7A 2XMXA 4XNKA 4N75A 2R4OA 2ZFGA 3SY9A 3SZDA 4AKRA 1ZHYA 2AXTO 3KZIO 4XNLA 5ADXL 1ORMA 3C5OA 4FSPA 4D5UA 1Q9GA 3AA7B 4GCQA 3T24A 3VE1A 5B66O 2FGQX 2WJRA 3VZUX 5ADXK 3LK2A 1QJ9A 5KAIO 5G39A 2GE4A 3HWBA 2IWWA 3TZGA 3BRZA 4JFBA 1T16A 4RL9A 3GP6A 2XE5A 3DWOX 3SY7A 3AA6B 4KR4A 1HXUA 3QRCA 5DL8A 2Y7SA 3G7GA 3AAAB 4C4VA 1MM4A 3K19A 2XG6A 5DL7A 1ZHXA 3EMNX 4UB6O 1BT9A 4PR7A 1GFOA 1ZHTA 2K4TA 2N2LA 2Y0LA 3T20A 4RLBA 4LSFA 1YS5A 2O4VA 1Q9FA 2R8AA 2ZLDA 3POXA 4AKMA 4LSIA 1BXWA 4QQ1A 5E79O 2JMMA 3AA1B 4FMSA 1QJPA 3AA7A 2KC0A 1IZNB 2W81C 4O4XA 4RJWA 4D64A 4GF4A 3RBHA 3LK2B 3VY8X 3QRAA 4AFKA 4FRXA 1P4TA 4FZMA 4G76A 4FSOA 3A0BO 3VZTX 3PQUA 1OSMA 2XTRA 3T0SA 3UPGA 3HOLA 3PORA 2N2MA 3UU2A 2LHFA 1G90A 1E54A 2KDYA 3AAAA 1ZHZA 2JQYA 3O0EA 3UAQA 5IYUA 3JTYA 6PRNA 2F1VA 3HOEA 7PRNA 2Y2XA 4B61A 2X27X 3KVDD 4LSEA 4GCSA 3LK3B 3NJTA 3POUA 3LK42 1PRNA 1ZHWA 4E1SA 4E1TA 5DL5A 3JCUO 1GFQA 3AA1A 2ERVA 3AAEB 5G3AA 4K3CA 1IZNA 4N74A 2R4PA 4FZLA 1HXTA 2J4UP 2X9KA 1GFNA 3PGSA 3WU2O 2R88A 4O3WA 5JDPA 5EE2A 2KXPA 4FZNA 5AFUL 1MM5A 4PUXA 4O3YA 3AA0B 4JCHA 5FVNA 3A2SX 3BS0A 1OPFA 2MNHA 4AUIA 2YPVA 4F4BA 3PQSA 4GHBA 3SYSA 2XE2A 3DA4A 3POQA 2R4NA 5G38A 2XE3A 2M07A 5DL6A 2OMFA 3LK3A 5AFUK 2PRNA 4CTDA 4U9CA 2IWVA 3SYBA 1S5LO 2R4LA 3DZMA 4FT6A 3WI5A 3AAEA 4C00A 5TISO 2QTKA 3VY9X 4UB8O 3NSGA 4FESA 1QJ8A 2Y0KA 3DWNA 4AYMC 4FRTA 1PHOA 5D5DA 2KXPB 4O3ZA 8PRNA 5GV0A 1T1LA 4KR8A 4FUVA 3AA0A 3LK41 5B5EO
chains in the Genus database with same CATH topology
2YNKA 2M06A 4AYEC 4D65A 4FOZA 4G75A 1GFPA 5PRNA 2MHLA 2F1TA 4O4UA 1MPFA 2W80C 3VZWX 4KRAA 2KZ7B 2K0LA 4BUMX 4AKRB 4GCPA 4O49A 3WI4A 4N58A 2XTQA 1THQA 3DA3A 3VE2A 2J1NA 2ODJA 5T5FA 3V8UA 4RJXA 1H6S1 1GFMA 1BH3A 3PRNA 2LFUA 4N59A 4RLCA 4AZLA 3HW9A 4LSHA 3AA6A 4AYID 5G26A 3SZVA 4AYNA 4C69X 1HXXA 4O3XB 2PORA 2Y0HA 2FGRA 3FYXA 2XE1A 4Z3TA 2KZ7A 2XMXA 4XNKA 2ZFGA 3SY9A 3SZDA 4AKRA 1ZHYA 4XNLA 5ADXL 1ORMA 3C5OA 4FSPA 4D5UA 1Q9GA 3AA7B 4GCQA 3T24A 3VE1A 2FGQX 3VZUX 5ADXK 3LK2A 1QJ9A 2GE4A 3HWBA 3TZGA 4JFBA 3SY7A 4RL9A 3GP6A 2XE5A 3AA6B 4KR4A 1HXUA 3QRCA 5DL8A 2Y7SA 3G7GA 3AAAB 1MM4A 3K19A 2XG6A 5DL7A 1ZHXA 3EMNX 1BT9A 1GFOA 1ZHTA 2K4TA 2N2LA 2Y0LA 3T20A 4RLBA 4LSFA 1YS5A 2O4VA 1Q9FA 3POXA 2ZLDA 4AKMA 4AYDC 4LSIA 1BXWA 4QQ1A 2JMMA 3AA1B 4FMSA 1QJPA 3AA7A 2KC0A 1IZNB 2W81C 4O4XA 4RJWA 4D64A 4GF4A 3RBHA 3LK2B 3VY8X 3QRAA 4AFKA 4FRXA 1P4TA 4FZMA 4G76A 4FSOA 3VZTX 3PQUA 1OSMA 2XTRA 3T0SA 3UPGA 3HOLA 3PORA 2N2MA 3UU2A 2LHFA 1G90A 1E54A 2KDYA 3AAAA 1ZHZA 3O0EA 3UAQA 5IYUA 3JTYA 6PRNA 2F1VA 3HOEA 7PRNA 2Y2XA 4B61A 2X27X 3KVDD 4LSEA 4GCSA 3LK3B 3POUA 3LK42 1PRNA 1ZHWA 4E1SA 4E1TA 5DL5A 1GFQA 3AA1A 2ERVA 3AAEB 1IZNA 4FZLA 1HXTA 2J4UP 1GFNA 4O3WA 5JDPA 5EE2A 2KXPA 4FZNA 5AFUL 1MM5A 4PUXA 4O3YA 3AA0B 4JCHA 5FVNA 3A2SX 1OPFA 2MNHA 4AUIA 2YPVA 4F4BA 3PQSA 4GHBA 3SYSA 2XE2A 3DA4A 3POQA 2XE3A 2M07A 5DL6A 2OMFA 3LK3A 5AFUK 2PRNA 4U9CA 3SYBA 3WI5A 4FT6A 3AAEA 2QTKA 3VY9X 3NSGA 4FESA 1QJ8A 2Y0KA 4AYMC 4FRTA 1PHOA 5D5DA 2KXPB 4O3ZA 8PRNA 5GV0A 4KR8A 4FUVA 3AA0A 3LK41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D65 A;  4FOZ A;  1GFP A;  5PRN A;  1MPF A;  3VZW X;  4KRA A;  4BUM X;  4GCP A;  3WI4 A;  2J1N A;  2ODJ A;  4RJX A;  1H6S 1;  1GFM A;  1BH3 A;  3PRN A;  3HW9 A;  4LSH A;  3SZV A;  4C69 X;  1HXX A;  2POR A;  2Y0H A;  2FGR A;  3FYX A;  2XE1 A;  2ZFG A;  3SY9 A;  3SZD A;  4D5U A;  4FSP A;  4GCQ A;  3T24 A;  2FGQ X;  3VZU X;  3HWB A;  4JFB A;  3SY7 A;  2XE5 A;  4KR4 A;  1HXU A;  5DL8 A;  3K19 A;  2XG6 A;  5DL7 A;  3EMN X;  1BT9 A;  1GFO A;  2K4T A;  2Y0L A;  3T20 A;  4LSF A;  2O4V A;  3POX A;  2ZLD A;  4LSI A;  4FMS A;  4RJW A;  4D64 A;  3VY8 X;  4FRX A;  4FSO A;  3VZT X;  1OSM A;  3T0S A;  3UPG A;  3POR A;  3UU2 A;  1E54 A;  3O0E A;  3JTY A;  6PRN A;  7PRN A;  2Y2X A;  4LSE A;  4GCS A;  3POU A;  1PRN A;  5DL5 A;  1GFQ A;  1HXT A;  2J4U P;  1GFN A;  5JDP A;  5FVN A;  3A2S X;  1OPF A;  4AUI A;  3SYS A;  2XE2 A;  3POQ A;  2XE3 A;  5DL6 A;  2OMF A;  2PRN A;  3SYB A;  3WI5 A;  4FT6 A;  2QTK A;  3VY9 X;  3NSG A;  2Y0K A;  4FRT A;  1PHO A;  8PRN A;  4KR8 A; 
#chains in the Genus database with same CATH topology
 2YNK A;  2M06 A;  4AYE C;  3A0H O;  3PF1 A;  4D65 A;  4FOZ A;  4G75 A;  1GFP A;  5PRN A;  2MHL A;  2F1T A;  4O4U A;  1MPF A;  2W80 C;  3BRY A;  4IL6 O;  4KRA A;  2KZ7 B;  2K0L A;  4K3B A;  3VZW X;  5GTH O;  4BUM X;  4AKR B;  4GCP A;  4O49 A;  2F1C X;  2WJQ A;  2WVP A;  3WI4 A;  4N58 A;  2XTQ A;  1THQ A;  3DA3 A;  4AYD C;  3VE2 A;  2J1N A;  2ODJ A;  3PGU A;  5KAF O;  5T5F A;  3V8U A;  4PJ0 O;  4RJX A;  1H6S 1;  1GFM A;  1BH3 A;  3PRN A;  2LFU A;  3PGR A;  4N59 A;  4RLC A;  3HW9 A;  4AZL A;  5H2F O;  4LSH A;  2R89 A;  3AA6 A;  5G26 A;  3SZV A;  4AYI D;  4AYN A;  1HXX A;  4C69 X;  4O3X B;  2POR A;  2FGR A;  2Y0H A;  4C4V B;  3FYX A;  2XE1 A;  4Z3T A;  4FQE A;  5GTI O;  2KZ7 A;  2XMX A;  4XNK A;  4N75 A;  2R4O A;  2ZFG A;  3SY9 A;  3SZD A;  4AKR A;  1ZHY A;  2AXT O;  3KZI O;  4XNL A;  5ADX L;  1ORM A;  3C5O A;  4FSP A;  4D5U A;  1Q9G A;  3AA7 B;  4GCQ A;  3T24 A;  3VE1 A;  5B66 O;  2FGQ X;  2WJR A;  3VZU X;  5ADX K;  3LK2 A;  1QJ9 A;  5KAI O;  5G39 A;  2GE4 A;  3HWB A;  2IWW A;  3TZG A;  3BRZ A;  4JFB A;  1T16 A;  4RL9 A;  3GP6 A;  2XE5 A;  3DWO X;  3SY7 A;  3AA6 B;  4KR4 A;  1HXU A;  3QRC A;  5DL8 A;  2Y7S A;  3G7G A;  3AAA B;  4C4V A;  1MM4 A;  3K19 A;  2XG6 A;  5DL7 A;  1ZHX A;  3EMN X;  4UB6 O;  1BT9 A;  4PR7 A;  1GFO A;  1ZHT A;  2K4T A;  2N2L A;  2Y0L A;  3T20 A;  4RLB A;  4LSF A;  1YS5 A;  2O4V A;  1Q9F A;  2R8A A;  2ZLD A;  3POX A;  4AKM A;  4LSI A;  1BXW A;  4QQ1 A;  5E79 O;  2JMM A;  3AA1 B;  4FMS A;  1QJP A;  3AA7 A;  2KC0 A;  1IZN B;  2W81 C;  4O4X A;  4RJW A;  4D64 A;  4GF4 A;  3RBH A;  3LK2 B;  3VY8 X;  3QRA A;  4AFK A;  4FRX A;  1P4T A;  4FZM A;  4G76 A;  4FSO A;  3A0B O;  3VZT X;  3PQU A;  1OSM A;  2XTR A;  3T0S A;  3UPG A;  3HOL A;  3POR A;  2N2M A;  3UU2 A;  2LHF A;  1G90 A;  1E54 A;  2KDY A;  3AAA A;  1ZHZ A;  2JQY A;  3O0E A;  3UAQ A;  5IYU A;  3JTY A;  6PRN A;  2F1V A;  3HOE A;  7PRN A;  2Y2X A;  4B61 A;  2X27 X;  3KVD D;  4LSE A;  4GCS A;  3LK3 B;  3NJT A;  3POU A;  3LK4 2;  1PRN A;  1ZHW A;  4E1S A;  4E1T A;  5DL5 A;  3JCU O;  1GFQ A;  3AA1 A;  2ERV A;  3AAE B;  5G3A A;  4K3C A;  1IZN A;  4N74 A;  2R4P A;  4FZL A;  1HXT A;  2J4U P;  2X9K A;  1GFN A;  3PGS A;  3WU2 O;  2R88 A;  4O3W A;  5JDP A;  5EE2 A;  2KXP A;  4FZN A;  5AFU L;  1MM5 A;  4PUX A;  4O3Y A;  3AA0 B;  4JCH A;  5FVN A;  3A2S X;  3BS0 A;  1OPF A;  2MNH A;  4AUI A;  2YPV A;  4F4B A;  3PQS A;  4GHB A;  3SYS A;  2XE2 A;  3DA4 A;  3POQ A;  2R4N A;  5G38 A;  2XE3 A;  2M07 A;  5DL6 A;  2OMF A;  3LK3 A;  5AFU K;  2PRN A;  4CTD A;  4U9C A;  2IWV A;  3SYB A;  1S5L O;  2R4L A;  3DZM A;  4FT6 A;  3WI5 A;  3AAE A;  4C00 A;  5TIS O;  2QTK A;  3VY9 X;  4UB8 O;  3NSG A;  4FES A;  1QJ8 A;  2Y0K A;  3DWN A;  4AYM C;  4FRT A;  1PHO A;  5D5D A;  2KXP B;  4O3Z A;  8PRN A;  5GV0 A;  1T1L A;  4KR8 A;  4FUV A;  3AA0 A;  3LK4 1;  5B5E O; 
#chains in the Genus database with same CATH homology
 2YNK A;  2M06 A;  4AYE C;  4D65 A;  4FOZ A;  4G75 A;  1GFP A;  5PRN A;  2MHL A;  2F1T A;  4O4U A;  1MPF A;  2W80 C;  3VZW X;  4KRA A;  2KZ7 B;  2K0L A;  4BUM X;  4AKR B;  4GCP A;  4O49 A;  3WI4 A;  4N58 A;  2XTQ A;  1THQ A;  3DA3 A;  3VE2 A;  2J1N A;  2ODJ A;  5T5F A;  3V8U A;  4RJX A;  1H6S 1;  1GFM A;  1BH3 A;  3PRN A;  2LFU A;  4N59 A;  4RLC A;  4AZL A;  3HW9 A;  4LSH A;  3AA6 A;  4AYI D;  5G26 A;  3SZV A;  4AYN A;  4C69 X;  1HXX A;  4O3X B;  2POR A;  2Y0H A;  2FGR A;  3FYX A;  2XE1 A;  4Z3T A;  2KZ7 A;  2XMX A;  4XNK A;  2ZFG A;  3SY9 A;  3SZD A;  4AKR A;  1ZHY A;  4XNL A;  5ADX L;  1ORM A;  3C5O A;  4FSP A;  4D5U A;  1Q9G A;  3AA7 B;  4GCQ A;  3T24 A;  3VE1 A;  2FGQ X;  3VZU X;  5ADX K;  3LK2 A;  1QJ9 A;  2GE4 A;  3HWB A;  3TZG A;  4JFB A;  3SY7 A;  4RL9 A;  3GP6 A;  2XE5 A;  3AA6 B;  4KR4 A;  1HXU A;  3QRC A;  5DL8 A;  2Y7S A;  3G7G A;  3AAA B;  1MM4 A;  3K19 A;  2XG6 A;  5DL7 A;  1ZHX A;  3EMN X;  1BT9 A;  1GFO A;  1ZHT A;  2K4T A;  2N2L A;  2Y0L A;  3T20 A;  4RLB A;  4LSF A;  1YS5 A;  2O4V A;  1Q9F A;  3POX A;  2ZLD A;  4AKM A;  4AYD C;  4LSI A;  1BXW A;  4QQ1 A;  2JMM A;  3AA1 B;  4FMS A;  1QJP A;  3AA7 A;  2KC0 A;  1IZN B;  2W81 C;  4O4X A;  4RJW A;  4D64 A;  4GF4 A;  3RBH A;  3LK2 B;  3VY8 X;  3QRA A;  4AFK A;  4FRX A;  1P4T A;  4FZM A;  4G76 A;  4FSO A;  3VZT X;  3PQU A;  1OSM A;  2XTR A;  3T0S A;  3UPG A;  3HOL A;  3POR A;  2N2M A;  3UU2 A;  2LHF A;  1G90 A;  1E54 A;  2KDY A;  3AAA A;  1ZHZ A;  3O0E A;  3UAQ A;  5IYU A;  3JTY A;  6PRN A;  2F1V A;  3HOE A;  7PRN A;  2Y2X A;  4B61 A;  2X27 X;  3KVD D;  4LSE A;  4GCS A;  3LK3 B;  3POU A;  3LK4 2;  1PRN A;  1ZHW A;  4E1S A;  4E1T A;  5DL5 A;  1GFQ A;  3AA1 A;  2ERV A;  3AAE B;  1IZN A;  4FZL A;  1HXT A;  2J4U P;  1GFN A;  4O3W A;  5JDP A;  5EE2 A;  2KXP A;  4FZN A;  5AFU L;  1MM5 A;  4PUX A;  4O3Y A;  3AA0 B;  4JCH A;  5FVN A;  3A2S X;  1OPF A;  2MNH A;  4AUI A;  2YPV A;  4F4B A;  3PQS A;  4GHB A;  3SYS A;  2XE2 A;  3DA4 A;  3POQ A;  2XE3 A;  2M07 A;  5DL6 A;  2OMF A;  3LK3 A;  5AFU K;  2PRN A;  4U9C A;  3SYB A;  3WI5 A;  4FT6 A;  3AAE A;  2QTK A;  3VY9 X;  3NSG A;  4FES A;  1QJ8 A;  2Y0K A;  4AYM C;  4FRT A;  1PHO A;  5D5D A;  2KXP B;  4O3Z A;  8PRN A;  5GV0 A;  4KR8 A;  4FUV A;  3AA0 A;  3LK4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...