4GCQA

Crystal structure of e. coli ompf porin in complex with carbenicillin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
total genus 98
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcqA00
2Y0KA 5PRNA 2ODJA 1PHOA 3T0SA 1GFNA 4FMSA 3PRNA 3T20A 1E54A 1HXTA 4D64A 2J4UP 1H6S1 4GCSA 3O0EA 4FSPA 1PRNA 2ZFGA 5DL6A 3PORA 2Y0LA 5DL5A 3SY7A 1GFQA 4LSHA 1MPFA 5DL8A 5DL7A 4FT6A 4FSOA 2Y0HA 2PORA 2FGRA 1OPFA 3VZUX 3UU2A 4LSEA 3WI4A 4FRTA 2ZLDA 3VZWX 4KR8A 2O4VA 2XE5A 3VZTX 3SY9A 3FYXA 3POUA 2XE3A 3POQA 2OMFA 2J1NA 1GFPA 3VY9X 2K4TA 2PRNA 3SZVA 4FOZA 2XG6A 1BH3A 4RJWA 2QTKA 4GCQA 3JTYA 2XE2A 1GFOA 4LSFA 3SZDA 4KR4A 4AUIA 3A2SX 4GCPA 3VY8X 4FRXA 4D65A 3EMNX 4D5UA 2XE1A 7PRNA 3K19A 3T24A 4KRAA 3NSGA 3UPGA 6PRNA 2FGQX 3SYBA 3WI5A 3POXA 1BT9A 1OSMA 2Y2XA 4RJXA 4JFBA 3SYSA 1HXXA 4LSIA 5JDPA 4BUMX 3HW9A 5FVNA 1GFMA 1HXUA 8PRNA 3HWBA 4C69X
chains in the Genus database with same CATH superfamily
4FZMA 4UB8O 2Y0KA 2XTRA 4F4BA 2R4NA 5TISO 5PRNA 2F1CX 1PHOA 1BXWA 2ODJA 3T0SA 3QRCA 3VE2A 2F1VA 2IWVA 2M07A 5AFUK 4O4XA 1Q9FA 1GFNA 4FMSA 2KC0A 4GHBA 1ZHTA 3PRNA 5ADXK 1E54A 4B61A 4JCHA 3T20A 1HXTA 3AAAB 4GF4A 4D64A 4N58A 2J4UP 1H6S1 4GCSA 5G3AA 2JQYA 4O3ZA 3O0EA 4FSPA 3AAAA 1PRNA 1G90A 2ZFGA 3JCUO 3AA7B 4UB6O 3HOLA 5E79O 5DL6A 5AFUL 2Y7SA 3PORA 5B5EO 2Y0LA 2N2LA 3PGSA 3HOEA 1QJ9A 4K3CA 5DL5A 3AA7A 4XNKA 3SY7A 3PF1A 1GFQA 3PGUA 1MM4A 2R8AA 5GTIO 4LSHA 5G26A 3AAEA 2ERVA 4AYDC 1MPFA 4FZLA 4E1TA 3WU2O 5DL8A 8PRNA 4AYEC 1Q9GA 5DL7A 4FT6A 2MHLA 4FSOA 2Y0HA 2PORA 3PQSA 3LK41 2FGRA 1OPFA 4G75A 3LK42 1S5LO 2LHFA 3VZUX 3VE1A 2WJQA 1P4TA 3UU2A 3PGRA 1ZHXA 3KVDD 4FRTA 4IL6O 4FQEA 4LSEA 3WI4A 4C00A 2ZLDA 4C4VB 3VZWX 4KR8A 2X27X 2JMMA 2XTQA 4N59A 5KAIO 3LK2B 4AKMA 2YPVA 2O4VA 2XE5A 3KZIO 3VZTX 5H2FO 4N75A 3G7GA 3A0BO 3FYXA 3SY9A 4C4VA 1ZHWA 3POUA 2XE3A 3LK2A 3POQA 5JDPA 4U9CA 4PJ0O 3PQUA 3UAQA 2OMFA 3DZMA 3A0HO 2J1NA 1GFPA 4FUVA 4QQ1A 3VY9X 3AA0B 2K4TA 2K0LA 2PRNA 5GTHO 2MNHA 3SZVA 4FOZA 2N2MA 2XG6A 3DWOX 1QJPA 3DA3A 4AKRB 1BH3A 1THQA 2R89A 3AA0A 4RJWA 2R4LA 4O3WA 2QTKA 2R88A 3BS0A 4AKRA 3DWNA 2M06A 3C5OA 4GCQA 5GV0A 1ORMA 3JTYA 2F1TA 4G76A 2KXPB 3BRYA 4O4UA 4Z3TA 2XE2A 4AYID 4FZNA 2W81C 3DA4A 1GFOA 4RLCA 4AYNA 1T16A 2KXPA 2R4OA 4LSFA 3GP6A 4KR4A 3SZDA 4AUIA 3A2SX 4O3XB 4GCPA 3RBHA 3VY8X 3LK3B 4FRXA 2XMXA 5G38A 4CTDA 3NJTA 3AA1B 4D65A 1MM5A 4FESA 3EMNX 4D5UA 2GE4A 2XE1A 3LK3A 7PRNA 4RLBA 1T1LA 3K19A 4RL9A 5IYUA 3AA1A 4AYMC 5KAFO 2YNKA 3AA6B 3T24A 4KRAA 3NSGA 4K3BA 2KZ7B 2IWWA 2R4PA 6PRNA 2FGQX 3UPGA 4O3YA 2WJRA 3AA6A 3SYBA 2AXTO 3WI5A 3POXA 1BT9A 1IZNB 1OSMA 2KZ7A 2Y2XA 4AFKA 4AZLA 2LFUA 1ZHZA 4O49A 1YS5A 2KDYA 2X9KA 4N74A 1IZNA 4RJXA 3V8UA 4JFBA 5B66O 5D5DA 3SYSA 1HXXA 1QJ8A 4LSIA 4PR7A 4BUMX 1ZHYA 3HW9A 5FVNA 2WVPA 4E1SA 1GFMA 3BRZA 5G39A 3AAEB 4XNLA 4PUXA 5ADXL 2W80C 5T5FA 3QRAA 3TZGA 1HXUA 5EE2A 3HWBA 4C69X
chains in the Genus database with same CATH topology
4FZMA 2Y0KA 2XTRA 4F4BA 5PRNA 2ODJA 1PHOA 1BXWA 3T0SA 3QRCA 3VE2A 2F1VA 2M07A 5AFUK 4O4XA 1Q9FA 1GFNA 4FMSA 2KC0A 4GHBA 1ZHTA 3PRNA 5ADXK 1E54A 4B61A 4JCHA 3T20A 1HXTA 3AAAB 4GF4A 4D64A 4N58A 2J4UP 1H6S1 4GCSA 4O3ZA 3O0EA 4FSPA 3AAAA 1PRNA 1G90A 2ZFGA 3AA7B 3HOLA 5DL6A 5AFUL 2Y7SA 3PORA 2Y0LA 2N2LA 3HOEA 1QJ9A 5DL5A 3AA7A 4XNKA 3SY7A 1GFQA 1MM4A 4LSHA 5G26A 3AAEA 2ERVA 4AYDC 1MPFA 4FZLA 4E1TA 5DL8A 8PRNA 4AYEC 1Q9GA 5DL7A 4FT6A 2MHLA 4FSOA 2Y0HA 2PORA 3PQSA 3LK41 2FGRA 1OPFA 4G75A 3LK42 2LHFA 3VZUX 3VE1A 1P4TA 3UU2A 1ZHXA 3KVDD 4FRTA 4LSEA 3WI4A 2ZLDA 3VZWX 4KR8A 2X27X 2JMMA 2XTQA 4N59A 3LK2B 4AKMA 2YPVA 2O4VA 2XE5A 3VZTX 3G7GA 3SY9A 3FYXA 1ZHWA 3POUA 2XE3A 3LK2A 3POQA 4U9CA 3UAQA 3PQUA 2OMFA 4FUVA 2J1NA 1GFPA 4QQ1A 3VY9X 3AA0B 2K4TA 2K0LA 2PRNA 2MNHA 3SZVA 4FOZA 2N2MA 2XG6A 1QJPA 3DA3A 4AKRB 1BH3A 1THQA 3AA0A 4RJWA 4O3WA 2QTKA 4AKRA 2M06A 3C5OA 4GCQA 5GV0A 1ORMA 3JTYA 2F1TA 4G76A 2KXPB 4O4UA 4Z3TA 2XE2A 4AYID 4FZNA 2W81C 3DA4A 1GFOA 4RLCA 4AYNA 2KXPA 4LSFA 3GP6A 4KR4A 3SZDA 4AUIA 3A2SX 4O3XB 4GCPA 3RBHA 3VY8X 3LK3B 4FRXA 2XMXA 3AA1B 4D65A 1MM5A 4FESA 3EMNX 4D5UA 2GE4A 2XE1A 3LK3A 7PRNA 4RLBA 3K19A 4RL9A 5IYUA 3AA1A 4AYMC 2YNKA 3AA6B 3T24A 4KRAA 3NSGA 2KZ7B 3UPGA 6PRNA 2FGQX 4O3YA 3AA6A 3SYBA 3WI5A 3POXA 1BT9A 1IZNB 1OSMA 2KZ7A 2Y2XA 4AFKA 4AZLA 2LFUA 1ZHZA 4O49A 1YS5A 2KDYA 1IZNA 4RJXA 3V8UA 4JFBA 5D5DA 3SYSA 1HXXA 1QJ8A 4LSIA 4E1SA 4BUMX 1ZHYA 3HW9A 5FVNA 5JDPA 1GFMA 3AAEB 4XNLA 4PUXA 5ADXL 2W80C 5T5FA 3QRAA 3TZGA 1HXUA 5EE2A 3HWBA 4C69X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0K A;  5PRN A;  2ODJ A;  1PHO A;  3T0S A;  1GFN A;  4FMS A;  3PRN A;  3T20 A;  1E54 A;  1HXT A;  4D64 A;  2J4U P;  1H6S 1;  4GCS A;  3O0E A;  4FSP A;  1PRN A;  2ZFG A;  5DL6 A;  3POR A;  2Y0L A;  5DL5 A;  3SY7 A;  1GFQ A;  4LSH A;  1MPF A;  5DL8 A;  5DL7 A;  4FT6 A;  4FSO A;  2Y0H A;  2POR A;  2FGR A;  1OPF A;  3VZU X;  3UU2 A;  4LSE A;  3WI4 A;  4FRT A;  2ZLD A;  3VZW X;  4KR8 A;  2O4V A;  2XE5 A;  3VZT X;  3SY9 A;  3FYX A;  3POU A;  2XE3 A;  3POQ A;  2OMF A;  2J1N A;  1GFP A;  3VY9 X;  2K4T A;  2PRN A;  3SZV A;  4FOZ A;  2XG6 A;  1BH3 A;  4RJW A;  2QTK A;  4GCQ A;  3JTY A;  2XE2 A;  1GFO A;  4LSF A;  3SZD A;  4KR4 A;  4AUI A;  3A2S X;  4GCP A;  3VY8 X;  4FRX A;  4D65 A;  3EMN X;  4D5U A;  2XE1 A;  7PRN A;  3K19 A;  3T24 A;  4KRA A;  3NSG A;  3UPG A;  6PRN A;  2FGQ X;  3SYB A;  3WI5 A;  3POX A;  1BT9 A;  1OSM A;  2Y2X A;  4RJX A;  4JFB A;  3SYS A;  1HXX A;  4LSI A;  5JDP A;  4BUM X;  3HW9 A;  5FVN A;  1GFM A;  1HXU A;  8PRN A;  3HWB A;  4C69 X; 
#chains in the Genus database with same CATH topology
 4FZM A;  4UB8 O;  2Y0K A;  2XTR A;  4F4B A;  2R4N A;  5TIS O;  5PRN A;  2F1C X;  1PHO A;  1BXW A;  2ODJ A;  3T0S A;  3QRC A;  3VE2 A;  2F1V A;  2IWV A;  2M07 A;  5AFU K;  4O4X A;  1Q9F A;  1GFN A;  4FMS A;  2KC0 A;  4GHB A;  1ZHT A;  3PRN A;  5ADX K;  1E54 A;  4B61 A;  4JCH A;  3T20 A;  1HXT A;  3AAA B;  4GF4 A;  4D64 A;  4N58 A;  2J4U P;  1H6S 1;  4GCS A;  5G3A A;  2JQY A;  4O3Z A;  3O0E A;  4FSP A;  3AAA A;  1PRN A;  1G90 A;  2ZFG A;  3JCU O;  3AA7 B;  4UB6 O;  3HOL A;  5E79 O;  5DL6 A;  5AFU L;  2Y7S A;  3POR A;  5B5E O;  2Y0L A;  2N2L A;  3PGS A;  3HOE A;  1QJ9 A;  4K3C A;  5DL5 A;  3AA7 A;  4XNK A;  3SY7 A;  3PF1 A;  1GFQ A;  3PGU A;  1MM4 A;  2R8A A;  5GTI O;  4LSH A;  5G26 A;  3AAE A;  2ERV A;  4AYD C;  1MPF A;  4FZL A;  4E1T A;  3WU2 O;  5DL8 A;  8PRN A;  4AYE C;  1Q9G A;  5DL7 A;  4FT6 A;  2MHL A;  4FSO A;  2Y0H A;  2POR A;  3PQS A;  3LK4 1;  2FGR A;  1OPF A;  4G75 A;  3LK4 2;  1S5L O;  2LHF A;  3VZU X;  3VE1 A;  2WJQ A;  1P4T A;  3UU2 A;  3PGR A;  1ZHX A;  3KVD D;  4FRT A;  4IL6 O;  4FQE A;  4LSE A;  3WI4 A;  4C00 A;  2ZLD A;  4C4V B;  3VZW X;  4KR8 A;  2X27 X;  2JMM A;  2XTQ A;  4N59 A;  5KAI O;  3LK2 B;  4AKM A;  2YPV A;  2O4V A;  2XE5 A;  3KZI O;  3VZT X;  5H2F O;  4N75 A;  3G7G A;  3A0B O;  3FYX A;  3SY9 A;  4C4V A;  1ZHW A;  3POU A;  2XE3 A;  3LK2 A;  3POQ A;  5JDP A;  4U9C A;  4PJ0 O;  3PQU A;  3UAQ A;  2OMF A;  3DZM A;  3A0H O;  2J1N A;  1GFP A;  4FUV A;  4QQ1 A;  3VY9 X;  3AA0 B;  2K4T A;  2K0L A;  2PRN A;  5GTH O;  2MNH A;  3SZV A;  4FOZ A;  2N2M A;  2XG6 A;  3DWO X;  1QJP A;  3DA3 A;  4AKR B;  1BH3 A;  1THQ A;  2R89 A;  3AA0 A;  4RJW A;  2R4L A;  4O3W A;  2QTK A;  2R88 A;  3BS0 A;  4AKR A;  3DWN A;  2M06 A;  3C5O A;  4GCQ A;  5GV0 A;  1ORM A;  3JTY A;  2F1T A;  4G76 A;  2KXP B;  3BRY A;  4O4U A;  4Z3T A;  2XE2 A;  4AYI D;  4FZN A;  2W81 C;  3DA4 A;  1GFO A;  4RLC A;  4AYN A;  1T16 A;  2KXP A;  2R4O A;  4LSF A;  3GP6 A;  4KR4 A;  3SZD A;  4AUI A;  3A2S X;  4O3X B;  4GCP A;  3RBH A;  3VY8 X;  3LK3 B;  4FRX A;  2XMX A;  5G38 A;  4CTD A;  3NJT A;  3AA1 B;  4D65 A;  1MM5 A;  4FES A;  3EMN X;  4D5U A;  2GE4 A;  2XE1 A;  3LK3 A;  7PRN A;  4RLB A;  1T1L A;  3K19 A;  4RL9 A;  5IYU A;  3AA1 A;  4AYM C;  5KAF O;  2YNK A;  3AA6 B;  3T24 A;  4KRA A;  3NSG A;  4K3B A;  2KZ7 B;  2IWW A;  2R4P A;  6PRN A;  2FGQ X;  3UPG A;  4O3Y A;  2WJR A;  3AA6 A;  3SYB A;  2AXT O;  3WI5 A;  3POX A;  1BT9 A;  1IZN B;  1OSM A;  2KZ7 A;  2Y2X A;  4AFK A;  4AZL A;  2LFU A;  1ZHZ A;  4O49 A;  1YS5 A;  2KDY A;  2X9K A;  4N74 A;  1IZN A;  4RJX A;  3V8U A;  4JFB A;  5B66 O;  5D5D A;  3SYS A;  1HXX A;  1QJ8 A;  4LSI A;  4PR7 A;  4BUM X;  1ZHY A;  3HW9 A;  5FVN A;  2WVP A;  4E1S A;  1GFM A;  3BRZ A;  5G39 A;  3AAE B;  4XNL A;  4PUX A;  5ADX L;  2W80 C;  5T5F A;  3QRA A;  3TZG A;  1HXU A;  5EE2 A;  3HWB A;  4C69 X; 
#chains in the Genus database with same CATH homology
 4FZM A;  2Y0K A;  2XTR A;  4F4B A;  5PRN A;  2ODJ A;  1PHO A;  1BXW A;  3T0S A;  3QRC A;  3VE2 A;  2F1V A;  2M07 A;  5AFU K;  4O4X A;  1Q9F A;  1GFN A;  4FMS A;  2KC0 A;  4GHB A;  1ZHT A;  3PRN A;  5ADX K;  1E54 A;  4B61 A;  4JCH A;  3T20 A;  1HXT A;  3AAA B;  4GF4 A;  4D64 A;  4N58 A;  2J4U P;  1H6S 1;  4GCS A;  4O3Z A;  3O0E A;  4FSP A;  3AAA A;  1PRN A;  1G90 A;  2ZFG A;  3AA7 B;  3HOL A;  5DL6 A;  5AFU L;  2Y7S A;  3POR A;  2Y0L A;  2N2L A;  3HOE A;  1QJ9 A;  5DL5 A;  3AA7 A;  4XNK A;  3SY7 A;  1GFQ A;  1MM4 A;  4LSH A;  5G26 A;  3AAE A;  2ERV A;  4AYD C;  1MPF A;  4FZL A;  4E1T A;  5DL8 A;  8PRN A;  4AYE C;  1Q9G A;  5DL7 A;  4FT6 A;  2MHL A;  4FSO A;  2Y0H A;  2POR A;  3PQS A;  3LK4 1;  2FGR A;  1OPF A;  4G75 A;  3LK4 2;  2LHF A;  3VZU X;  3VE1 A;  1P4T A;  3UU2 A;  1ZHX A;  3KVD D;  4FRT A;  4LSE A;  3WI4 A;  2ZLD A;  3VZW X;  4KR8 A;  2X27 X;  2JMM A;  2XTQ A;  4N59 A;  3LK2 B;  4AKM A;  2YPV A;  2O4V A;  2XE5 A;  3VZT X;  3G7G A;  3SY9 A;  3FYX A;  1ZHW A;  3POU A;  2XE3 A;  3LK2 A;  3POQ A;  4U9C A;  3UAQ A;  3PQU A;  2OMF A;  4FUV A;  2J1N A;  1GFP A;  4QQ1 A;  3VY9 X;  3AA0 B;  2K4T A;  2K0L A;  2PRN A;  2MNH A;  3SZV A;  4FOZ A;  2N2M A;  2XG6 A;  1QJP A;  3DA3 A;  4AKR B;  1BH3 A;  1THQ A;  3AA0 A;  4RJW A;  4O3W A;  2QTK A;  4AKR A;  2M06 A;  3C5O A;  4GCQ A;  5GV0 A;  1ORM A;  3JTY A;  2F1T A;  4G76 A;  2KXP B;  4O4U A;  4Z3T A;  2XE2 A;  4AYI D;  4FZN A;  2W81 C;  3DA4 A;  1GFO A;  4RLC A;  4AYN A;  2KXP A;  4LSF A;  3GP6 A;  4KR4 A;  3SZD A;  4AUI A;  3A2S X;  4O3X B;  4GCP A;  3RBH A;  3VY8 X;  3LK3 B;  4FRX A;  2XMX A;  3AA1 B;  4D65 A;  1MM5 A;  4FES A;  3EMN X;  4D5U A;  2GE4 A;  2XE1 A;  3LK3 A;  7PRN A;  4RLB A;  3K19 A;  4RL9 A;  5IYU A;  3AA1 A;  4AYM C;  2YNK A;  3AA6 B;  3T24 A;  4KRA A;  3NSG A;  2KZ7 B;  3UPG A;  6PRN A;  2FGQ X;  4O3Y A;  3AA6 A;  3SYB A;  3WI5 A;  3POX A;  1BT9 A;  1IZN B;  1OSM A;  2KZ7 A;  2Y2X A;  4AFK A;  4AZL A;  2LFU A;  1ZHZ A;  4O49 A;  1YS5 A;  2KDY A;  1IZN A;  4RJX A;  3V8U A;  4JFB A;  5D5D A;  3SYS A;  1HXX A;  1QJ8 A;  4LSI A;  4E1S A;  4BUM X;  1ZHY A;  3HW9 A;  5FVN A;  5JDP A;  1GFM A;  3AAE B;  4XNL A;  4PUX A;  5ADX L;  2W80 C;  5T5F A;  3QRA A;  3TZG A;  1HXU A;  5EE2 A;  3HWB A;  4C69 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...