4GCQA

Crystal structure of e. coli ompf porin in complex with carbenicillin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
molecule keywords Outer membrane protein F
total genus 98
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcqA00
4KRAA 4FRXA 3POUA 3WI4A 2FGRA 3UU2A 2XG6A 1OSMA 4FSPA 3SY7A 5JDPA 4FSOA 8PRNA 2K4TA 5PRNA 2OMFA 3SY9A 3WI5A 1BT9A 4FMSA 3VZUX 4LSIA 3SZDA 2ZLDA 4D5UA 4D64A 1HXUA 2PRNA 4RJXA 2J1NA 4KR8A 2XE1A 3POQA 3VZTX 3POXA 4AUIA 5DL5A 2J4UP 1GFMA 3VY9X 2PORA 5DL7A 2Y2XA 2Y0LA 1BH3A 1GFPA 4FT6A 3HWBA 3K19A 2XE3A 5DL8A 4GCQA 1MPFA 3NSGA 3VY8X 3JTYA 3SYBA 3SZVA 4D65A 1GFNA 3FYXA 1H6S1 3HW9A 3VZWX 6PRNA 1PRNA 2ZFGA 4RJWA 3EMNX 3O0EA 3T0SA 2Y0HA 2XE2A 4JFBA 2Y0KA 2FGQX 3PRNA 1GFQA 3A2SX 3T24A 7PRNA 1OPFA 3PORA 4GCSA 1E54A 1HXTA 4KR4A 1PHOA 2ODJA 1HXXA 4LSEA 2O4VA 4LSHA 5DL6A 4FOZA 3UPGA 4C69X 4BUMX 2XE5A 3SYSA 4GCPA 3T20A 2QTKA 1GFOA 4LSFA 5FVNA 4FRTA
chains in the Genus database with same CATH superfamily
3LK41 4XNLA 4KRAA 4FZLA 4RL9A 4E1TA 5G38A 3PGSA 2GE4A 3QRAA 4FRXA 3RBHA 2YPVA 3GP6A 4O3YA 3PQUA 3POUA 2W80C 2KZ7A 4UB8O 4N74A 2M07A 2N2LA 5G3AA 3WI4A 2FGRA 2F1VA 2XTQA 3UU2A 4C00A 2XG6A 1OSMA 5D5DA 4FSPA 1ZHZA 3SY7A 5JDPA 4FSOA 8PRNA 4AYNA 2M06A 4K3CA 2K4TA 5KAIO 5PRNA 2XMXA 1IZNB 4AYMC 2OMFA 3VE2A 3LK42 5EE2A 2R4OA 4AKRA 4XNKA 3AAEB 4N75A 3SY9A 3VE1A 2X27X 5AFUL 3A0BO 3LK3B 4C4VB 5E79O 3WI5A 3AA6A 1BT9A 3AA1B 4FMSA 4UB6O 3V8UA 3VZUX 4PR7A 2F1TA 4JCHA 4LSIA 1ORMA 3SZDA 2ZLDA 4D5UA 4AYDC 4QQ1A 1P4TA 5B66O 4FRTA 2ERVA 4D64A 1HXUA 2PRNA 4FZNA 3HOLA 4RJXA 2J1NA 4F4BA 4KR8A 5GTHO 2XE1A 3POQA 3VZTX 1MM5A 1S5LO 2WJQA 3POXA 4AUIA 3PGRA 5DL5A 2MNHA 3LK3A 4C4VA 3BS0A 2J4UP 2N2MA 2YNKA 5ADXK 1QJ8A 2MHLA 4GHBA 5H2FO 1GFMA 2AXTO 3VY9X 3LK2B 3LK2A 5AFUK 1ZHTA 3AA7A 2PORA 1Q9FA 1YS5A 5DL7A 1THQA 2Y0LA 2Y2XA 4O49A 5KAFO 3WU2O 1BH3A 4G76A 5GV0A 1QJ9A 1IZNA 4O3ZA 4N59A 1G90A 1GFPA 3HWBA 4FT6A 2JMMA 3K19A 2XE3A 4FUVA 2W81C 4GCQA 1MPFA 5DL8A 4AFKA 4AKMA 4O3WA 3HOEA 5GTIO 2R4LA 3NSGA 4RLCA 5TISO 4G75A 3VY8X 2R88A 3AAEA 3JTYA 3SYBA 3SZVA 4AKRB 4D65A 4CTDA 2X9KA 1GFNA 2R4PA 3FYXA 4FESA 4LSFA 3NJTA 5G39A 1ZHWA 5ADXL 1H6S1 3AA1A 3C5OA 3HW9A 1T1LA 1BXWA 3VZWX 6PRNA 1PRNA 2ZFGA 4AYEC 4RJWA 3EMNX 5G26A 4B61A 1MM4A 3O0EA 3T0SA 1ZHXA 3BRZA 3DZMA 4U9CA 2R89A 3PF1A 2Y0HA 2XE2A 4JFBA 2Y0KA 4O4XA 3DWOX 1T16A 2FGQX 2Y7SA 3BRYA 3PRNA 4FZMA 1GFQA 3TZGA 3A2SX 3T24A 7PRNA 2KDYA 2IWWA 1OPFA 3AAAA 3PORA 4GCSA 1E54A 2LFUA 1HXTA 2WVPA 3A0HO 3AA7B 2IWVA 1PHOA 2ODJA 4KR4A 2F1CX 1HXXA 2XTRA 4RLBA 5B5EO 2JQYA 3PQSA 4LSEA 2O4VA 3AA0B 3DA3A 4LSHA 4O4UA 1QJPA 2R8AA 3PGUA 5DL6A 3KZIO 3G7GA 4Z3TA 4N58A 2KXPB 3DA4A 4O3XB 5T5FA 4E1SA 3AAAB 3UAQA 4AYID 4GF4A 4PJ0O 2WJRA 4FOZA 2LHFA 3UPGA 4C69X 3QRCA 4IL6O 4FQEA 2K0LA 4BUMX 2XE5A 2KZ7B 3DWNA 3JCUO 4AZLA 2KXPA 1Q9GA 3SYSA 3AA6B 4GCPA 5IYUA 1ZHYA 3AA0A 2KC0A 2QTKA 3T20A 1GFOA 4K3BA 5FVNA 4PUXA 3KVDD 2R4NA
chains in the Genus database with same CATH topology
3LK41 4XNLA 4KRAA 4FZLA 4RL9A 4E1TA 2GE4A 3QRAA 4FRXA 3RBHA 2YPVA 3GP6A 4O3YA 3PQUA 3POUA 2W80C 2KZ7A 2M07A 2N2LA 3WI4A 2FGRA 2F1VA 2XTQA 3UU2A 2XG6A 1OSMA 5D5DA 4FSPA 1ZHZA 3SY7A 5JDPA 4FSOA 8PRNA 4AYNA 2M06A 2K4TA 5PRNA 4AYMC 2XMXA 1IZNB 2OMFA 3VE2A 3LK42 5EE2A 4AKRA 4XNKA 3AAEB 3VE1A 3SY9A 2X27X 5AFUL 3LK3B 3WI5A 3AA6A 1BT9A 3AA1B 4FMSA 3V8UA 3VZUX 2F1TA 4JCHA 4LSIA 1ORMA 3SZDA 2ZLDA 4D5UA 4AYDC 4QQ1A 1P4TA 2ERVA 4D64A 1HXUA 2PRNA 4FZNA 3HOLA 4RJXA 2J1NA 4F4BA 4KR8A 2XE1A 3POQA 3VZTX 1MM5A 3POXA 4AUIA 5DL5A 2MNHA 3LK3A 2J4UP 2N2MA 2YNKA 5ADXK 1QJ8A 2MHLA 4GHBA 1GFMA 3VY9X 3LK2B 3LK2A 5AFUK 1ZHTA 3AA7A 2PORA 1Q9FA 1YS5A 5DL7A 1THQA 2Y0LA 2Y2XA 4O49A 1BH3A 4G76A 5GV0A 1QJ9A 1IZNA 4O3ZA 4N59A 1G90A 1GFPA 3HWBA 4FT6A 2JMMA 3K19A 2XE3A 4FUVA 2W81C 4GCQA 1MPFA 5DL8A 4AFKA 4AKMA 4O3WA 3HOEA 3NSGA 4RLCA 4G75A 3VY8X 3AAEA 3JTYA 3SYBA 3SZVA 4AKRB 4D65A 1GFNA 3FYXA 4FESA 5ADXL 1ZHWA 1H6S1 3AA1A 3C5OA 3HW9A 3VZWX 1BXWA 6PRNA 1PRNA 2ZFGA 4AYEC 4RJWA 3EMNX 5G26A 4B61A 1MM4A 3O0EA 3T0SA 1ZHXA 4U9CA 2Y0HA 2XE2A 4JFBA 2Y0KA 4O4XA 2FGQX 2Y7SA 3PRNA 4FZMA 1GFQA 3TZGA 3A2SX 3T24A 7PRNA 2KDYA 1OPFA 3AAAA 3PORA 4GCSA 1E54A 2LFUA 1HXTA 3AA7B 4KR4A 1PHOA 2ODJA 4RLBA 2XTRA 1HXXA 3PQSA 4LSEA 2O4VA 3AA0B 3DA3A 4LSHA 4O4UA 1QJPA 5DL6A 3G7GA 4Z3TA 4N58A 2KXPB 3DA4A 4O3XB 5T5FA 4E1SA 3AAAB 3UAQA 4AYID 4GF4A 4FOZA 2LHFA 3UPGA 4C69X 3QRCA 2K0LA 4BUMX 2XE5A 2KZ7B 4AZLA 2KXPA 1Q9GA 3SYSA 3AA6B 4GCPA 5IYUA 1ZHYA 3AA0A 2KC0A 2QTKA 3T20A 1GFOA 4LSFA 5FVNA 4PUXA 3KVDD 4FRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRA A;  4FRX A;  3POU A;  3WI4 A;  2FGR A;  3UU2 A;  2XG6 A;  1OSM A;  4FSP A;  3SY7 A;  5JDP A;  4FSO A;  8PRN A;  2K4T A;  5PRN A;  2OMF A;  3SY9 A;  3WI5 A;  1BT9 A;  4FMS A;  3VZU X;  4LSI A;  3SZD A;  2ZLD A;  4D5U A;  4D64 A;  1HXU A;  2PRN A;  4RJX A;  2J1N A;  4KR8 A;  2XE1 A;  3POQ A;  3VZT X;  3POX A;  4AUI A;  5DL5 A;  2J4U P;  1GFM A;  3VY9 X;  2POR A;  5DL7 A;  2Y2X A;  2Y0L A;  1BH3 A;  1GFP A;  4FT6 A;  3HWB A;  3K19 A;  2XE3 A;  5DL8 A;  4GCQ A;  1MPF A;  3NSG A;  3VY8 X;  3JTY A;  3SYB A;  3SZV A;  4D65 A;  1GFN A;  3FYX A;  1H6S 1;  3HW9 A;  3VZW X;  6PRN A;  1PRN A;  2ZFG A;  4RJW A;  3EMN X;  3O0E A;  3T0S A;  2Y0H A;  2XE2 A;  4JFB A;  2Y0K A;  2FGQ X;  3PRN A;  1GFQ A;  3A2S X;  3T24 A;  7PRN A;  1OPF A;  3POR A;  4GCS A;  1E54 A;  1HXT A;  4KR4 A;  1PHO A;  2ODJ A;  1HXX A;  4LSE A;  2O4V A;  4LSH A;  5DL6 A;  4FOZ A;  3UPG A;  4C69 X;  4BUM X;  2XE5 A;  3SYS A;  4GCP A;  3T20 A;  2QTK A;  1GFO A;  4LSF A;  5FVN A;  4FRT A; 
#chains in the Genus database with same CATH topology
 3LK4 1;  4XNL A;  4KRA A;  4FZL A;  4RL9 A;  4E1T A;  5G38 A;  3PGS A;  2GE4 A;  3QRA A;  4FRX A;  3RBH A;  2YPV A;  3GP6 A;  4O3Y A;  3PQU A;  3POU A;  2W80 C;  2KZ7 A;  4UB8 O;  4N74 A;  2M07 A;  2N2L A;  5G3A A;  3WI4 A;  2FGR A;  2F1V A;  2XTQ A;  3UU2 A;  4C00 A;  2XG6 A;  1OSM A;  5D5D A;  4FSP A;  1ZHZ A;  3SY7 A;  5JDP A;  4FSO A;  8PRN A;  4AYN A;  2M06 A;  4K3C A;  2K4T A;  5KAI O;  5PRN A;  2XMX A;  1IZN B;  4AYM C;  2OMF A;  3VE2 A;  3LK4 2;  5EE2 A;  2R4O A;  4AKR A;  4XNK A;  3AAE B;  4N75 A;  3SY9 A;  3VE1 A;  2X27 X;  5AFU L;  3A0B O;  3LK3 B;  4C4V B;  5E79 O;  3WI5 A;  3AA6 A;  1BT9 A;  3AA1 B;  4FMS A;  4UB6 O;  3V8U A;  3VZU X;  4PR7 A;  2F1T A;  4JCH A;  4LSI A;  1ORM A;  3SZD A;  2ZLD A;  4D5U A;  4AYD C;  4QQ1 A;  1P4T A;  5B66 O;  4FRT A;  2ERV A;  4D64 A;  1HXU A;  2PRN A;  4FZN A;  3HOL A;  4RJX A;  2J1N A;  4F4B A;  4KR8 A;  5GTH O;  2XE1 A;  3POQ A;  3VZT X;  1MM5 A;  1S5L O;  2WJQ A;  3POX A;  4AUI A;  3PGR A;  5DL5 A;  2MNH A;  3LK3 A;  4C4V A;  3BS0 A;  2J4U P;  2N2M A;  2YNK A;  5ADX K;  1QJ8 A;  2MHL A;  4GHB A;  5H2F O;  1GFM A;  2AXT O;  3VY9 X;  3LK2 B;  3LK2 A;  5AFU K;  1ZHT A;  3AA7 A;  2POR A;  1Q9F A;  1YS5 A;  5DL7 A;  1THQ A;  2Y0L A;  2Y2X A;  4O49 A;  5KAF O;  3WU2 O;  1BH3 A;  4G76 A;  5GV0 A;  1QJ9 A;  1IZN A;  4O3Z A;  4N59 A;  1G90 A;  1GFP A;  3HWB A;  4FT6 A;  2JMM A;  3K19 A;  2XE3 A;  4FUV A;  2W81 C;  4GCQ A;  1MPF A;  5DL8 A;  4AFK A;  4AKM A;  4O3W A;  3HOE A;  5GTI O;  2R4L A;  3NSG A;  4RLC A;  5TIS O;  4G75 A;  3VY8 X;  2R88 A;  3AAE A;  3JTY A;  3SYB A;  3SZV A;  4AKR B;  4D65 A;  4CTD A;  2X9K A;  1GFN A;  2R4P A;  3FYX A;  4FES A;  4LSF A;  3NJT A;  5G39 A;  1ZHW A;  5ADX L;  1H6S 1;  3AA1 A;  3C5O A;  3HW9 A;  1T1L A;  1BXW A;  3VZW X;  6PRN A;  1PRN A;  2ZFG A;  4AYE C;  4RJW A;  3EMN X;  5G26 A;  4B61 A;  1MM4 A;  3O0E A;  3T0S A;  1ZHX A;  3BRZ A;  3DZM A;  4U9C A;  2R89 A;  3PF1 A;  2Y0H A;  2XE2 A;  4JFB A;  2Y0K A;  4O4X A;  3DWO X;  1T16 A;  2FGQ X;  2Y7S A;  3BRY A;  3PRN A;  4FZM A;  1GFQ A;  3TZG A;  3A2S X;  3T24 A;  7PRN A;  2KDY A;  2IWW A;  1OPF A;  3AAA A;  3POR A;  4GCS A;  1E54 A;  2LFU A;  1HXT A;  2WVP A;  3A0H O;  3AA7 B;  2IWV A;  1PHO A;  2ODJ A;  4KR4 A;  2F1C X;  1HXX A;  2XTR A;  4RLB A;  5B5E O;  2JQY A;  3PQS A;  4LSE A;  2O4V A;  3AA0 B;  3DA3 A;  4LSH A;  4O4U A;  1QJP A;  2R8A A;  3PGU A;  5DL6 A;  3KZI O;  3G7G A;  4Z3T A;  4N58 A;  2KXP B;  3DA4 A;  4O3X B;  5T5F A;  4E1S A;  3AAA B;  3UAQ A;  4AYI D;  4GF4 A;  4PJ0 O;  2WJR A;  4FOZ A;  2LHF A;  3UPG A;  4C69 X;  3QRC A;  4IL6 O;  4FQE A;  2K0L A;  4BUM X;  2XE5 A;  2KZ7 B;  3DWN A;  3JCU O;  4AZL A;  2KXP A;  1Q9G A;  3SYS A;  3AA6 B;  4GCP A;  5IYU A;  1ZHY A;  3AA0 A;  2KC0 A;  2QTK A;  3T20 A;  1GFO A;  4K3B A;  5FVN A;  4PUX A;  3KVD D;  2R4N A; 
#chains in the Genus database with same CATH homology
 3LK4 1;  4XNL A;  4KRA A;  4FZL A;  4RL9 A;  4E1T A;  2GE4 A;  3QRA A;  4FRX A;  3RBH A;  2YPV A;  3GP6 A;  4O3Y A;  3PQU A;  3POU A;  2W80 C;  2KZ7 A;  2M07 A;  2N2L A;  3WI4 A;  2FGR A;  2F1V A;  2XTQ A;  3UU2 A;  2XG6 A;  1OSM A;  5D5D A;  4FSP A;  1ZHZ A;  3SY7 A;  5JDP A;  4FSO A;  8PRN A;  4AYN A;  2M06 A;  2K4T A;  5PRN A;  4AYM C;  2XMX A;  1IZN B;  2OMF A;  3VE2 A;  3LK4 2;  5EE2 A;  4AKR A;  4XNK A;  3AAE B;  3VE1 A;  3SY9 A;  2X27 X;  5AFU L;  3LK3 B;  3WI5 A;  3AA6 A;  1BT9 A;  3AA1 B;  4FMS A;  3V8U A;  3VZU X;  2F1T A;  4JCH A;  4LSI A;  1ORM A;  3SZD A;  2ZLD A;  4D5U A;  4AYD C;  4QQ1 A;  1P4T A;  2ERV A;  4D64 A;  1HXU A;  2PRN A;  4FZN A;  3HOL A;  4RJX A;  2J1N A;  4F4B A;  4KR8 A;  2XE1 A;  3POQ A;  3VZT X;  1MM5 A;  3POX A;  4AUI A;  5DL5 A;  2MNH A;  3LK3 A;  2J4U P;  2N2M A;  2YNK A;  5ADX K;  1QJ8 A;  2MHL A;  4GHB A;  1GFM A;  3VY9 X;  3LK2 B;  3LK2 A;  5AFU K;  1ZHT A;  3AA7 A;  2POR A;  1Q9F A;  1YS5 A;  5DL7 A;  1THQ A;  2Y0L A;  2Y2X A;  4O49 A;  1BH3 A;  4G76 A;  5GV0 A;  1QJ9 A;  1IZN A;  4O3Z A;  4N59 A;  1G90 A;  1GFP A;  3HWB A;  4FT6 A;  2JMM A;  3K19 A;  2XE3 A;  4FUV A;  2W81 C;  4GCQ A;  1MPF A;  5DL8 A;  4AFK A;  4AKM A;  4O3W A;  3HOE A;  3NSG A;  4RLC A;  4G75 A;  3VY8 X;  3AAE A;  3JTY A;  3SYB A;  3SZV A;  4AKR B;  4D65 A;  1GFN A;  3FYX A;  4FES A;  5ADX L;  1ZHW A;  1H6S 1;  3AA1 A;  3C5O A;  3HW9 A;  3VZW X;  1BXW A;  6PRN A;  1PRN A;  2ZFG A;  4AYE C;  4RJW A;  3EMN X;  5G26 A;  4B61 A;  1MM4 A;  3O0E A;  3T0S A;  1ZHX A;  4U9C A;  2Y0H A;  2XE2 A;  4JFB A;  2Y0K A;  4O4X A;  2FGQ X;  2Y7S A;  3PRN A;  4FZM A;  1GFQ A;  3TZG A;  3A2S X;  3T24 A;  7PRN A;  2KDY A;  1OPF A;  3AAA A;  3POR A;  4GCS A;  1E54 A;  2LFU A;  1HXT A;  3AA7 B;  4KR4 A;  1PHO A;  2ODJ A;  4RLB A;  2XTR A;  1HXX A;  3PQS A;  4LSE A;  2O4V A;  3AA0 B;  3DA3 A;  4LSH A;  4O4U A;  1QJP A;  5DL6 A;  3G7G A;  4Z3T A;  4N58 A;  2KXP B;  3DA4 A;  4O3X B;  5T5F A;  4E1S A;  3AAA B;  3UAQ A;  4AYI D;  4GF4 A;  4FOZ A;  2LHF A;  3UPG A;  4C69 X;  3QRC A;  2K0L A;  4BUM X;  2XE5 A;  2KZ7 B;  4AZL A;  2KXP A;  1Q9G A;  3SYS A;  3AA6 B;  4GCP A;  5IYU A;  1ZHY A;  3AA0 A;  2KC0 A;  2QTK A;  3T20 A;  1GFO A;  4LSF A;  5FVN A;  4PUX A;  3KVD D;  4FRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...