4GCSA

Crystal structure of e. coli ompf porin in complex with ertapenem
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
total genus 98
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcsA00
4GCPA 1OPFA 3T0SA 8PRNA 2ODJA 2PORA 2K4TA 2Y0KA 4C69X 2ZFGA 3PORA 1GFOA 1HXXA 1GFPA 4FSOA 3K19A 4FOZA 3SZDA 2Y0LA 1OSMA 1E54A 5DL8A 5DL6A 4LSHA 3VY9X 3HWBA 4LSEA 4RJXA 1PRNA 2PRNA 2J1NA 3VZWX 3T24A 4KR4A 3POXA 2Y0HA 4LSFA 3SY7A 3WI4A 3FYXA 4GCQA 1HXUA 2ZLDA 2J4UP 2XE5A 2O4VA 1PHOA 2QTKA 4D64A 4KR8A 3VZUX 2XE3A 4GCSA 3SYSA 4FMSA 1HXTA 1GFNA 3UPGA 5DL5A 4FRXA 1GFMA 4RJWA 3POUA 3SYBA 3SY9A 1H6S1 1BT9A 2Y2XA 4D5UA 3A2SX 4JFBA 4KRAA 2XE2A 4LSIA 5JDPA 4BUMX 3O0EA 4AUIA 3SZVA 1GFQA 4D65A 2FGQX 7PRNA 3JTYA 3EMNX 4FRTA 5FVNA 4FSPA 3UU2A 3VZTX 3HW9A 5DL7A 3POQA 6PRNA 2FGRA 2OMFA 3PRNA 2XE1A 3NSGA 4FT6A 2XG6A 5PRNA 3T20A 3WI5A 1BH3A 3VY8X 1MPFA
chains in the Genus database with same CATH superfamily
4GCPA 4O3ZA 1OPFA 3T0SA 3TZGA 3HOLA 4AYEC 2KC0A 8PRNA 2ODJA 5GTIO 2PORA 4U9CA 2K4TA 2YNKA 5AFUK 2KZ7A 2Y0KA 4C69X 2N2LA 2ZFGA 2R88A 4KRAA 3PORA 1Q9FA 3V8UA 1GFOA 1HXXA 2XMXA 1GFPA 4FZMA 4N75A 3PQUA 3PF1A 4FSOA 4AKRB 3K19A 4FOZA 5G3AA 3HOEA 4O3WA 4AFKA 3SZDA 4QQ1A 5GV0A 2F1VA 4AKMA 2Y0LA 1OSMA 1E54A 1ZHXA 5DL8A 2LHFA 5DL6A 4JCHA 2R4PA 4AYID 4LSHA 3VY9X 2X27X 4C4VA 4E1TA 4AYNA 2K0LA 3HWBA 1QJ9A 4FESA 4LSEA 3AA7A 4RJXA 4F4BA 4PJ0O 3VE2A 2F1TA 1T1LA 2KXPA 4CTDA 5G39A 1PRNA 2PRNA 3AAAA 2J1NA 3VZWX 4UB8O 2WJRA 3T24A 4FQEA 4KR4A 4RLBA 1MM5A 5ADXL 3VZUX 4PR7A 4IL6O 4RL9A 3LK3A 2W80C 4GF4A 3BRYA 3RBHA 1YS5A 3AAEA 2Y0HA 3POXA 4C4VB 4E1SA 2JQYA 4LSFA 3SY7A 4RLCA 3WI4A 3FYXA 3AA6A 2Y7SA 2LFUA 4O3XB 4N59A 4AYMC 2AXTO 3DZMA 3PQSA 4GCQA 2M07A 3NJTA 1HXUA 1Q9GA 2ZLDA 5E79O 2KXPB 3LK2A 2XE5A 5G38A 3C5OA 2O4VA 3AA0A 5G26A 2GE4A 3AAAB 5KAFO 3DA3A 4N58A 2KZ7B 5ADXK 3PGRA 1QJ8A 1PHOA 2WVPA 1MM4A 2QTKA 4KR8A 4D64A 3JCUO 4G75A 3AA1A 2N2MA 2R89A 3LK3B 3QRCA 1ZHWA 4O4XA 2XE3A 4GCSA 1S5LO 3SYSA 5B66O 4FMSA 1HXTA 1GFNA 3UPGA 3AA6B 2R4NA 5DL5A 4FRXA 1GFMA 1T16A 2IWWA 1THQA 3POUA 4GHBA 2XTQA 4RJWA 3SYBA 2ERVA 3SY9A 1H6S1 4AYDC 1BT9A 2R8AA 2W81C 2XTRA 4UB6O 3LK2B 5TISO 3AA0B 2Y2XA 1ZHZA 3A0BO 3DWNA 4B61A 3A2SX 3G7GA 4D5UA 3WU2O 1BXWA 2YPVA 2J4UP 4FUVA 4JFBA 2M06A 5T5FA 3AA7B 1ZHTA 2XE2A 3KVDD 4FZNA 3AA1B 4K3CA 2R4LA 4K3BA 1P4TA 4LSIA 4BUMX 5JDPA 1G90A 2JMMA 5EE2A 3O0EA 1IZNA 4C00A 4O3YA 4AUIA 2IWVA 2MHLA 5B5EO 3SZVA 1GFQA 1ORMA 4XNKA 4D65A 5KAIO 2FGQX 2F1CX 3QRAA 2X9KA 7PRNA 3BS0A 5D5DA 2MNHA 3EMNX 3JTYA 3DA4A 4FRTA 2R4OA 2WJQA 3LK41 4FSPA 3BRZA 3AAEB 5FVNA 3UU2A 3HW9A 3VE1A 3VZTX 4AZLA 3PGSA 5DL7A 2KDYA 3PGUA 4XNLA 3POQA 3UAQA 1QJPA 5H2FO 4N74A 4O49A 4O4UA 6PRNA 5AFUL 2FGRA 2OMFA 3DWOX 1IZNB 3PRNA 4FZLA 3LK42 4G76A 2XE1A 3NSGA 3A0HO 4FT6A 4PUXA 2XG6A 5PRNA 3GP6A 4AKRA 5GTHO 3T20A 3WI5A 1BH3A 4Z3TA 1ZHYA 3KZIO 5IYUA 3VY8X 1MPFA
chains in the Genus database with same CATH topology
4GCPA 4O3ZA 1OPFA 3T0SA 3TZGA 3HOLA 4AYEC 2KC0A 8PRNA 2ODJA 2PORA 4U9CA 2K4TA 2YNKA 5AFUK 2KZ7A 2Y0KA 4C69X 2N2LA 2ZFGA 3PORA 1Q9FA 3V8UA 1GFOA 1HXXA 2XMXA 1GFPA 4FZMA 3PQUA 4FSOA 4AKRB 3K19A 4FOZA 3HOEA 4O3WA 4AFKA 3SZDA 4QQ1A 5GV0A 2F1VA 4AKMA 2Y0LA 1OSMA 1E54A 1ZHXA 5DL8A 2LHFA 5DL6A 4JCHA 4AYID 4LSHA 3VY9X 2X27X 4E1TA 4AYNA 2K0LA 3HWBA 1QJ9A 4FESA 4LSEA 3AA7A 4RJXA 4F4BA 3VE2A 2F1TA 2KXPA 1PRNA 2PRNA 3AAAA 2J1NA 3VZWX 3T24A 4KR4A 4RLBA 1MM5A 5ADXL 4RL9A 3LK3A 2W80C 4GF4A 3RBHA 4E1SA 1YS5A 3AAEA 2Y0HA 3POXA 4LSFA 3SY7A 4RLCA 3WI4A 3FYXA 3AA6A 2Y7SA 2LFUA 4O3XB 4N59A 4AYMC 4GCQA 3PQSA 2M07A 1HXUA 1Q9GA 2ZLDA 2J4UP 2KXPB 3LK2A 2XE5A 3C5OA 2O4VA 3AA0A 5G26A 2GE4A 3AAAB 3DA3A 4N58A 2KZ7B 5ADXK 1QJ8A 1PHOA 1MM4A 2QTKA 4KR8A 4D64A 4G75A 3AA1A 2N2MA 3LK3B 3QRCA 4O4XA 1ZHWA 3VZUX 2XE3A 4GCSA 3SYSA 4FMSA 1HXTA 1GFNA 3UPGA 3AA6B 5DL5A 4FRXA 1GFMA 1THQA 3POUA 4GHBA 2XTQA 4RJWA 3SYBA 2ERVA 3SY9A 1H6S1 4AYDC 1BT9A 2W81C 2XTRA 3LK2B 3AA0B 2Y2XA 1ZHZA 4B61A 4D5UA 3A2SX 3G7GA 1BXWA 2YPVA 4FUVA 4JFBA 2M06A 5T5FA 3AA7B 1ZHTA 2XE2A 3KVDD 4FZNA 3AA1B 4KRAA 4LSIA 4BUMX 1P4TA 5JDPA 1G90A 2JMMA 5EE2A 3O0EA 1IZNA 4O3YA 4AUIA 2MHLA 3SZVA 1GFQA 1ORMA 4XNKA 4D65A 2FGQX 3QRAA 7PRNA 5D5DA 2MNHA 3EMNX 3JTYA 3DA4A 4FRTA 4FSPA 3LK41 5FVNA 3UU2A 3VE1A 3AAEB 3VZTX 3HW9A 4AZLA 5DL7A 2KDYA 4XNLA 3POQA 3UAQA 1QJPA 4O49A 4O4UA 6PRNA 5AFUL 2FGRA 2OMFA 1IZNB 3PRNA 4FZLA 3LK42 4G76A 2XE1A 3NSGA 4FT6A 4PUXA 2XG6A 5PRNA 3GP6A 4AKRA 3T20A 3WI5A 1BH3A 4Z3TA 1ZHYA 5IYUA 3VY8X 1MPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCP A;  1OPF A;  3T0S A;  8PRN A;  2ODJ A;  2POR A;  2K4T A;  2Y0K A;  4C69 X;  2ZFG A;  3POR A;  1GFO A;  1HXX A;  1GFP A;  4FSO A;  3K19 A;  4FOZ A;  3SZD A;  2Y0L A;  1OSM A;  1E54 A;  5DL8 A;  5DL6 A;  4LSH A;  3VY9 X;  3HWB A;  4LSE A;  4RJX A;  1PRN A;  2PRN A;  2J1N A;  3VZW X;  3T24 A;  4KR4 A;  3POX A;  2Y0H A;  4LSF A;  3SY7 A;  3WI4 A;  3FYX A;  4GCQ A;  1HXU A;  2ZLD A;  2J4U P;  2XE5 A;  2O4V A;  1PHO A;  2QTK A;  4D64 A;  4KR8 A;  3VZU X;  2XE3 A;  4GCS A;  3SYS A;  4FMS A;  1HXT A;  1GFN A;  3UPG A;  5DL5 A;  4FRX A;  1GFM A;  4RJW A;  3POU A;  3SYB A;  3SY9 A;  1H6S 1;  1BT9 A;  2Y2X A;  4D5U A;  3A2S X;  4JFB A;  4KRA A;  2XE2 A;  4LSI A;  5JDP A;  4BUM X;  3O0E A;  4AUI A;  3SZV A;  1GFQ A;  4D65 A;  2FGQ X;  7PRN A;  3JTY A;  3EMN X;  4FRT A;  5FVN A;  4FSP A;  3UU2 A;  3VZT X;  3HW9 A;  5DL7 A;  3POQ A;  6PRN A;  2FGR A;  2OMF A;  3PRN A;  2XE1 A;  3NSG A;  4FT6 A;  2XG6 A;  5PRN A;  3T20 A;  3WI5 A;  1BH3 A;  3VY8 X;  1MPF A; 
#chains in the Genus database with same CATH topology
 4GCP A;  4O3Z A;  1OPF A;  3T0S A;  3TZG A;  3HOL A;  4AYE C;  2KC0 A;  8PRN A;  2ODJ A;  5GTI O;  2POR A;  4U9C A;  2K4T A;  2YNK A;  5AFU K;  2KZ7 A;  2Y0K A;  4C69 X;  2N2L A;  2ZFG A;  2R88 A;  4KRA A;  3POR A;  1Q9F A;  3V8U A;  1GFO A;  1HXX A;  2XMX A;  1GFP A;  4FZM A;  4N75 A;  3PQU A;  3PF1 A;  4FSO A;  4AKR B;  3K19 A;  4FOZ A;  5G3A A;  3HOE A;  4O3W A;  4AFK A;  3SZD A;  4QQ1 A;  5GV0 A;  2F1V A;  4AKM A;  2Y0L A;  1OSM A;  1E54 A;  1ZHX A;  5DL8 A;  2LHF A;  5DL6 A;  4JCH A;  2R4P A;  4AYI D;  4LSH A;  3VY9 X;  2X27 X;  4C4V A;  4E1T A;  4AYN A;  2K0L A;  3HWB A;  1QJ9 A;  4FES A;  4LSE A;  3AA7 A;  4RJX A;  4F4B A;  4PJ0 O;  3VE2 A;  2F1T A;  1T1L A;  2KXP A;  4CTD A;  5G39 A;  1PRN A;  2PRN A;  3AAA A;  2J1N A;  3VZW X;  4UB8 O;  2WJR A;  3T24 A;  4FQE A;  4KR4 A;  4RLB A;  1MM5 A;  5ADX L;  3VZU X;  4PR7 A;  4IL6 O;  4RL9 A;  3LK3 A;  2W80 C;  4GF4 A;  3BRY A;  3RBH A;  1YS5 A;  3AAE A;  2Y0H A;  3POX A;  4C4V B;  4E1S A;  2JQY A;  4LSF A;  3SY7 A;  4RLC A;  3WI4 A;  3FYX A;  3AA6 A;  2Y7S A;  2LFU A;  4O3X B;  4N59 A;  4AYM C;  2AXT O;  3DZM A;  3PQS A;  4GCQ A;  2M07 A;  3NJT A;  1HXU A;  1Q9G A;  2ZLD A;  5E79 O;  2KXP B;  3LK2 A;  2XE5 A;  5G38 A;  3C5O A;  2O4V A;  3AA0 A;  5G26 A;  2GE4 A;  3AAA B;  5KAF O;  3DA3 A;  4N58 A;  2KZ7 B;  5ADX K;  3PGR A;  1QJ8 A;  1PHO A;  2WVP A;  1MM4 A;  2QTK A;  4KR8 A;  4D64 A;  3JCU O;  4G75 A;  3AA1 A;  2N2M A;  2R89 A;  3LK3 B;  3QRC A;  1ZHW A;  4O4X A;  2XE3 A;  4GCS A;  1S5L O;  3SYS A;  5B66 O;  4FMS A;  1HXT A;  1GFN A;  3UPG A;  3AA6 B;  2R4N A;  5DL5 A;  4FRX A;  1GFM A;  1T16 A;  2IWW A;  1THQ A;  3POU A;  4GHB A;  2XTQ A;  4RJW A;  3SYB A;  2ERV A;  3SY9 A;  1H6S 1;  4AYD C;  1BT9 A;  2R8A A;  2W81 C;  2XTR A;  4UB6 O;  3LK2 B;  5TIS O;  3AA0 B;  2Y2X A;  1ZHZ A;  3A0B O;  3DWN A;  4B61 A;  3A2S X;  3G7G A;  4D5U A;  3WU2 O;  1BXW A;  2YPV A;  2J4U P;  4FUV A;  4JFB A;  2M06 A;  5T5F A;  3AA7 B;  1ZHT A;  2XE2 A;  3KVD D;  4FZN A;  3AA1 B;  4K3C A;  2R4L A;  4K3B A;  1P4T A;  4LSI A;  4BUM X;  5JDP A;  1G90 A;  2JMM A;  5EE2 A;  3O0E A;  1IZN A;  4C00 A;  4O3Y A;  4AUI A;  2IWV A;  2MHL A;  5B5E O;  3SZV A;  1GFQ A;  1ORM A;  4XNK A;  4D65 A;  5KAI O;  2FGQ X;  2F1C X;  3QRA A;  2X9K A;  7PRN A;  3BS0 A;  5D5D A;  2MNH A;  3EMN X;  3JTY A;  3DA4 A;  4FRT A;  2R4O A;  2WJQ A;  3LK4 1;  4FSP A;  3BRZ A;  3AAE B;  5FVN A;  3UU2 A;  3HW9 A;  3VE1 A;  3VZT X;  4AZL A;  3PGS A;  5DL7 A;  2KDY A;  3PGU A;  4XNL A;  3POQ A;  3UAQ A;  1QJP A;  5H2F O;  4N74 A;  4O49 A;  4O4U A;  6PRN A;  5AFU L;  2FGR A;  2OMF A;  3DWO X;  1IZN B;  3PRN A;  4FZL A;  3LK4 2;  4G76 A;  2XE1 A;  3NSG A;  3A0H O;  4FT6 A;  4PUX A;  2XG6 A;  5PRN A;  3GP6 A;  4AKR A;  5GTH O;  3T20 A;  3WI5 A;  1BH3 A;  4Z3T A;  1ZHY A;  3KZI O;  5IYU A;  3VY8 X;  1MPF A; 
#chains in the Genus database with same CATH homology
 4GCP A;  4O3Z A;  1OPF A;  3T0S A;  3TZG A;  3HOL A;  4AYE C;  2KC0 A;  8PRN A;  2ODJ A;  2POR A;  4U9C A;  2K4T A;  2YNK A;  5AFU K;  2KZ7 A;  2Y0K A;  4C69 X;  2N2L A;  2ZFG A;  3POR A;  1Q9F A;  3V8U A;  1GFO A;  1HXX A;  2XMX A;  1GFP A;  4FZM A;  3PQU A;  4FSO A;  4AKR B;  3K19 A;  4FOZ A;  3HOE A;  4O3W A;  4AFK A;  3SZD A;  4QQ1 A;  5GV0 A;  2F1V A;  4AKM A;  2Y0L A;  1OSM A;  1E54 A;  1ZHX A;  5DL8 A;  2LHF A;  5DL6 A;  4JCH A;  4AYI D;  4LSH A;  3VY9 X;  2X27 X;  4E1T A;  4AYN A;  2K0L A;  3HWB A;  1QJ9 A;  4FES A;  4LSE A;  3AA7 A;  4RJX A;  4F4B A;  3VE2 A;  2F1T A;  2KXP A;  1PRN A;  2PRN A;  3AAA A;  2J1N A;  3VZW X;  3T24 A;  4KR4 A;  4RLB A;  1MM5 A;  5ADX L;  4RL9 A;  3LK3 A;  2W80 C;  4GF4 A;  3RBH A;  4E1S A;  1YS5 A;  3AAE A;  2Y0H A;  3POX A;  4LSF A;  3SY7 A;  4RLC A;  3WI4 A;  3FYX A;  3AA6 A;  2Y7S A;  2LFU A;  4O3X B;  4N59 A;  4AYM C;  4GCQ A;  3PQS A;  2M07 A;  1HXU A;  1Q9G A;  2ZLD A;  2J4U P;  2KXP B;  3LK2 A;  2XE5 A;  3C5O A;  2O4V A;  3AA0 A;  5G26 A;  2GE4 A;  3AAA B;  3DA3 A;  4N58 A;  2KZ7 B;  5ADX K;  1QJ8 A;  1PHO A;  1MM4 A;  2QTK A;  4KR8 A;  4D64 A;  4G75 A;  3AA1 A;  2N2M A;  3LK3 B;  3QRC A;  4O4X A;  1ZHW A;  3VZU X;  2XE3 A;  4GCS A;  3SYS A;  4FMS A;  1HXT A;  1GFN A;  3UPG A;  3AA6 B;  5DL5 A;  4FRX A;  1GFM A;  1THQ A;  3POU A;  4GHB A;  2XTQ A;  4RJW A;  3SYB A;  2ERV A;  3SY9 A;  1H6S 1;  4AYD C;  1BT9 A;  2W81 C;  2XTR A;  3LK2 B;  3AA0 B;  2Y2X A;  1ZHZ A;  4B61 A;  4D5U A;  3A2S X;  3G7G A;  1BXW A;  2YPV A;  4FUV A;  4JFB A;  2M06 A;  5T5F A;  3AA7 B;  1ZHT A;  2XE2 A;  3KVD D;  4FZN A;  3AA1 B;  4KRA A;  4LSI A;  4BUM X;  1P4T A;  5JDP A;  1G90 A;  2JMM A;  5EE2 A;  3O0E A;  1IZN A;  4O3Y A;  4AUI A;  2MHL A;  3SZV A;  1GFQ A;  1ORM A;  4XNK A;  4D65 A;  2FGQ X;  3QRA A;  7PRN A;  5D5D A;  2MNH A;  3EMN X;  3JTY A;  3DA4 A;  4FRT A;  4FSP A;  3LK4 1;  5FVN A;  3UU2 A;  3VE1 A;  3AAE B;  3VZT X;  3HW9 A;  4AZL A;  5DL7 A;  2KDY A;  4XNL A;  3POQ A;  3UAQ A;  1QJP A;  4O49 A;  4O4U A;  6PRN A;  5AFU L;  2FGR A;  2OMF A;  1IZN B;  3PRN A;  4FZL A;  3LK4 2;  4G76 A;  2XE1 A;  3NSG A;  4FT6 A;  4PUX A;  2XG6 A;  5PRN A;  3GP6 A;  4AKR A;  3T20 A;  3WI5 A;  1BH3 A;  4Z3T A;  1ZHY A;  5IYU A;  3VY8 X;  1MPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...