4GCSA

Crystal structure of e. coli ompf porin in complex with ertapenem
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
molecule keywords Outer membrane protein F
total genus 98
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcsA00
2XE1A 2ODJA 4GCQA 4AUIA 3T24A 3WI5A 3POUA 3O0EA 1HXUA 2XE3A 3SYSA 4LSEA 2K4TA 4FRXA 3JTYA 3FYXA 3HW9A 1GFQA 2Y2XA 4LSHA 1GFNA 1H6S1 2ZLDA 1PRNA 2Y0LA 4LSFA 1OSMA 3A2SX 4FT6A 4FSPA 1MPFA 3SY7A 1BH3A 3SY9A 2XE2A 4GCPA 3SZDA 1GFOA 4KRAA 1BT9A 3VY9X 2OMFA 4JFBA 3NSGA 1GFMA 3VZWX 3VZUX 2Y0KA 4C69X 1HXXA 4FMSA 6PRNA 3UPGA 3T0SA 3POXA 2PORA 3EMNX 4LSIA 3PORA 4FOZA 5DL8A 3VY8X 2XG6A 5DL6A 5DL5A 5DL7A 4FRTA 4RJXA 2QTKA 3POQA 4BUMX 2FGRA 4D64A 2FGQX 8PRNA 4KR8A 5JDPA 1PHOA 3VZTX 3PRNA 4RJWA 2O4VA 1E54A 2J4UP 2XE5A 4D5UA 7PRNA 3K19A 3WI4A 3T20A 4GCSA 1HXTA 4KR4A 2PRNA 4D65A 2J1NA 4FSOA 2Y0HA 2ZFGA 5PRNA 1GFPA 3UU2A 3SYBA 5FVNA 3HWBA 1OPFA 3SZVA
chains in the Genus database with same CATH superfamily
2XE1A 3AAEB 1P4TA 3AA6A 1MM5A 2ODJA 2XMXA 3DZMA 4XNKA 3AA0A 4GF4A 4GCQA 4AUIA 3T24A 3PF1A 4PJ0O 3WI5A 2KXPB 2IWWA 2KZ7A 4AKRA 3POUA 2X27X 3O0EA 1HXUA 4JCHA 4K3CA 5B5EO 2XE3A 3SYSA 4LSEA 2YPVA 2K4TA 4FRXA 4FZMA 3JTYA 3AAEA 3FYXA 4AYMC 2M07A 4UB6O 5IYUA 3HW9A 3AA6B 1GFQA 3LK41 5D5DA 2Y2XA 2YNKA 2KC0A 2R4NA 4LSHA 1G90A 1GFNA 2LFUA 3AA7B 4IL6O 1H6S1 4AZLA 2ZLDA 5ADXL 3VE1A 5GTIO 1PRNA 3G7GA 1THQA 3BS0A 1ZHWA 5G39A 2Y0LA 2GE4A 4AKMA 4AYDC 4C4VB 2IWVA 2K0LA 4LSFA 4O3WA 3JCUO 2R4PA 1OSMA 1T16A 3A2SX 2JQYA 2R4OA 4FSPA 1MPFA 2MHLA 4FT6A 3SY7A 1BH3A 3SY9A 5ADXK 2F1VA 5H2FO 2XE2A 3QRAA 4Z3TA 3AA7A 4GCPA 3SZDA 1ZHTA 1BXWA 4O3XB 4O3ZA 4UB8O 1GFOA 4KRAA 5T5FA 4AYID 3AAAB 2N2MA 4N74A 5G3AA 1BT9A 1IZNB 1Q9GA 3AA0B 4K3BA 3VY9X 4AYEC 5GV0A 2OMFA 2W81C 1ZHZA 4JFBA 4AFKA 2R88A 4CTDA 3LK2B 2WJQA 1ZHXA 2WVPA 1OPFA 3NSGA 1ZHYA 4E1TA 1GFMA 2MNHA 3KZIO 4FZLA 5G26A 3VZWX 1ORMA 1YS5A 2R4LA 3VZUX 2Y0KA 4C69X 4B61A 4E1SA 4O49A 2XTQA 4AYNA 1HXXA 4FMSA 3LK3A 4FUVA 6PRNA 3LK2A 4GHBA 3UPGA 3T0SA 2N2LA 3POXA 2PORA 3EMNX 4LSIA 3PORA 4FOZA 5DL8A 3VE2A 4PR7A 2XG6A 3LK42 2LHFA 5DL6A 5EE2A 3VY8X 4C00A 2WJRA 3PGUA 2X9KA 2KXPA 3DWNA 1QJ9A 4FESA 5DL5A 5DL7A 3HOEA 5G38A 2F1TA 4RLBA 4G76A 4C4VA 4RLCA 4FRTA 4FZNA 4RJXA 2QTKA 5AFUK 3PGSA 3POQA 4BUMX 2FGRA 4AKRB 3GP6A 4N58A 1IZNA 4N59A 4D64A 2FGQX 8PRNA 3BRZA 3C5OA 1MM4A 3PQUA 3BRYA 4KR8A 3RBHA 4O4UA 4QQ1A 3V8UA 5AFUL 1PHOA 5JDPA 3VZTX 3PRNA 4N75A 4F4BA 3KVDD 4RJWA 4U9CA 3A0HO 2O4VA 3TZGA 3AA1A 1QJPA 1E54A 2J4UP 5B66O 2XE5A 3DWOX 3UAQA 3A0BO 4D5UA 3K19A 2R8AA 3WI4A 7PRNA 3T20A 5KAIO 3PGRA 2F1CX 4GCSA 3HOLA 4FQEA 1HXTA 2KDYA 4PUXA 5GTHO 4KR4A 1QJ8A 1T1LA 5E79O 2R89A 2PRNA 4XNLA 5TISO 4D65A 2XTRA 3QRCA 3PQSA 2J1NA 4FSOA 2Y0HA 3DA3A 3WU2O 2ZFGA 5PRNA 2AXTO 3AA1B 1GFPA 2KZ7B 4O3YA 4O4XA 2Y7SA 4RL9A 3NJTA 5KAFO 3SYBA 3UU2A 4G75A 2ERVA 3AAAA 3LK3B 1S5LO 3DA4A 5FVNA 3HWBA 2M06A 2JMMA 3SZVA 1Q9FA 2W80C
chains in the Genus database with same CATH topology
2XE1A 3AAEB 1P4TA 3AA6A 1MM5A 2ODJA 2XMXA 4XNKA 3AA0A 4GF4A 4GCQA 4AUIA 3T24A 3WI5A 2KXPB 2KZ7A 4AKRA 3POUA 2X27X 3O0EA 1HXUA 4JCHA 2XE3A 3SYSA 4LSEA 2YPVA 2K4TA 4FRXA 4FZMA 3JTYA 3AAEA 3FYXA 4AYMC 2M07A 5IYUA 3HW9A 3AA6B 1GFQA 3LK41 5D5DA 2Y2XA 2YNKA 2KC0A 4LSHA 1G90A 1GFNA 2LFUA 3AA7B 1H6S1 4AZLA 2ZLDA 5ADXL 3VE1A 1PRNA 3G7GA 1THQA 1ZHWA 4AKMA 2Y0LA 2GE4A 4AYDC 2K0LA 4LSFA 4O3WA 1OSMA 3A2SX 4FT6A 4FSPA 1MPFA 2MHLA 3SY7A 1BH3A 3SY9A 5ADXK 2F1VA 2XE2A 3QRAA 4Z3TA 3AA7A 4GCPA 3SZDA 1ZHTA 1BXWA 4O3XB 4O3ZA 1GFOA 4KRAA 5T5FA 4AYID 3AAAB 2N2MA 1BT9A 1IZNB 1Q9GA 3AA0B 3VY9X 4AYEC 5GV0A 2OMFA 2W81C 1ZHZA 4JFBA 4AFKA 3LK2B 1ZHXA 3NSGA 1OPFA 1ZHYA 4E1TA 1GFMA 2MNHA 4FZLA 5G26A 3VZWX 1ORMA 1YS5A 3VZUX 2Y0KA 4C69X 4B61A 4E1SA 4O49A 2XTQA 4AYNA 1HXXA 4FMSA 3LK3A 4FUVA 6PRNA 3LK2A 4GHBA 3UPGA 3T0SA 2N2LA 3POXA 2PORA 3EMNX 4LSIA 3PORA 4FOZA 5DL8A 3VE2A 3VY8X 2XG6A 3LK42 2LHFA 5DL6A 5EE2A 2KXPA 4FESA 1QJ9A 5DL5A 5DL7A 3HOEA 2F1TA 4RLBA 4G76A 5AFUK 4RLCA 4FRTA 4FZNA 4RJXA 2QTKA 3POQA 4BUMX 2FGRA 4AKRB 3GP6A 4N58A 1IZNA 4N59A 4D64A 2FGQX 8PRNA 3C5OA 3PQUA 1MM4A 4KR8A 3RBHA 4O4UA 4QQ1A 3V8UA 5AFUL 1PHOA 5JDPA 3VZTX 3PRNA 4F4BA 3KVDD 4RJWA 4U9CA 3TZGA 2O4VA 3AA1A 1QJPA 1E54A 2J4UP 2XE5A 3UAQA 4D5UA 7PRNA 3K19A 3WI4A 3T20A 4GCSA 3HOLA 1HXTA 2KDYA 4PUXA 4KR4A 1QJ8A 2PRNA 4XNLA 4D65A 2XTRA 3QRCA 3PQSA 2J1NA 4FSOA 2Y0HA 3DA3A 2ZFGA 5PRNA 3AA1B 1GFPA 2KZ7B 4O3YA 4O4XA 2Y7SA 4RL9A 3UU2A 3SYBA 4G75A 2ERVA 3AAAA 3LK3B 3DA4A 5FVNA 3HWBA 2M06A 2JMMA 3SZVA 1Q9FA 2W80C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE1 A;  2ODJ A;  4GCQ A;  4AUI A;  3T24 A;  3WI5 A;  3POU A;  3O0E A;  1HXU A;  2XE3 A;  3SYS A;  4LSE A;  2K4T A;  4FRX A;  3JTY A;  3FYX A;  3HW9 A;  1GFQ A;  2Y2X A;  4LSH A;  1GFN A;  1H6S 1;  2ZLD A;  1PRN A;  2Y0L A;  4LSF A;  1OSM A;  3A2S X;  4FT6 A;  4FSP A;  1MPF A;  3SY7 A;  1BH3 A;  3SY9 A;  2XE2 A;  4GCP A;  3SZD A;  1GFO A;  4KRA A;  1BT9 A;  3VY9 X;  2OMF A;  4JFB A;  3NSG A;  1GFM A;  3VZW X;  3VZU X;  2Y0K A;  4C69 X;  1HXX A;  4FMS A;  6PRN A;  3UPG A;  3T0S A;  3POX A;  2POR A;  3EMN X;  4LSI A;  3POR A;  4FOZ A;  5DL8 A;  3VY8 X;  2XG6 A;  5DL6 A;  5DL5 A;  5DL7 A;  4FRT A;  4RJX A;  2QTK A;  3POQ A;  4BUM X;  2FGR A;  4D64 A;  2FGQ X;  8PRN A;  4KR8 A;  5JDP A;  1PHO A;  3VZT X;  3PRN A;  4RJW A;  2O4V A;  1E54 A;  2J4U P;  2XE5 A;  4D5U A;  7PRN A;  3K19 A;  3WI4 A;  3T20 A;  4GCS A;  1HXT A;  4KR4 A;  2PRN A;  4D65 A;  2J1N A;  4FSO A;  2Y0H A;  2ZFG A;  5PRN A;  1GFP A;  3UU2 A;  3SYB A;  5FVN A;  3HWB A;  1OPF A;  3SZV A; 
#chains in the Genus database with same CATH topology
 2XE1 A;  3AAE B;  1P4T A;  3AA6 A;  1MM5 A;  2ODJ A;  2XMX A;  3DZM A;  4XNK A;  3AA0 A;  4GF4 A;  4GCQ A;  4AUI A;  3T24 A;  3PF1 A;  4PJ0 O;  3WI5 A;  2KXP B;  2IWW A;  2KZ7 A;  4AKR A;  3POU A;  2X27 X;  3O0E A;  1HXU A;  4JCH A;  4K3C A;  5B5E O;  2XE3 A;  3SYS A;  4LSE A;  2YPV A;  2K4T A;  4FRX A;  4FZM A;  3JTY A;  3AAE A;  3FYX A;  4AYM C;  2M07 A;  4UB6 O;  5IYU A;  3HW9 A;  3AA6 B;  1GFQ A;  3LK4 1;  5D5D A;  2Y2X A;  2YNK A;  2KC0 A;  2R4N A;  4LSH A;  1G90 A;  1GFN A;  2LFU A;  3AA7 B;  4IL6 O;  1H6S 1;  4AZL A;  2ZLD A;  5ADX L;  3VE1 A;  5GTI O;  1PRN A;  3G7G A;  1THQ A;  3BS0 A;  1ZHW A;  5G39 A;  2Y0L A;  2GE4 A;  4AKM A;  4AYD C;  4C4V B;  2IWV A;  2K0L A;  4LSF A;  4O3W A;  3JCU O;  2R4P A;  1OSM A;  1T16 A;  3A2S X;  2JQY A;  2R4O A;  4FSP A;  1MPF A;  2MHL A;  4FT6 A;  3SY7 A;  1BH3 A;  3SY9 A;  5ADX K;  2F1V A;  5H2F O;  2XE2 A;  3QRA A;  4Z3T A;  3AA7 A;  4GCP A;  3SZD A;  1ZHT A;  1BXW A;  4O3X B;  4O3Z A;  4UB8 O;  1GFO A;  4KRA A;  5T5F A;  4AYI D;  3AAA B;  2N2M A;  4N74 A;  5G3A A;  1BT9 A;  1IZN B;  1Q9G A;  3AA0 B;  4K3B A;  3VY9 X;  4AYE C;  5GV0 A;  2OMF A;  2W81 C;  1ZHZ A;  4JFB A;  4AFK A;  2R88 A;  4CTD A;  3LK2 B;  2WJQ A;  1ZHX A;  2WVP A;  1OPF A;  3NSG A;  1ZHY A;  4E1T A;  1GFM A;  2MNH A;  3KZI O;  4FZL A;  5G26 A;  3VZW X;  1ORM A;  1YS5 A;  2R4L A;  3VZU X;  2Y0K A;  4C69 X;  4B61 A;  4E1S A;  4O49 A;  2XTQ A;  4AYN A;  1HXX A;  4FMS A;  3LK3 A;  4FUV A;  6PRN A;  3LK2 A;  4GHB A;  3UPG A;  3T0S A;  2N2L A;  3POX A;  2POR A;  3EMN X;  4LSI A;  3POR A;  4FOZ A;  5DL8 A;  3VE2 A;  4PR7 A;  2XG6 A;  3LK4 2;  2LHF A;  5DL6 A;  5EE2 A;  3VY8 X;  4C00 A;  2WJR A;  3PGU A;  2X9K A;  2KXP A;  3DWN A;  1QJ9 A;  4FES A;  5DL5 A;  5DL7 A;  3HOE A;  5G38 A;  2F1T A;  4RLB A;  4G76 A;  4C4V A;  4RLC A;  4FRT A;  4FZN A;  4RJX A;  2QTK A;  5AFU K;  3PGS A;  3POQ A;  4BUM X;  2FGR A;  4AKR B;  3GP6 A;  4N58 A;  1IZN A;  4N59 A;  4D64 A;  2FGQ X;  8PRN A;  3BRZ A;  3C5O A;  1MM4 A;  3PQU A;  3BRY A;  4KR8 A;  3RBH A;  4O4U A;  4QQ1 A;  3V8U A;  5AFU L;  1PHO A;  5JDP A;  3VZT X;  3PRN A;  4N75 A;  4F4B A;  3KVD D;  4RJW A;  4U9C A;  3A0H O;  2O4V A;  3TZG A;  3AA1 A;  1QJP A;  1E54 A;  2J4U P;  5B66 O;  2XE5 A;  3DWO X;  3UAQ A;  3A0B O;  4D5U A;  3K19 A;  2R8A A;  3WI4 A;  7PRN A;  3T20 A;  5KAI O;  3PGR A;  2F1C X;  4GCS A;  3HOL A;  4FQE A;  1HXT A;  2KDY A;  4PUX A;  5GTH O;  4KR4 A;  1QJ8 A;  1T1L A;  5E79 O;  2R89 A;  2PRN A;  4XNL A;  5TIS O;  4D65 A;  2XTR A;  3QRC A;  3PQS A;  2J1N A;  4FSO A;  2Y0H A;  3DA3 A;  3WU2 O;  2ZFG A;  5PRN A;  2AXT O;  3AA1 B;  1GFP A;  2KZ7 B;  4O3Y A;  4O4X A;  2Y7S A;  4RL9 A;  3NJT A;  5KAF O;  3SYB A;  3UU2 A;  4G75 A;  2ERV A;  3AAA A;  3LK3 B;  1S5L O;  3DA4 A;  5FVN A;  3HWB A;  2M06 A;  2JMM A;  3SZV A;  1Q9F A;  2W80 C; 
#chains in the Genus database with same CATH homology
 2XE1 A;  3AAE B;  1P4T A;  3AA6 A;  1MM5 A;  2ODJ A;  2XMX A;  4XNK A;  3AA0 A;  4GF4 A;  4GCQ A;  4AUI A;  3T24 A;  3WI5 A;  2KXP B;  2KZ7 A;  4AKR A;  3POU A;  2X27 X;  3O0E A;  1HXU A;  4JCH A;  2XE3 A;  3SYS A;  4LSE A;  2YPV A;  2K4T A;  4FRX A;  4FZM A;  3JTY A;  3AAE A;  3FYX A;  4AYM C;  2M07 A;  5IYU A;  3HW9 A;  3AA6 B;  1GFQ A;  3LK4 1;  5D5D A;  2Y2X A;  2YNK A;  2KC0 A;  4LSH A;  1G90 A;  1GFN A;  2LFU A;  3AA7 B;  1H6S 1;  4AZL A;  2ZLD A;  5ADX L;  3VE1 A;  1PRN A;  3G7G A;  1THQ A;  1ZHW A;  4AKM A;  2Y0L A;  2GE4 A;  4AYD C;  2K0L A;  4LSF A;  4O3W A;  1OSM A;  3A2S X;  4FT6 A;  4FSP A;  1MPF A;  2MHL A;  3SY7 A;  1BH3 A;  3SY9 A;  5ADX K;  2F1V A;  2XE2 A;  3QRA A;  4Z3T A;  3AA7 A;  4GCP A;  3SZD A;  1ZHT A;  1BXW A;  4O3X B;  4O3Z A;  1GFO A;  4KRA A;  5T5F A;  4AYI D;  3AAA B;  2N2M A;  1BT9 A;  1IZN B;  1Q9G A;  3AA0 B;  3VY9 X;  4AYE C;  5GV0 A;  2OMF A;  2W81 C;  1ZHZ A;  4JFB A;  4AFK A;  3LK2 B;  1ZHX A;  3NSG A;  1OPF A;  1ZHY A;  4E1T A;  1GFM A;  2MNH A;  4FZL A;  5G26 A;  3VZW X;  1ORM A;  1YS5 A;  3VZU X;  2Y0K A;  4C69 X;  4B61 A;  4E1S A;  4O49 A;  2XTQ A;  4AYN A;  1HXX A;  4FMS A;  3LK3 A;  4FUV A;  6PRN A;  3LK2 A;  4GHB A;  3UPG A;  3T0S A;  2N2L A;  3POX A;  2POR A;  3EMN X;  4LSI A;  3POR A;  4FOZ A;  5DL8 A;  3VE2 A;  3VY8 X;  2XG6 A;  3LK4 2;  2LHF A;  5DL6 A;  5EE2 A;  2KXP A;  4FES A;  1QJ9 A;  5DL5 A;  5DL7 A;  3HOE A;  2F1T A;  4RLB A;  4G76 A;  5AFU K;  4RLC A;  4FRT A;  4FZN A;  4RJX A;  2QTK A;  3POQ A;  4BUM X;  2FGR A;  4AKR B;  3GP6 A;  4N58 A;  1IZN A;  4N59 A;  4D64 A;  2FGQ X;  8PRN A;  3C5O A;  3PQU A;  1MM4 A;  4KR8 A;  3RBH A;  4O4U A;  4QQ1 A;  3V8U A;  5AFU L;  1PHO A;  5JDP A;  3VZT X;  3PRN A;  4F4B A;  3KVD D;  4RJW A;  4U9C A;  3TZG A;  2O4V A;  3AA1 A;  1QJP A;  1E54 A;  2J4U P;  2XE5 A;  3UAQ A;  4D5U A;  7PRN A;  3K19 A;  3WI4 A;  3T20 A;  4GCS A;  3HOL A;  1HXT A;  2KDY A;  4PUX A;  4KR4 A;  1QJ8 A;  2PRN A;  4XNL A;  4D65 A;  2XTR A;  3QRC A;  3PQS A;  2J1N A;  4FSO A;  2Y0H A;  3DA3 A;  2ZFG A;  5PRN A;  3AA1 B;  1GFP A;  2KZ7 B;  4O3Y A;  4O4X A;  2Y7S A;  4RL9 A;  3UU2 A;  3SYB A;  4G75 A;  2ERV A;  3AAA A;  3LK3 B;  3DA4 A;  5FVN A;  3HWB A;  2M06 A;  2JMM A;  3SZV A;  1Q9F A;  2W80 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...