4GD4A

Crystal structure of jmjd2a complexed with inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
SETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Crystal Structure of JMJD2A Complexed with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4gd4A01
5FY4A 2XDVA 5LY1A 3N9MA 5FPAA 4GJZA 4AAPA 4EZHA 5A1LA 3PUAA 5FZDA 5FZHA 5IVVA 5FPLA 1VRBA 5A7WB 5FY1A 2XXZA 4EZ4A 5A7QA 4UF0B 5F2WA 5A7WA 3OPTA 5A7OA 3N9OA 4TN7A 5ANQA 5A3TA 4UF0A 3PURA 4AI9A 4LIVA 4NUBA 5F3EA 5FBJA 5FUPA 4V2VA 3RVHA 3KV9A 5FZ8A 5FYVA 2WWJA 3LD8A 4LXLA 3AVRA 5IVEA 4QWNA 3K3OA 5FWEA 3KV6A 5LY2A 5FP4A 5FV3A 5IVFA 4DIQA 5F5IA 5FP8A 4CCNA 4LIUA 2Q8DA 4GD4A 2OT7A 2OS2A 4Y33A 3U78A 3LDBA 2OQ7A 5LW9A 2Q8EA 2GP5A 5FXVA 3NJYA 4XDPA 4BXFA 5FYUA 5FY7A 5FXZA 2PXJA 3ZPOA 3N9PA 5FUNA 4QXBA 4BISA 5FYMA 3PUQA 5F3IA 4CCOA 4DO0A 5FZ0A 5FY0A 5FYSA 2YU1A 5FPUA 4GJYA 5FZEA 5KR7A 3K2OA 3DXTA 5FYBA 2VD7A 2W2IA 3AVSA 5F3GA 3UYJA 5FZIA 3AL6A 3KVBA 4E4HA 3K3NA 5FP7A 5A3WA 4IGOA 5FWJA 2WWUA 2OQ6A 5FZ3A 5F5CA 5FZCA 5FXXA 3N9QA 3KV5A 2GP3A 4ASKA 4EYUA 3KVAA 5FPVA 4QX8A 5FYYA 5K4LA 3AL5A 5FZ7A 5F2SA 4Y4RA 5IVBA 4CUGA 2YBPA 4XDOA 5FP9A 4IGPA 3PUSA 5FYHA 4CCLA 5FP3A 2P5BA 5E6HA 4CCJA 4D6RA 5A3PA 4QXHA 3DXUA 4V2WA 4CSWA 3OPWA 3ZLIA 5ISLA 4HOOA 4QXCA 5F37A 5FY8A 2YU2A 4HONA 5FZMA 5IW0A 5FZFA 3PU8A 2Q8CA 5IWFA 5FYCA 5FYTA 5FZGA 5A7SA 5FY9A 3KV4A 4C8DA 5FZLA 4IGQA 4D6QA 5FZKA 5FZOB 2YBSA 3PTRB 4QX7A 4BU2A 5FZ9A 2YBKA 5A7PA 5FZBA 5FZ1A 5FZOA 3N9LA 5F39A 5FXWA 5F3CA 4CCKA 3N9NA 5FZ6A 3PU3A 2YPDA 3PDQA 5F32A 5IVCA 5F5AA 4Y3OA 2XUEA 5FJHA 2XMLA 4LITA 5FZAA 4D6SA 5CEHA 4CCMA 5FZ4A 4GAZA 3U4SA 5IVJA 5FY5A 4URAA 5A80A 5FJKA 4QU1A 5IVYA 5A7NA 5LWBA 5FYZA 5A1FA 5A3NA 5FYIA 2OX0A 5FPBA
chains in the Genus database with same CATH superfamily
3J26N 2VVDA 1ZBA2 3WV6A 1W8OA 3B9IA 3P3NA 2EF6A 2G4IA 3PUAA 4ARYA 2MEV2 4XF1A 2XH6A 3VN4A 5FPXA 4CDXC 4N53A 4BQ2A 1BK1A 2XXZA 3HPNA 4WM8A 3WG4A 1DHKB 2EIDA 2JDKA 1UOBA 2QQMA 2YHJA 5GLVA 3IMNA 1ZBE3 2WZPP 1RHI3 1LKNA 1BK0A 1S1AA 3Q8AA 5JAXA 3KV9A 1V9U1 1MVQA 1UMIA 3JQWA 4WM7C 3ATGA 4Y1VA 1GANA 5GLZA 5A6ZA 3WHUA 3OBRA 5FCCA 2QQNA 1WLTA 3OYWA 3T0DA 4FVVA 2EXKA 3WSOA 2BQPA 3T4VA 4BM8A 3KV6A 4LNVA 4QT6A 1C28A 2RS53 1DQ6A 1QOOA 4HFSA 2VQTA 2ZX1A 1TQ5A 1Z7S2 1YCIA 3T30A 1Y3TA 4GD4A 4RGGA 4LKFA 3NAPA 3WQ0A 3AJZA 1H4HA 2ES3A 4W6XA 4DUWA 5FMBA 3LEKA 3S7EA 3I54A 4MXWB 4XYXA 3RMYA 4KBBA 4LBLA 4EE2A 2PLV2 3P1IA 2VTFA 1ASJ1 2VCBA 3T2TA 2TBVA 1W6QA 4HVRA 3I4IA 3URFA 1RUE3 3GXUA 5BNNC 4JTOA 1BJQA 1ODNA 5LCWL 1W28A 2IXLA 1ZA7A 3SH5A 4CDQC 5C71A 3K2OA 2ZA9A 2VD7A 2BV4A 5H9SA 4UXAA 1OQ1A 1UAIA 1ZBA3 1S4CA 4HKWA 2PHTA 4YM1A 3AYDA 1CAXA 4NR1A 1YLLA 1HRI1 2FHRA 4XUPA 3ZFEA 2R041 4AHYA 1AZDA 1YC61 1RUNA 1UY2A 3NV3A 4LBKA 3OD4A 1L7QA 4MGTA 4KWJA 1LOEA 4ASKA 5ANNA 1NA1C 1RL3A 2JDNA 2RR12 1LAJA 4XFHA 2FDFA 4Q0UA 1W90A 4OYUA 2F6BA 2WSVA 3DPRA 1GR3A 4XDOA 5JOYA 4IGPA 3EXUA 1J1TA 2BZDA 1OUSA 1HB2A 2VUJA 2BGCA 4QMAA 4XFBA 3RG0A 3ZKUA 3BTAA 4OHYA 2B9UA 2WIIB 3BOWA 3DXUA 4OLLA 1W3XA 2VCCA 1UPIA 3WF4A 2WNUA 4TTGA 3PUIA 5L19A 4LHNA 4CPBD 2QQPA 4CRQA 4N53C 5GALA 4ZS3A 2WJSA 3RPQA 4WM8C 4DXRA 2RS32 5F37A 1MQTB 1XNBA 1XPWA 4S2HA 1PMJX 4CUBA 3TEZA 2JG9C 4HN0A 1RC6A 5EJ3A 1QY4A 4B1MA 5FKBA 5A6QA 1CPNA 1V6JA 1Z7S3 1JOJA 4AVSA 2WZEA 2PHLA 4BU2A 3OY8B 1HV1A 1RGSA 3GBFA 4S2DA 3RZGA 5EJZB 2IXKA 4AAXA 2JEMA 4HT1T 1A3KA 1W8UA 4JRLA 1PGSA 3B01A 3NNJA 3O0WA 2PLV3 5D21A 3U75A 1Y7BA 1BBT1 3FUQA 4LEJA 4O61A 2VZQA 3PTYA 4W6WA 3WP5A 1CQ9A 5IVJA 5G05L 4OHXA 5FJKA 3KS7A 3PLQA 4XACA 3NAPC 1F5FA 5JZGB 2A6VA 1OXCA 3TB0A 2EAKA 4XW3A 5FPBA 2YV8A 5J48A 2W08A 4IESA 2DVAA 4FPKA 1F35A 3QOPA 1C8NA 2VMHA 4QQHA 4AI1A 4YYOA 2P3KA 2YC2A 5FZDA 2XB6C 4LE3A 5IVVA 3WX5A 1F15A 2VZSA 3ZYFA 2QZ2A 1MS0A 3FFZA 2P34A 2XGXA 2WFF2 3B3QE 5A7WA 1OH3A 5GZCA 3QACA 3B93A 3OJBA 1V6OA 1W0NA 1VRH3 4YZ5A 3ACGA 1ULCA 3HMYA 3ZFEC 4CU9A 1ZBE1 5DG2A 2BOIA 1UPSA 3ZXGA 4I2OA 1RHI1 5IK8A 4MGSA 1TMF2 3GBWA 2CSGA 2RS33 2ZX4A 1DYPA 3AKTA 2H0VA 2UU8A 1S2EA 3DPRC 2ZGNA 3LPGA 3DUIA 3E1F1 4UWDA 2VCMA 2JDAA 4QAWA 3BGAA 5JIUA 1W8NA 4YM3A 2FQPA 2RS51 3GCWA 2WNUC 3LQCA 4A6SA 3DECA 2XQXA 4IW3A 3WVJA 4MGYE 3JU9A 4DEQA 1J84A 4XDPA 1ZYBA 2R1BA 2V4VA 3L2HA 3I2KA 3ZPOA 4XZUG 3LF7A 2ZGPA 1JN2P 5D8AB 5DUXA 4LHSA 2YU1A 3GYDA 4GJYA 4ES8A 1RUE1 1AYN2 3V65A 4CXXA 1UZZA 3AXEA 3EBRA 3MDPA 1UY1A 5FYBA 1AVBA 4QKFA 3A7QA 3AVSA 5F3GA 1PMHX 3WG3A 1ZBA1 2XG3A 4XAAA 1ND3A 2WT0A 5JIAA 1TE1B 1SLBA 3NWKA 1BXHA 4AOCA 4KWLA 5C7GA 2MEV1 2QZ3A 2VO5A 3IBMA 2BDRA 2E33A 5A32A 4QX0A 2WFF3 5DUWA 3OB8A 4CA9A 2C1FA 1HRV2 1POQA 1MS9A 3V0AB 1XNAA 2UWAA 4EWDA 3WNKA 3RRDA 2A1XA 1TMF3 4CSWA 4XEZA 1CAUB 2XBO2 4P5HA 5FMOS 4LQRA 3NNLA 4BQWA 2FDHA 3HEIA 3ZLIA 4CYDA 1KRIA 4JHZA 4J25A 4A44A 2LW8A 2WO2A 1UX7A 4QGMA 4ZS2A 2PA7A 2RS12 3VZOA 3AMNA 3VBHB 2HH9A 4KGGA 3ITQA 3KF3A 3ME2A 4PCRA 2P3IA 5A7SA 5CA6A 5HCAA 2ZBJA 3WG1A 1Z7S1 1NCRB 4OMCA 2ID4A 5HBAA 2R16A 3T4HB 4BMBA 4OZXA 2HLEA 3K77A 4XJAA 3QH6A 4A7KA 2DU0A 2QQIA 4LK6A 1ZZCA 4B7KA 3VKFC 3AZXA 2PLV1 3AZZA 1DGRA 5EHDA 2Q4SA 1RXFA 3HAGA 2K9ZA 4AL9A 3POBA 1AYN3 4ZU5A 1OOPC 2ZCWA 1FMD2 2DCTA 3FLTA 5A7NA 1IOAA 2A7AA 3O1UA 5GM0A 4AFAA 4UW3A 2VXRA 2ZEXA 4QX2A 2ZHNA 4YW3A 5DMYA 4P9LA 5FPAA 4ORFA 1RUJ2 3ZFGA 1PO12 2BRTA 5BXXA 5A1LA 1DQ5A 1SMVA 1ULOA 3NNGA 2JKXA 3OBAA 5JR2A 3MO4A 4XMAA 3NL1A 1URXA 3V56A 2RR11 2CWMA 3BIWE 5HCBA 2XJUA 1D4M2 4IEXA 1CR7A 4UF0B 3PIGA 3WINE 2V73A 4L2NA 1W6NB 1GP5A 5FAXA 5IFTA 1ND3C 2ZMNA 4IDZA 3AZWA 1SDWA 4YARA 4LIVA 1P8JA 3NJVA 1A8DA 2XBO3 1HX6A 1S0CA 1AXKA 1T2XA 4YVSB 2W3JA 1YIPA 4H14A 3I2OA 4NAMA 1X33A 3VD9A 2J42A 1EPZA 1QHDA 2RS31 3FBYA 3LE0A 4YW4A 5LEJA 4IV3A 1QH6A 3VBRC 1JZ4A 3AVRA 2QQVA 3RMXA 4CUAA 1WGPA 3PJYA 4QWNA 4JGYA 5FP4A 2GZWA 4DIQA 1WCQA 4XUTA 4YWAA 2W1SA 1NXD1 2Y6GA 4A7YA 5ABJB 1AL22 4R9BA 1V6LA 3ZYJB 4HN1A 5GZFA 3H8UA 5FXVA 3E97A 2RMU2 1H8TB 3RJ2X 4I01A 5FYUA 5FO9B 2PXJA 2WKKA 2ETEA 5H9PA 5A1AA 3UNPA 1FMD3 1US3A 3MF6A 2F4LA 1UKGA 4PBPA 1YQ5A 4QX5A 3VZKA 4L0PA 3VB9A 1SBEA 4PDWB 5KHJA 3TN92 5SV5A 2P37A 3JD72 1W6PB 4FFFA 3KVBA 1PO13 1E57A 3KM5A 5EQUA 1PGW2 4QXKA 4DNYA 4F7ZA 3ZR5A 2A6XA 1HB3A 3IDCB 3ZXFA 2JDYA 2R0HA 1HIXA 1SFNA 5IUQA 3AL5A 4HETA 4BIOA 2V72A 1F5JA 1PVC2 1QXJA 2WFF1 1HN1A 4Q0PA 4RFRB 1YHFA 3MGUA 3ON7A 3RYPA 4XC9A 4Y1UA 2WO7A 4H7MA 4RR3B 1IGOA 5JI9A 2FCUA 2LS6A 4MGZE 3ZFGC 3OPWA 1TMF1 1XNCA 2A75A 2HYXA 4PQQA 2ZPXA 4XOGA 2GC0A 2JKBA 3U1XA 4SLIA 4HOOA 3MPPG 4Q27A 4AQ6A 3ENRA 1YRZA 2RDRA 2VW2A 4M01A 3VD7A 2JG8A 5GZGA 1V00A 1VMFA 4W6YA 3THTA 4BXSV 4Y1XA 4Z1VA 4QX7A 2KM2A 4BQ1A 5LZ6A 1AL23 3WNOA 1UCXA 4E2GA 5IK5A 1RITA 5JUVA 1REFA 2RMU3 1SDDB 3PHMA 4EWEA 3KLSA 3SMHA 1LODA 4LBMA 4K7JA 5ERLA 3AMQA 4NIAA 4Y3OA 3O1OA 4LJHA 1V70A 4FI9A 3CHXA 4JGYC 4BQ3A 5CEHA 5T55A 2IVIB 3RZHA 1CJDA 4XHBA 4OI0A 1F31A 3RWNA 2IXHA 4FO9A 1AYN1 2YZ4A 1NLQA 3B69A 5APAA 3TN93 1TEIA 3JD73 5I0TA 2QCSB 3O1TA 2C5DA 3AXDA 4E2QA 2CGPA 4OI4A 2B45X 4XQ4A 3H50A 3FHAA 4AAPA 3ZO0B 5FOJB 2VVFA 1Y9GA 3VZJA 1ONAA 4MO3M 3TEXA 4F8AA 3I2JA 1E5RA 1PVC3 2QJVA 4IE6A 3FJSA 3ES1A 4P9JA 1JHJA 4YSFA 2I45A 4CDUB 1HRV1 4XE9A 3SC7X 1LRHA 3MFAA 5CKNA 1JUHA 3WT3A 2B8MA 1PZ7A 2PYTA 3ZDVA 1L3JA 3FLRA 5FBJA 1V6IA 3FZ3A 3LPFA 2XBO1 2E6VA 2ZGOA 5FMDA 4BWOA 1LENA 2XJVA 4PI0A 2IC1A 3EMRA 3WP6A 1DGRN 2RS11 4AWDA 4D8MA 3VBSB 2XJSA 4H55A 2BOJA 5LA0A 1UMZA 3BVCA 1NLRA 1OKQA 4XUOA 2XLAA 5HV4A 2JB8A 5FP8A 2A6YA 4I0BA 4B1LA 1CZTA 2XHKA 4J6GA 4JZRA 1DU3D 1W2UA 4Q0SA 4BE3A 2NYYA 2PAMA 3I2DA 2BVBA 2ZGSA 4DOUA 2OZJA 2WN2A 3NSTA 3ILFA 4QB6A 2KA3A 2EVXA 5F3IA 3R4UA 4MXWA 5CG9A 3WQ7A 2JICA 1SFYA 2VNRA 1X50A 4FT8A 4NRQA 4FBFA 1FMD1 2FMDA 2TEPA 4YVWB 1VB4A 3HOBA 4UW4A 1RUI2 5IFPA 4AEJA 2B5HA 2IFWA 4X6QB 3M2MA 1ZVFA 3ASIA 4IEYA 1W9TA 1RUJ1 1NE4A 1PO11 4BMEA 1GYKA 5FWJA 1PO22 3MIEA 3HQUA 4YM0A 2V5DA 4U36A 3MV01 5T54A 2P3JA 3BODA 3WUDA 3TEYA 1QIQA 3VDBA 4NE9A 4TLGA 4CCJA 1D4M1 4HLTA 4UOJA 2FCTA 5A6XA 1FOD2 4R4XA 2JJ6A 1EPWA 1S55A 1ZZ8A 3ZIWA 3A4UA 1WW4A 2G1MA 4M3CE 5E6HA 1W2OA 2ZHMA 5AVAA 2WO1A 2D3PA 4I30A 1LOFA 2D3RA 2J1RA 3FLPA 3WHTA 3WP4A 2CGOA 3MUZ1 5LA1A 2Y6KA 3W21A 1RUH2 3IN9A 2A70A 4PF1A 4XTMA 1RUD2 3UJQA 3WG2A 1MQTA 4NIHA 2Y6JA 3PVBB 3A21A 4CU6A 3W58A 4IEQA 1HB1A 1QQP2 5IAVA 3U14A 2O8QA 1AL21 1QJU2 5LA2A 3SHRA 2C6SA 2E31A 1GOGA 2RE9A 2NZ9A 3H9AA 3OY8A 4CCKA 5C5UA 3WXPA 2RMU1 3T0BA 2OPKA 3PDQA 2WA3A 2VTXA 2XUEA 3ACFA 1J3PA 5HXMA 1GQHA 1OH4A 5C9AB 4CCMA 1O4TA 2N7GA 1JTZX 1EV12 3JUUA 3UGFA 3ZYIB 1Q8OA 5BNOB 1RUI3 2GH2A 1K12A 2WLQA 3I7DA 4Q2FA 4FCAA 1KITA 3TN91 4NO4A 3JD71 4HG6B 4FXGB 5FYIA 5JZGA 4K6BA 2EIEA 1W9SA 1UWWA 1PO23 1PGW1 1OLME 3LEMA 2R062 3GNEA 4QM9A 2HWE2 2GN7A 4WZFA 3C7GA 1OPOA 4M3CB 4Q5OA 2ARCA 1LEMA 2YC4A 1YQ2A 1FOD3 3JCIA 1PVC1 4Z82A 4AXOA 1IZ3A 3BTXA 3FN9A 4P14A 2XJPA 1DP0A 1GP4A 2XONA 4W8JA 4IE5A 1UO9A 4JC1A 2YDEA 4UW5A 3VKMA 2VW0A 1VJ2A 1RUH3 1IS4A 1WLDA 2VC9A 5C4WB 1PNGA 4MYEA 1W05A 1C5HA 1CAWA 5HV0A 1CGPA 1IS3A 1STMA 2VAUA 1O59A 1QQP3 3ZPYA 5IVFA 3JQXA 1QJU3 3DN7A 4E8DA 1H1IA 1JXNA 1LOFC 1OA4A 2WT1A 1VBE2 5T5OA 2ZABA 2Q8DA 2ZMLA 4MGQA 4LBQB 4AVVA 1LB2A 1NT0A 3NJYA 2O0OA 3TWIA 1UZVA 5BYNA 3H3UA 4RA0A 3T0AA 2FD8A 2GNTA 4BISA 1G7YA 1FYUA 3KT4A 5JLVA 5DUVA 2AEYA 2Y8KA 1W2AX 4FQZA 1MZ6A 2CV6A 4R9CA 5D8AA 1QJEA 1JZ7A 2G19A 3J7NA 3VHPA 1MPXA 1PZ9A 3AC0A 4QQOA 3VD5A 4Y20B 2J1EA 3SKVA 5IK7A 4OI1A 3AFKA 4AVBA 2R063 5DAWA 4TZDA 3CQOA 4NN0A 2HWE3 3KGZA 1QXPA 2P1BA 5F5CA 5F6KA 5FXXA 3ZDSA 5JMCA 4EYUA 4DPNA 4QDQA 5AFBA 4IE4A 2P6HA 5FZ7A 1HW5A 1BQPA 3G6JB 3FWEA 3OSDA 3USSA 2XOMA 4N7IA 5BV6A 4QQPA 2VMCA 2BGOA 2VECA 1W04A 3SXWA 2JDHA 4BPZA 1RXGA 4K21A 1AR62 3V0AA 4FP2A 5JXHA 2D97A 3JB8A 4ZHNA 1GICA 1LESA 1CAUA 1W8HA 1I6XA 4AFMA 4EQVA 1S2KA 5FZMA 2QQWA 3WW3A 5CFCB 3DL3A 1H9PA 1Q8QA 2ENRA 3ZXEA 1JYNA 1AYM2 3LCPA 4QKBA 3U4XA 2QUOA 3VBHA 3JZVA 4C90A 4CCEA 1VBE3 2VXJA 5L7OB 2BWAA 1NCRA 4NPLA 4XCAA 1D2QA 2QQKA 2GMMA 4RGAA 4XABA 5F5AA 4FPFA 3HNMA 3MW4A 4L9BA 2P6CA 1YFXA 4IEOA 4D6SA 4XBQA 4MUVA 2OYZA 3BPSA 1DGLA 2Y6FA 3U4SA 3F2ZA 2ADDA 3ZXJA 4D0QA 5LEKA 5C70A 3O1PA 3BUCA 5A1FA 3IAQA 4B4PA 5C5TA 1RUI1 2Q5TA 3Q8CA 3VBOB 1YNAA 2E7TA 1MVEA 5KC6A 2ZZJA 4BLIA 1HLCA 2XDVA 2VQUA 5JOZA 2BGPA 1PO21 3OGSA 5JWPA 5D8AC 4FP3A 4QQ2A 3GZUC 4EN0A 4O65A 5FO7B 2AUYA 3FC0A 1D0HA 2X5IB 5LBFA 1JUIA 3UKVA 2BP6A 1JI6A 2I2SA 2V5YA 1FOD1 3PMEA 4KBZA 5F2WA 1RB8G 2DUOA 4UF0A 3U0ZA 4AGRA 1AR63 5BY5A 1JYWA 1OPMA 2P2KA 2H6BA 1W6NA 4NIIA 4BYYA 2BBVA 3OUHA 1XU2A 1NQDA 3GGLA 4AQ2A 2D3SA 3KWVA 3OEBA 1ZZBA 2ZZQA 4YVSA 3I3QA 1RUH1 1G9FA 2DTYA 3B5LB 3GZAA 1JS9A 1RUD1 3LD8A 4IETA 4WZCA 4DRVA 5IYYA 5J3UA 2BPA2 2G9GA 3M3EA 2P3YA 2E63A 1HV0A 3E5XA 3KSCA 4F83A 2JDMA 2XPJA 1QQP1 5DABA 1CONA 1NKGA 1QJU1 2OT7A 1HN0A 3LDBA 4FOVA 4MZUA 3R4SA 3LEIA 5ABJA 3H3LA 2ET7A 2WQZC 2W92A 1RUC2 1QNWA 2NM1A 2O8OA 1VBC2 1YIFA 1Z0HA 4KWKA 4N43B 4RYDA 1XNKA 1H8TA 1WA4A 4XAEA 4XDQA 5FYMA 3KCYA 5LATA 3VBHC 5IK4A 1G9DA 1EV11 4FPLA 4FPEA 1DF0A 2PQQA 4AHXA 2PELA 1UX6A 1NCRC 4Q4Y2 4XIKA 3RYKA 2A3YA 2HKXA 1XXNA 2W2IA 2VZPA 4PF5A 1QJFA 1WCUA 4PDWA 4A41A 4HKOA 2WS92 5A3WA 5T3NA 1W6PA 3EB7A 3ZIXA 2R061 4AI8A 2HWE1 2VQAA 4Y5SA 5FFOC 3QH7A 1AUYA 4CEYB 1UOGA 4OQ9A 2QNKA 3VD3A 4AFDA 1O3TA 4C0BA 4RHV2 2YBPA 2Y34A 4LK7A 1OT5A 4AK3A 3BTYA 1DDLA 3PUSA 1HDKA 3ZSJA 5DAXA 5EIYB 4CCLA 3WNNA 4NROA 2PAEA 4RR3A 4FPOB 1W8TA 1KFUL 2IXIA 3NV4A 5KHIA 1BCXA 4OUMA 4QXCA 3TRSB 3INAA 4XQDA 5FY8A 1H1MA 2YU2A 3KT7A 1F4HA 3KMHA 1AHSA 1RUG2 4C8DA 3E6BA 2YUEA 3FHQA 2MEV3 5GLWA 5FZBA 1VBE1 1W6MB 4GWMA 3ZX7A 1XQNA 4ITCA 1DZTA 5F3CA 3RI8A 1RUC3 1CZVA 3MICA 4YVSC 1VBC3 2VM9A 4Q8LA 2PAKA 3WCSA 3E6DA 1JHNA 2O1QA 3CMGA 1N3QA 3HN3A 4URTA 1SLCA 1UOFA 4URAA 3HQRA 2YFZA 3H7JA 4Q4Y3 4ZZ5A 2ORZA 4Y5Z0 3DGTA 5ABJC 4DFSA 2D93A 2WS93 3VHNA 1W9WA 1H8TC 4Y5TA 3SCHA 4D7TA 5LRSA 3AYAA 1H8VA 1ULDA 2IWGB 2W1QA 4QDRA 4PIXA 2XJTA 4Y22B 2H0BA 5BNPB 4HL0A 5FPLA 5BPXA 3MYXA 4NHMA 3HBKA 2GSYA 1VBA2 1B09A 1H2LA 4NHYA 4RHV3 1A8MA 2SBAA 1LOGA 3MEPA 3KF5A 4O7XA 2WINB 1RJ7A 4IV1B 4JTNA 4PDWC 5FTTC 4D69A 3PURA 4CDUA 3EQEA 3O1RA 1AR61 5DZFA 4PHZA 4P08A 1TNFA 1S0DA 2E7QA 5EZWA 4UFKA 1VIWB 4P9YA 5F1RA 1R1A2 4NWWA 4DXZA 4JHTA 1SQ4A 4Q1PA 4XJZA 4BDVB 3T2QA 1RUG3 4N9IA 5DXDA 1ZRFA 1AYM1 1J3QA 2DVBA 3A23A 3VBSA 4NHLA 3T2PA 1GNZA 2Q8OA 4A45A 2DVGA 4KI5M 2VPVA 2RR13 2HEWF 4FPJA 1X7NA 3IT8A 4DY3A 1APNA 1KJRA 4LPLA 1V6KA 5CNAA 4XUQA 1AX1A 4S2FA 3RQ0A 4MH0E 3N36A 2DVFA 2X8KA 3UESA 3UGGA 1VB2A 4LO5B 1O6UA 2B42B 2Q30A 2WAOA 3D8CA 1JYTA 2LRPA 1IKPA 2GU9A 4MXVA 1BVVA 4FFIA 3U10A 4YVWA 1BKZA 4FFGA 4JKKA 1CAWB 1B35B 2R32A 1A78A 2W95A 4UYBA 5AVPA 4LULA 2AEZA 4PQ9A 5FP7A 3SCFA 4DXTA 1AR92 2VZ1A 3D0SA 2WWUA 4NJ4A 2J1VA 2KD7A 3HD8B 4LO6B 1VBA3 2DF7A 1Q8VA 3CBNA 4ASMB 4QX8A 3TBDA 3WQ1A 3RZKA 2XJRA 1MS8A 1SPPB 2K0GA 4XVHA 4XFFA 4FXKB 1EP0A 3I3EA 5FP9A 1NCQB 2WFPA 5FIXA 2OUJA 5KHKA 3NNFA 4JX0A 3OBTA 4QGLA 4D6RA 3JXSA 1O8SA 4FTBA 4V2WA 1OF3A 2D6OX 1C4RA 2WC2A 3VBUB 5J98B 3ZYHA 1R1A3 2LM3A 4YZ1A 5I91A 5KHHA 1KD7A 3FFQA 3GHNA 5FYCA 4A2UA 3GBGA 3OTFA 4AEMA 2ZX0A 4AFBA 2PHUA 1O8PA 4CDUC 1MZFA 2GMEA 2QE3A 2JX9A 2VZUA 5FZ9A 2XWBB 4B3NA 1GWLA 1M06G 4K1ZA 5FZ6A 2JDUA 4U2AA 1RUC1 1VBC1 3LDKA 4H7LA 3SH4A 1OF4A 4IUGA 3VBSC 3PVNA 4LORA 4ASLA 4AVTA 3LOIA 4EJRA 4ZY9A 2XL9A 5C9AA 2YROA 4HVQA 3DYOA 4LBQD 1QMJA 4SBVA 3ZFFB 4DUXA 5FQ0B 4Q4Y1 1VAVA 3WCRA 1GOHA 5JPMB 1BHGA 1Y9QA 3MIGA 2OX0A 5BNOA 4IERA 3POYA 2WS91 1WCSA 1AR93 1DQ4A 4OI2A 4AQSA 2VY0A 3S7IA 3NNMA 3ZSKA 2BFUL 1UN1A 5HXVA 5EPAA 2PFWA 3Q9OA 5EFUA 2WT2A 2VJXA 4Q4V2 4EZ4A 4XCBA 2PN5A 2G9ZA 4KGQA 4YVWC 4XHXA 4M3CA 4RHV1 3OPTA 2QQUA 3WEZA 2VUDA 4BK4A 3E5UA 1X8EA 1X82A 4LLOA 4QHBA 5F3EA 3T2OA 3BOPA 3WLUA 4IEZA 2D5HA 1O4ZA 4DUVA 2A6WA 2J7MA 5FZ8A 1AR72 1OLQA 3K46A 1GWKA 1LHWA 1KFXL 4NRPA 1VLNA 4PLNA 4AEDB 3BKZA 4BQYA 1FXZA 1LU1A 3GZEA 1ACCA 3M7AA 5DAVA 5IVEA 1RUG1 5C4WA 3VD4A 4I3PA 1ZX5A 4JCKA 3AKQA 1OVPA 4CP2A 1JH5A 3VDAA 1UL9A 4Y33A 1QOSA 1CZSA 1WMXA 5DDJ2 2AREA 3D82A 1RINA 4AE2A 1LTEA 3UT0A 1HRV3 1Q8SA 4LBQA 4NOTA 5FXZA 4JVAA 3VZMA 2VL4A 4E8CA 3PUQA 4GZ9A 1J83A 5TSWA 2R6QA 4YW2A 3VL9A 1CIYA 2WNEA 3QLQA 4AHWA 1UYZA 1D7PM 4LKDA 4XETA 1HXS2 4AI3A 1JYVA 2W52A 2RS13 5GKAC 1OLMA 2EXJA 1GZTA 2LTNA 4FOYA 4P9WA 1D2SA 4QKDA 4QX1A 1ULGA 3VKNA 3ZYBA 4Y20A 4TSVA 1LHOA 3H8XA 1N3PA 3L9JT 2Q0AA 3VZNA 4CDQB 1H30A 5FREA 3WNPA 1WCKA 2NLRA 1REEA 2ERFA 4FOQA 4JGZB 1CAVB 1VBA1 5ACA2 4J1XA 4A3ZA 4D7SA 3BN6A 5BNOC 2C9AA 4NHXA 1CJPA 4C1XA 3VHOA 1WMDA 5DZEA 4CCCA 1LHNA 4GWIA 5C8CB 2GNBA 2JWPA 1FI2A 3S6PA 1AR73 2BTVC 5C6CA 5JCTA 1KGYA 1R1A1 3F95A 2JIGA 1OURA 4R8HA 5C33A 4LO8A 4UW6A 1RUJ3 5I0SA 5CFCA 3PVOA 1FAYA 4IGQA 5FZKA 3VDDB 5AC92 2YYOA 4KL1A 1JODA 3AP5A 3LSDA 5DDJ3 4GB32 3N9LA 1MS1A 4RQPB 4S2GA 2JG9B 4JQRA 1WA6X 5FDBA 5L7OA 1LJ7A 3KHCA 1AXYA 4EN7B 1D4M3 1QDCA 3N35A 3VL8A 1GZWB 2XHNA 3Q8EA 5IVCA 3NV2A 5H9RA 1GUIA 5C4WC 2G9FA 1LGCA 2VOXA 3BPZA 4ZXKA 2CAUA 1CX4A 1HXS3 3NJXA 1LNSA 4IEWA 3CJXA 2FCVA 1W9YA 1N1YA 3O5SA 4B7EA 1CN1A 1ULEA 2QQJA 4NMIA 1X36A 3ABZA 5FY4A 4UFMA 2PTMA 3VBOA 2R49A 5FO8B 3BIEA 1AR91 2NMNA 3KZ4C 1QEXA 4Z07A 4HMZA 4AI2A 4CTEA 2RM22 5ACA3 2V09A 3M8LA 3I3MA 1VMJA 3RYRA 1GFF2 2X5IA 1DIWA 1GNYA 4IV3C 3ZXKA 4W65A 5LBEA 2EXIA 1LHVA 1MR5A 5GLTA 4NUBA 3K48A 2BEOA 3ST7A 1HJGA 1GOFA 1XNTA 4K40A 5I8YA 4K8RB 1G6NA 2NQYA 4OFGA 4EWAA 3BB6A 4I3GA 1VP6A 1I5PA 5CFDB 4INDA 4YLZA 2D6LX 2AACA 3DCQA 4OZOA 4QGNA 5AC93 4Y4YA 4QB2A 4YZ2A 4GB33 1I1EA 3K4AA 1ENRA 3P6BA 1WD3A 2OS2A 4YW6A 3OPZA 3RS6A 5EWSA 1O3SA 2VG9A 4OULA 4W50A 5GLUA 2GALA 4WVVA 4QXBA 5FUNA 5G04L 3ZXAC 2FDKA 1OKOA 1FV3A 2HWC2 5CFCC 3AZYA 4N43A 1FPN2 5T52A 5FY0A 4ZONA 1S0BA 3ILNA 5E89A 4LR4A 3JB4C 1WBLA 2R30A 3FE5A 4NHKA 5KR7A 5L7OC 1LU2A 3HJRA 3NV1A 4E4DX 4HXCA 3RSJA 3AL6A 4A4AA 4RD7A 3ZKYA 2AH2A 3WDVA 3ACLA 4CUCA 2CNAA 3ZMNA 2RM23 4P02B 3WZ1A 4AR2A 2Z79A 4Q4V1 3ACIA 3MUY1 5FYYA 2RDSA 4PI2A 3QBQA 2VMGA 3B9CA 2BYVE 3ZVXA 4CEYA 4XJUA 1H6YA 1FV2A 3VBOC 5DN2A 1IPJA 4C91A 2JG8C 4L11A 2Z42A 1RTVA 4NIGA 3WD5A 1S2BA 3VLBB 1UF2C 1XRUA 2E51A 3GJAA 1MEC2 1AR71 3UGHA 4BQ5A 4D94A 3RI9A 5FZFA 2IFRA 2X5IC 2DVDA 5L73A 2Q8CA 2L9LA 3THPA 1MZEA 1WBFA 3WF2A 4CP9B 3H8RA 3AP6A 3KV4A 4DINB 1KS4A 4CVUA 5JXIA 3S57A 3CJIB 1KDMA 4E9KA 4TYSA 3MIDA 2X05A 3D5OA 5DDJ1 3I59B 1W6MA 3N9NA 1QWRA 1WMFA 3MHZA 4M0NA 2PHXA 1CIWA 2WYSA 3PU3A 2YPDA 5F32A 3I3DA 2HWC3 1FPN3 1KXGA 2CY6A 5J1XA 4HK9A 1Q43A 1LGNA 4WVMB 4YGCA 4H3WA 4YPJA 3C7OA 2JD4A 3V64A 1RIRA 5KWRA 3W5MA 4Q26A 1WWYA 1MS3A 1HXS1 2QDRA 2HWB2 3CLPA 1SACA 5GZDA 5BUVA 1WD4A 3V0BB 4K8FA 1JBCA 1OBNA 1OOPB 1U0AA 4AZZA 4HSJA 2RVAA 4N43C 1OQEA 4GH4B 4AYUA 1YI7A 1L7RA 2RDQA 2AGSA 2ATFA 3MPBA 1Y43B 4Y22A 1C57A 1CX1A 5ACA1 5BNPA 2W5FA 2P17A 1IKQA 2VBBA 2W91A 4E2SA 5J37A 4QPWA 4JDOA 4LLFA 4ZU4A 1R092 4IV1A 3RWKX 4FAGA 3HNBM 1G9AA 1MEC3 5B2GB 2QQOA 3ZM8A 3MLKA 5F8PA 3IIAA 4LXLA 5FWEA 2AENA 2EICA 2HYKA 3ETQA 4GIQA 3WNXA 4COWA 5AC91 2VW1A 4R9AA 1GZ9A 2DCJA 2ZOEB 4GB31 1WW7A 4Q29A 3VBRB 3ACHA 2OQ7A 1X9PA 5LW9A 3NKGA 1BMV2 1XJAA 5F7UA 2E26A 3TNPB 5FBZA 1SZBA 2RDNA 2WNVB 4YGBA 1BLZA 3ZOIA 3GM8A 4UFHA 2DFBA 2Y26A 1XC6A 2CU5A 3MLLA 4QM8A 2BERA 2VULA 3ES4A 2HWB3 2DUPA 3OG2A 1TME2 1N1SA 2WZR2 5JI7A 4BHPA 4CU8A 4K1YA 5EJ1B 1YQ6A 2A3XA 5FUIA 1RUD3 4PJYA 4E4HA 3AKSA 1VBB2 1B35A 4QPGB 3UL2A 5J36A 1S0FA 3ZN6B 5IT6A 1QOTA 1OHFA 2RM21 2WDBA 3KV5A 3POFA 1YYNA 2XLFA 4IL7A 2Z69A 3H42B 4MG2A 2BUKA 2EXHA 1GKBA 4V1PA 1SPPA 1R093 3OF1A 3S0MA 4FSJA 1MQTC 5A6YA 5A3PA 1NCQA 1O91A 3WUCA 5FLIA 1EV13 3EJKA 3ZSLA 5A3LA 1TZOA 2I74A 5BNPC 2QVSB 5T5JA 3VBUA 1NY72 5K0UB 3HVDA 3X29B 2QQLA 4HBNA 1NZCA 1JMUB 2VNGA 1UY3A 5E16A 2B46X 4FTEA 5FY9A 4IV1C 2RV9A 3T08A 1M4WA 5FZLA 3Q8FA 5FZOB 3N3HA 4IEVA 3VKLA 5FKCA 5A7PA 5FZ1A 4LOTA 1KS5A 3CU7A 1EUUA 3WQBA 1NQJA 2ZJCA 1N1TA 3H1MA 3O0XA 5JZGC 1OFNA 2V4AA 1C8M2 2HWC1 2LROA 1FPN1 3SEEA 2R7EB 4LOSA 4PBOA 1WW5A 1TME3 2WZR3 5B4NA 5FLJA 4QPIB 2A3WA 1GP6A 1HQLA 2ZTNA 4ISRA 3FX3A 1QDOA 2I07B 2WA4A 3I2GA 3ZFFA 3LA7A 4L8QA 2QBXA 3TYJA 5FQ0A 2OXBA 1VBB3 3IMMA 1QJY2 2ZS6B 3SNMA 3T3YA 1POV3 4XJ8A 1YJLA 1N1VA 1VPHA 2BFUS 3AMMA 1BEV2 3ZN5A 4NPMA 3RZJA 2XR4A 2R0FA 4LBNA 2QTWB 4AHZA 4YZ4A 1J3RA 1SBDA 3LFIA 4Q0QA 4HVOA 3N9OA 3AMPA 5A3TA 5A33B 4AI9A 5LB6A 3W9AA 1B35C 1UQXA 4P9GA 1QNYA 1FATA 3BU0A 4V2VA 1VBD2 4P9XA 1PK6B 2FMYA 4I0WB 3C2UA 1XOYA 1MEC1 2HWF2 1NXMA 1ZA4A 5A3MA 3LAGA 3KQRA 3ZYPA 1UOJA 4LO4B 1N47A 2IXJA 4DY5A 3IIIA 3OGRA 4AEDA 1O7FA 1KQRA 4XTPA 1UU6A 5CISA 3WNMA 1NCQC 5FV3A 1CWPA 3N7LA 4LE4A 4DB5A 1BVP1 2ZKNA 3B7MA 4K20A 1X9TA 1LCLA 1UMHA 4FFHA 3C8XA 4XF4A 2GP5A 4N90A 5JSPA 4R4ZA 5C3OA 1NAEA 2ZGLA 1C8M3 2CYFA 2ZX3A 3M3OA 2Q1MA 2OZ6A 4XBNA 2AC1A 3HWJA 4X6RB 4CP0A 1DQ2A 4DZGA 3PMSA 3MIFA 4LKSA 3T1LA 3AZVA 4GMP1 3HIFA 2DBNA 1LEDA 2HWB1 3WF3A 1UIKA 4AGGA 4C0HA 2VOVA 2NMOA 2VMFA 1QJY3 1AYM3 3QD6A 4PLMA 5DAQA 3FUOA 4IGOA 4YG3A 2EIBA 3ZYRA 2W39A 4XXPA 1LR5A 1BEV3 1XE7A 1JZ5A 1W8WA 1HQNA 2YG0A 1XE0A 4XF0A 5FZCA 1D0GA 1N3OA 4CDQA 5IATA 1RUOA 5FPVA 3USUB 3P5BA 3ZFFC 4JGZA 1CAVA 3J7LA 4J1WA 5F9TA 3J9SA 5FYHA 1HQWA 3LIHA 3VGIA 1R091 1OC1A 2J22A 1FX5A 1VBD3 1C1FA 2JD9A 2P5BA 5F5QA 4I09A 5I0UA 3RFRA 1OFSA 4COZA 2HWF3 1DCSA 3MI8A 4JV4A 1ND2B 3OGJA 4C1WA 4UBGA 2P4EA 5C8CA 4QD2A 1W8ZA 5LRRA 1O5LA 2Y6LA 5CBLA 4KU7A 3POEA 3M3QA 4AVAA 2VBPA 3SITA 4Q0VA 4Q1RA 5FYTA 2AYHA 2HEYF 4XIOA 3NJZA 5EV7A 3LIGA 1QJZA 4LKEA 2XVLA 4P5YA 3BYWA 2RJLA 2UY9A 1PIV2 3VDDA 3IAPA 2DV9A 2WAAA 4RFT0 1BMV1 3R0RA 1EY2A 4R52A 4RQPA 2JG9A 1ZZ6A 3VBFB 2VE1A 1PMIA 1U5XA 3PVEA 4AEDC 3R4DB 5FOBB 2DBIA 1CVNA 1GZWA 3A22A 3J8F2 2EIGA 4XURA 4Z92B 1R64A 4GAZA 2VZOA 2WRAA 1UYXA 1H2KA 2VZ3A 4I02A 5FY5A 3TAYA 2KXLA 4FAHA 3KCCA 1TME1 2WZR1 3M70A 3K51A 4QU2A 1T6BX 1WLCA 2Y38A 5C8WA 1KEXA 2BWCA 4HPKB 5LY1A 3LEGA 4R9DA 1DQ1A 3N9MA 1VBB1 1TG7A 2YC0A 2JIJA 3U07A 1POV1 1BYHA 1LECA 1IG3A 2W1UA 3O0VA 4XXAA 3LA2A 3LKJA 5I8SA 2ZGTA 5CADA 3C7EA 1JYCA 3LA3A 2EAAA 5A7QA 4ZU7A 4M4RA 2CTVA 1DGWX 2OVUA 2BNMA 4M0HA 5ANQA 5JOXA 2W0XA 4MGIE 5M0TA 4UFLA 2VTXJ 2YGMA 1YFUA 3PNAA 1RVF2 3LZZA 1GQGA 3ORJA 1DFQA 3BCWA 3GDBA 3I2HA 5T50A 4OUSA 5FK7A 3D0JA 1COV2 3I2IA 1NY71 1LHUA 2AZ5A 4FPYA 4YW7A 4JGZC 2WUHA 5LA9A 1H1AA 2D5FA 2ZGMA 1QJX2 2FBEA 3A0NA 3O14A 3K3OA 3OCPA 1WW6A 5IJRA 5LY2A 5CFDA 2AR6A 2UURA 1W99A 5F5IA 4OHZA 1DZRA 4EN6B 5GZEA 3O1VA 1UIJA 1PIV3 3OOXA 1AF9A 4HSLA 2ORXA 5J7MA 4FPHA 2E7AA 5C8CC 3WR0A 2Q8EA 1W2TA 4L92A 1VMHA 2ARAA 2PMWB 4KMQA 4XFAA 2VZVA 4GQ7A 2LUWA 4Q4W2 3J8F3 1S0GA 5FPZA 1OD3A 1C8M1 1VRH2 4YGDA 2C4XA 4YW5A 3WF0A 4AF9A 4EROA 4YG0A 1QGLA 5FYSA 1DBNA 2GDFA 2XWJB 3OBZA 1DZQA 3VDDC 4IXLA 3RGBA 4RQPC 1H2NA 3K4DA 3E5QA 4GALA 4MADA 4K3UA 3UETA 3POGA 3I49A 4CDWB 1QJY1 2RJKA 1IPKA 3IPVB 1VALA 1I3HA 1KJLA 1YJKA 2NN8A 3LB9A 1BEV1 4RR3C 1YFYA 2O14A 4A42A 4ES9A 4MOAA 2XQRA 1ST8A 1J59A 4HK8A 5F2SA 1SLAA 1DG6A 1WUVA 4CUGA 2DDUA 1RVF3 4LT5A 5DQ0A 3VKOA 4GULA 1UZYA 1GV9A 3AP9A 4UAPA 2NP0A 1DQ0A 1VBD1 5KXEA 3UKNA 4CU7A 3LSEA 1COV3 5KXDA 2HWF1 2OUHA 1PHMA 1VAKA 1NOVA 3IWZA 1QJX3 3OGGA 3H3ZA 2J1UA 5IHRA 2J1AA 1K5JA 1Q3EA 1AR82 1XB9A 1DLLA 3NO8A 1H2MA 4BQXA 3K75B 3MIBA 2YBSA 2A6ZA 2PHFA 4CP9A 1TNRA 1EYBA 1ALYA 3GCXA 4RL7A 1W6OB 3CJIA 5KXCA 2B9VA 2D6PA 4A6OA 4HZFA 4Q4W3 4CPBA 3RDIA 2F17A 2JDZA 3N7JA 2BVVA 3I59A 5JSRA 2GH8A 1S0EA 1UZ0A 1ZNPA 2C0ZA 4AEKA 5CFDC 4LO7A 3O7OA 1JW6A 1JZ8A 1UY4A 3ALQA 5FZ4A 3AP7A 2EA7A 4CP1A 3I97A 3M1HA 2RHPA 4WVMA 5IVYA 1Q56A 2ZXQA 4EN8B 1SLTA 4BIFA 2TNFA 3WDYA 4CE8A 4IE7A 4CEWB 1V6NA 3IB3A 2WR9A 4MSVA 2MPFA 3HNYM 3IDAA 3POIA 1K5MB 2Y64A 3LDRA 2GC1A 2YMZA 3V0BA 3RZZA 2WABA 4HANA 3WDTA 1OOPA 1UY0A 5CZKA 2VQ0A 3UK9A 5T5PA 3KB5A 2ZGKA 3MW2A 1H6XA 4GH4A 2MNGA 2D6MA 3SCGA 2FZ2A 1PVXA 3NVCA 3NW4A 1OA2A 3NRUA 4WVWA 1EAH2 5JPNB 1SLIA 2Y6HA 3D6EA 3GJBA 1ZZ9A 5CKQA 2CL2A 4LMFA 4UBHA 2JDPA 2R1DA 1I9RA 1ZREA 3WDWA 3NQHA 1W39A 3ELNA 4QX3A 1GWMA 2HBTA 2J1SA 4ZXEA 1ZZ7A 3H1WA 4RS5B 4KQ7A 2X10A 2Z4FA 2ZAAA 3NKTA 2QDNA 1PM7A 3DV8A 2GC3A 5FYVA 1AR83 2WSUA 1OSGA 1AXZA 1E5HA 3I2FA 3FHIB 3UKTA 5K9YA 2JE7A 4XBLA 2OKXA 3DF0A 1PIV1 4ET7A 5CU1A 1CESA 2IZWA 4ZKTB 2YXSA 3VBRA 1PX3A 4BXFA 2YY1A 5FY7A 2ZGRA 1NE6A 1MS4A 3WOGA 3MFCA 3J8F1 2TUNA 5CYYA 2JENA 1PGL2 4CDXB 2WNVA 4X8NA 1KDKA 2Z5WA 3TOJA 4ARXA 1CPMA 4P00B 1UKRA 1V0AA 3CJIC 3CZJA 5FZEA 4M00A 1K3IA 1OI6A 3E6CC 2YFUA 5D2AA 1JOPA 1YQCA 2CAVA 4WBBA 5FMCA 5FZIA 2QKDA 4UFJA 3K3NA 1R1ZA 2DTWA 3C3VA 3W20A 4LA3A 2A5ZA 1D4VB 4WM7B 2A71A 2GNDA 2OQ6A 1YXWA 2C26A 2VUCA 1SEFA 3J7MA 3FBMA 1U5ZA 1XE8A 4QPGA 5FK8A 4AW7A 2GP3A 1U5IA 2FDGA 4ONUA 3ZN6A 5KXBA 3GF6A 1EAH3 5K4LA 1JU3A 1J58A 1QF3A 3AP4A 1YEWA 2FZ1A 2VOWA 4YFWA 1RVF1 5FP3A 1O3QA 4UFIA 4KU8A 1Q5OA 4QXHA 4YRDA 2VH9A 1G9BA 3N4MA 4MHUA 4TXWA 1JZ6A 2GMPA 2YPJA 4MVTA 1K42A 1COV1 5EYXA 4GH4C 4O9EA 1Q8PA 4BCUA 5C3PA 1XYNA 4NIDA 5IW0A 2ZEZA 1GBGA 4HONA 1QJX1 4JQTA 4YFZA 5K0UA 4LA2A 5FZGA 3BTZA 3THDA 1R082 5BNNB 3ZR6A 1JZ3A 1BZWA 2A73B 3N7MA 2OW4A 3HQXA 3WF1A 2JECA 4YZ3A 5E88A 4Q4V3 5FZOA 3SISA 5C9AC 3EHKA 1NX9A 4FQ4A 5FXWA 5L9RA 3MV11 3S30A 4PIZA 2ZGQA 5CIRA 3LGRA 3H8OA 4Q4W1 4QB1A 5JXJA 1F9KA 5FJHA 1VRH1 2ZGUA 3L2YA 1SCRA 2CHHA 3NMBA 1F8VA 1CD3G 4FPGA 3I3BA 4DS0A 2IXCA 1NA1B 4OUEA 4QDSA 3W5NA 3O1SA 3WW2A 5LWBA 4AI0A 5FYZA 1IQDC 1HKDA 5I0DA 4QPIA 2D6KA 3D4KA 3H0OA 3O12A 4JAAA 4L99A 4QQLA 3MIHA 5HCFA 2DCYA 3D3AA 4E4ZA 2XKPA 3UV9A 1UYYA 1TVGA 5F6LB 4EV0A 1UXXX 5IAXA 2WNVC 3HBZA 4N53B 2WQ4A 4XZPA 2VMEA 3JBG2 4WM8B 2C24A 4RSUA 1VRBA 5JSOA 2X09A 1ENXA 1W2NA 3ROUA 1T6GC 1O5UA 3FL7A 5A7OA 4DEVA 2X29A 1W0OA 5I8TA 1IS5A 3EO6A 4WV8A 4FTSA 2DWRA 1FNYA 5A33A 2ZHLA 1U12A 4XILA 3RVHA 4QPGC 5A3OA 3R6SA 3U37A 1E5IA 2UWCA 4B4QA 2XJQA 1EUTA 1PK6A 3N7KA 1I5ZA 3OYWB 5JXGA 3OD0A 2WYFA 2FDIA 5I93A 3K4ZA 1R083 4BK5A 1AR81 1AX0A 2VZTA 1WCDJ 1REDA 4PIYA 3ZXLA 5CKMA 2UY8A 3CZUA 4LIUA 2CDOA 3NAPB 3WY6A 1QH7A 4CXYA 1FT9A 1GMMA 4Q4X2 3U78A 1DYKA 4ZZ8A 2OPWA 1OA3A 1UU5A 4IE0A 4Y1ZA 1LULA 2H6CA 2YB7A 4IEPA 3M4FA 5K0UC 2ZHKA 4BA6A 1W6QB 4B8EA 4CCOA 4E4SA 1PX4A 2B4KA 2VR4A 1XYOA 4PT6A 4DO0A 5FPUA 3ZXDA 4DXSA 1YI9A 1SCSA 4DMIA 2W46A 3B02A 1W3VA 4KH9A 4AVCA 1ZRCA 2BBAA 4YG6A 4QPYA 4COVA 5CG8A 1CAXB 2VNVA 1C1LA 1S0IA 3KT1A 3MLJA 4GA9A 1XBFA 4KG0A 3ZFEB 4UI9L 1W03A 3ZYGA 1ULPA 3T1MA 1GLHA 1A34A 3JBG3 5C3QA 5E8AA 1SLLA 2XVGA 3BU7A 1US2A 1YUDA 1GU3A 1QKQA 1RMU2 3DPRB 4TWTA 5LK5A 1WZXA 4Y26A 3WW4A 4QPIC 5IVBA 1EAH1 3USUA 3OUJA 4B29A 5J09A 2WNUB 2ADEA 4B4RA 2DFCA 3AKPA 4E27A 5HI0A 3O1MA 4DQAA 3KD4A 4M3CF 2Q1ZB 2B7YA 3OUIA 1ND2A 4LBJA 3AX4A 4OCTA 3BALA 2WO3A 5K7PA 3CIHA 3IKWA 3PU8A 4COYA 3KQ4B 4ZPIA 3RNSA 4AGVA 2VZRA 3WDXA 4Z2WA 5KBFA 2BNNA 3CO2A 3PTRB 4MLOA 4Q4X3 3T09A 5L9VA 3PUHA 3CL1A 2FDJA 2ZEWA 3OEAA 4ISQA 4XJWA 3VHRA 1PK6C 5L36A 1IHMA 1ZRIA 4CCDA 2ZKLA 1WKYA 4KG8A 2HEVF 2DUQA 2ILMA 1O4YA 1LOBA 2QFEA 4OHWA 3MZHA 4GWNA 2W47A 3QCWA 1AX2A 2W1WA 3IDEA 4LITA 5FZAA 3IZOA 3VBFA 1NG0A 1OMIA 1XSQA 1IS6A 1PGL1 4XFGA 2HBUA 3J7HA 3AJYA 1UXZA 3LOBA 3VV1A 3I8TA 1MACA 4BJ0A 3WNLA 1W9FA 3MF9A 3SH3A 4L97A 2JE9A 4GKYA 4XFIA 1AJKA 3WDUA 3VDCA 4HPKA 3GZTB 1FNZA 4NWVA 1IPSA 5FZHA 1JYXA 2W68A 1RMU3 4XQWA 5A7WB 4XUNA 2GC2A 1ZRDA 1ENSA 2J1TA 1YQ8A 4N9HA 1NUKA 1AL0G 1C5IA 1LOCA 1RUF2 4ATEA 4GWJA 1LGBA 5FUPA 4D7YA 2ET1A 5EP9A 1UD1A 4OMDA 3S5QA 3DYPA 5LBBA 1W0PA 2WWJA 4MV2A 1V6MA 4HKLA 4YNIA 1GZCA 5E1RA 1R081 4D3WA 2HWD2 1G8WA 5JOWA 2VOKA 3HN1A 4CCNA 2XVKA 3ZSMA 2E53A 3AMHA 3ILRA 3G7DA 1YWKA 5LBCA 1PNFA 3SKJE 1ND2C 4NAOA 2W94A 5SV8A 1MS5A 1S0JA 2IVJA 2VMIA 2EALA 2MHFA 3N9PA 4MHRA 1ULFA 1PM4A 3AK0A 3B00A 4IQPA 4BZ4A 5HCHA 5FLHA 3RZMA 1OLRA 2R072 5GJ6A 2WLPA 4BOWA 3CKHA 5JDBA 1GSLA 4FOWA 1Y4WA 1GNHA 3SEPA 1ODMA 1ND3B 2Q1FA 4LUMA 3UYJA 2DURA 1Z78A 4CEYC 5FR3A 3S5AA 2WQ8A 4XJ9A 3VBFC 3H7YA 5C3RA 1OD5A 2ZX2A 3CF6E 3H1YA 2K2SA 4ATFA 3LWCA 4CDWA 3IPVA 3AYEA 4QKNA 2DYCA 5A32B 3JBG1 3N9QA 3SLIA 1QXRA 1SBFA 1F2NA 3AKRA 4XMIA 2ZACA 4QHOA 3APBA 2GNMA 4Q8KA 3KVAA 3A0KA 4JRAA 2VVEA 4N7UA 2CWSA 5CAZA 2X53S 4RN5A 2NPIA 3EYPA 4IEUA 5DUUA 1RUF3 3MBWA 1ENQA 2VUAA 4JDNA 3RZLA 2F4PA 3GALA 2BW8A 2DU1A 5FMOL 4LHKA 4G9SB 5JVVA 5H9QA 1V9U2 4TLFA 2D6NA 2K46A 4GMP3 2GN3A 2PHRA 4NRMA 1ZRRA 2OA2A 3B94A 3IM0A 4JKLA 4META 4XF3A 3LFMA 4KWUA 2WNOA 1W06A 1NLSA 2UWBA 3AM2A 3PJQA 2HWD3 5L9BA 4FPCA 5A70A 2LALA 2RG4A 4LTAA 4O9GA 4D6QA 1VAMA 5BNQA 2D40A 3ZSEA 5I0RA 1IQAA 4Q4X1 2VGDA 4UT5A 3FMGA 1W6OA 2BNOA 2SLIA 2XLGA 2W9XA 2Z2SB 2VCAA 2R073 3IDBB 3KGLA 3DYMA 2PHWA 3ZMOA 1ASJ2 4DRRA 5FRAA 4YGEA 1OQDA 4QU1A 5HPOA 3DKWA 4G3YC 1VE0A 1Y9MA 3U11A 4NVPA 2VBDA 3ZFGB 4CEWA 3ECQA 1JZ2A 1H9WA 1O3RA 1HRI2 4A7ZA 4GJZA 2R042 1W8FA 4WVZA 4A3XA 3J4UH 1UYPA 4EZHA 1K5MA 4Y1YA 1AJOA 2CDPA 4P9IA 5KHGA 1DGWA 4YW1A 2YGLA 3AB0A 5LASA 1RMU1 5DAPA 5FY1A 4AG4A 1J1LA 2PHDA 2DCZA 4JKMA 4MGKE 4RGKA 3AFGA 2Y33A 5AFEA 3Q8BA 4TN7A 2ARXA 3DEMA 4GMP0 4AFCA 4CZSA 3AYCA 3W59A 4CDWC 1F4AA 2VMDA 1V9U3 2WZ8A 2HJIA 1G9CA 1SG3A 2RJ2A 1U5YA 1DLCA 2VU9A 4IV3B 3TEWA 4NPRA 1L7LA 1UZWA 4Y24A 1WMEA 3ETPA 4RS5A 4BH9A 5K8SA 2WBKA 2VOTA 1A6CA 1LOAA 4JGYB 4LBOA 3POWA 4MX3A 4PLOA 1OVSA 5JMOA 4XPVA 3PIJA 1VR3A 1G86A 1UW8A 1RYYA 3HR9A 4QHZA 2XL7A 4COUA 1NYWA 4YM2A 4F3JA 4H2AA 2OIIA 2WL1A 1H0BA 1ZM1A 4JDMA 1UNBA 2E9QA 3CDZB 1X8MA 3C7HA 2JE8A 1H4GA 5JR7B 3P3PA 4Z2AA 3KHBA 2UYBA 1WLWA 2WWSA 1ASJ3 1BBT2 1UU4A 1QU0A 1XNDA 2ZMKA 3HT2A 3KCXA 5FZ0A 1JOBA 3RJRA 2E32A 1HB4A 4CDXA 2DCKA 3CEWA 2Y0OA 3DXTA 4K9SA 5D1IA 2IUWA 1YO8A 3POSA 1HRI3 2BJSA 5LK7B 1RJ8A 1SFPA 2R043 4BQ4A 4G4FA 4X8PA 5FZ3A 1XSRA 4AQTA 2Y60A 4OQ8A 3R05A 4BB3A 4CXWA 3MW3A 2VNOA 4WM7A 3ZN4A 1E5SA 3DKQA 1JU4A 3GHMA 3VBUC 4Y4RA 3VUOA 5CB7A 1PZ8A 1SHWB 4OHVA 5A3UA 3BI3A 4CEWC 1OUXA 1XYPA 4GKXA 1RUF1 4LUKA 4N8MA 4XFCA 4EN9B 5B4XA 1ZBE2 1K5MC 5DPNA 1RHI2 2D44A 2PQSA 1JYIA 3SQOA 1GQPA 5CVRA 3M3CA 3POJA 1YFWA 5ISLA 3WP3A 4I0AA 5DZGA 2JG8B 4W4ZA 3WW1A 1POV0 1NZIA 2D43A 3CNAA 4KNCA 4LHLA 5IWFA 1IG0A 2XKOA 2C9KA 2HWD1 1C3HA 5J96B 2W87A 4OVEA 3TNQA 5KC5A 2KR2A 5T5LA 2JB4A 3PL0A 2YBKA 2WN3A 2RS52 2Y0IA 2ARBA 1HJFA 5BNNA 2ZEYA 2JXAA 1DYOA 5F39A 4Z8BA 2B39A 4XF9A 4RS5C 5EXOA 2CGNA 5EYYA 2UYAA 1K45A 3HT1A 1BBT3 2XMLA 2D98A 3UJOA 4M4PA 4BLJA 5DG1A 2ZAHA 2R071 4GXLA 1XU1A 5A80A 1MZ5A 2GAUA 3M3IA 3C7FA 1RUE2 2D7FA 3VZLA 2BU9A 3OGVA 1NA1A 2XUMA 5A3NA 3THCA 5C3SA
chains in the Genus database with same CATH topology
5FY4A 2XDVA 5LY1A 3N9MA 5FPAA 4GJZA 4AAPA 4EZHA 5A1LA 3PUAA 5FZDA 5FZHA 5IVVA 5FPLA 1VRBA 5A7WB 5FY1A 2XXZA 4EZ4A 5A7QA 4UF0B 5F2WA 5A7WA 3OPTA 5A7OA 3N9OA 4TN7A 5ANQA 5A3TA 4UF0A 3PURA 4AI9A 4LIVA 4NUBA 5F3EA 5FBJA 5FUPA 4V2VA 3RVHA 3KV9A 5FZ8A 5FYVA 2WWJA 3LD8A 4LXLA 3AVRA 5IVEA 4QWNA 3K3OA 5FWEA 3KV6A 5LY2A 5FP4A 5FV3A 5IVFA 4DIQA 5F5IA 5FP8A 4CCNA 4LIUA 2Q8DA 4GD4A 2OT7A 2OS2A 4Y33A 3U78A 3LDBA 2OQ7A 5LW9A 2Q8EA 2GP5A 5FXVA 3NJYA 4XDPA 4BXFA 5FYUA 5FY7A 5FXZA 2PXJA 3ZPOA 3N9PA 5FUNA 4QXBA 4BISA 5FYMA 3PUQA 5F3IA 4CCOA 4DO0A 5FZ0A 5FY0A 5FYSA 2YU1A 5FPUA 4GJYA 5FZEA 5KR7A 3K2OA 3DXTA 5FYBA 2VD7A 2W2IA 3AVSA 5F3GA 3UYJA 5FZIA 3AL6A 3KVBA 4E4HA 3K3NA 5FP7A 5A3WA 4IGOA 5FWJA 2WWUA 2OQ6A 5FZ3A 5F5CA 5FZCA 5FXXA 3N9QA 3KV5A 2GP3A 4ASKA 4EYUA 3KVAA 5FPVA 4QX8A 5FYYA 5K4LA 3AL5A 5FZ7A 5F2SA 4Y4RA 5IVBA 4CUGA 2YBPA 4XDOA 5FP9A 4IGPA 3PUSA 5FYHA 4CCLA 5FP3A 2P5BA 5E6HA 4CCJA 4D6RA 5A3PA 4QXHA 3DXUA 4V2WA 4CSWA 3OPWA 3ZLIA 5ISLA 4HOOA 4QXCA 5F37A 5FY8A 2YU2A 4HONA 5FZMA 5IW0A 5FZFA 3PU8A 2Q8CA 5IWFA 5FYCA 5FYTA 5FZGA 5A7SA 5FY9A 3KV4A 4C8DA 5FZLA 4IGQA 4D6QA 5FZKA 5FZOB 2YBSA 3PTRB 4QX7A 4BU2A 5FZ9A 2YBKA 5A7PA 5FZBA 5FZ1A 5FZOA 3N9LA 5F39A 5FXWA 5F3CA 4CCKA 3N9NA 5FZ6A 3PU3A 2YPDA 3PDQA 5F32A 5IVCA 5F5AA 4Y3OA 2XUEA 5FJHA 2XMLA 4LITA 5FZAA 4D6SA 5CEHA 4CCMA 5FZ4A 4GAZA 3U4SA 5IVJA 5FY5A 4URAA 5A80A 5FJKA 4QU1A 5IVYA 5A7NA 5LWBA 5FYZA 5A1FA 5A3NA 5FYIA 2OX0A 5FPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY4 A;  2XDV A;  5LY1 A;  3N9M A;  5FPA A;  4GJZ A;  4AAP A;  4EZH A;  5A1L A;  3PUA A;  5FZD A;  5FZH A;  5IVV A;  5FPL A;  1VRB A;  5A7W B;  5FY1 A;  2XXZ A;  4EZ4 A;  5A7Q A;  4UF0 B;  5F2W A;  5A7W A;  3OPT A;  5A7O A;  3N9O A;  4TN7 A;  5ANQ A;  5A3T A;  4UF0 A;  3PUR A;  4AI9 A;  4LIV A;  4NUB A;  5F3E A;  5FBJ A;  5FUP A;  4V2V A;  3RVH A;  3KV9 A;  5FZ8 A;  5FYV A;  2WWJ A;  3LD8 A;  4LXL A;  3AVR A;  5IVE A;  4QWN A;  3K3O A;  5FWE A;  3KV6 A;  5LY2 A;  5FP4 A;  5FV3 A;  5IVF A;  4DIQ A;  5F5I A;  5FP8 A;  4CCN A;  4LIU A;  2Q8D A;  4GD4 A;  2OT7 A;  2OS2 A;  4Y33 A;  3U78 A;  3LDB A;  2OQ7 A;  5LW9 A;  2Q8E A;  2GP5 A;  5FXV A;  3NJY A;  4XDP A;  4BXF A;  5FYU A;  5FY7 A;  5FXZ A;  2PXJ A;  3ZPO A;  3N9P A;  5FUN A;  4QXB A;  4BIS A;  5FYM A;  3PUQ A;  5F3I A;  4CCO A;  4DO0 A;  5FZ0 A;  5FY0 A;  5FYS A;  2YU1 A;  5FPU A;  4GJY A;  5FZE A;  5KR7 A;  3K2O A;  3DXT A;  5FYB A;  2VD7 A;  2W2I A;  3AVS A;  5F3G A;  3UYJ A;  5FZI A;  3AL6 A;  3KVB A;  4E4H A;  3K3N A;  5FP7 A;  5A3W A;  4IGO A;  5FWJ A;  2WWU A;  2OQ6 A;  5FZ3 A;  5F5C A;  5FZC A;  5FXX A;  3N9Q A;  3KV5 A;  2GP3 A;  4ASK A;  4EYU A;  3KVA A;  5FPV A;  4QX8 A;  5FYY A;  5K4L A;  3AL5 A;  5FZ7 A;  5F2S A;  4Y4R A;  5IVB A;  4CUG A;  2YBP A;  4XDO A;  5FP9 A;  4IGP A;  3PUS A;  5FYH A;  4CCL A;  5FP3 A;  2P5B A;  5E6H A;  4CCJ A;  4D6R A;  5A3P A;  4QXH A;  3DXU A;  4V2W A;  4CSW A;  3OPW A;  3ZLI A;  5ISL A;  4HOO A;  4QXC A;  5F37 A;  5FY8 A;  2YU2 A;  4HON A;  5FZM A;  5IW0 A;  5FZF A;  3PU8 A;  2Q8C A;  5IWF A;  5FYC A;  5FYT A;  5FZG A;  5A7S A;  5FY9 A;  3KV4 A;  4C8D A;  5FZL A;  4IGQ A;  4D6Q A;  5FZK A;  5FZO B;  2YBS A;  3PTR B;  4QX7 A;  4BU2 A;  5FZ9 A;  2YBK A;  5A7P A;  5FZB A;  5FZ1 A;  5FZO A;  3N9L A;  5F39 A;  5FXW A;  5F3C A;  4CCK A;  3N9N A;  5FZ6 A;  3PU3 A;  2YPD A;  3PDQ A;  5F32 A;  5IVC A;  5F5A A;  4Y3O A;  2XUE A;  5FJH A;  2XML A;  4LIT A;  5FZA A;  4D6S A;  5CEH A;  4CCM A;  5FZ4 A;  4GAZ A;  3U4S A;  5IVJ A;  5FY5 A;  4URA A;  5A80 A;  5FJK A;  4QU1 A;  5IVY A;  5A7N A;  5LWB A;  5FYZ A;  5A1F A;  5A3N A;  5FYI A;  2OX0 A;  5FPB A; 
#chains in the Genus database with same CATH topology
 3J26 N;  2VVD A;  1ZBA 2;  3WV6 A;  1W8O A;  3B9I A;  3P3N A;  2EF6 A;  2G4I A;  3PUA A;  4ARY A;  2MEV 2;  4XF1 A;  2XH6 A;  3VN4 A;  5FPX A;  4CDX C;  4N53 A;  4BQ2 A;  1BK1 A;  2XXZ A;  3HPN A;  4WM8 A;  3WG4 A;  1DHK B;  2EID A;  2JDK A;  1UOB A;  2QQM A;  2YHJ A;  5GLV A;  3IMN A;  1ZBE 3;  2WZP P;  1RHI 3;  1LKN A;  1BK0 A;  1S1A A;  3Q8A A;  5JAX A;  3KV9 A;  1V9U 1;  1MVQ A;  1UMI A;  3JQW A;  4WM7 C;  3ATG A;  4Y1V A;  1GAN A;  5GLZ A;  5A6Z A;  3WHU A;  3OBR A;  5FCC A;  2QQN A;  1WLT A;  3OYW A;  3T0D A;  4FVV A;  2EXK A;  3WSO A;  2BQP A;  3T4V A;  4BM8 A;  3KV6 A;  4LNV A;  4QT6 A;  1C28 A;  2RS5 3;  1DQ6 A;  1QOO A;  4HFS A;  2VQT A;  2ZX1 A;  1TQ5 A;  1Z7S 2;  1YCI A;  3T30 A;  1Y3T A;  4GD4 A;  4RGG A;  4LKF A;  3NAP A;  3WQ0 A;  3AJZ A;  1H4H A;  2ES3 A;  4W6X A;  4DUW A;  5FMB A;  3LEK A;  3S7E A;  3I54 A;  4MXW B;  4XYX A;  3RMY A;  4KBB A;  4LBL A;  4EE2 A;  2PLV 2;  3P1I A;  2VTF A;  1ASJ 1;  2VCB A;  3T2T A;  2TBV A;  1W6Q A;  4HVR A;  3I4I A;  3URF A;  1RUE 3;  3GXU A;  5BNN C;  4JTO A;  1BJQ A;  1ODN A;  5LCW L;  1W28 A;  2IXL A;  1ZA7 A;  3SH5 A;  4CDQ C;  5C71 A;  3K2O A;  2ZA9 A;  2VD7 A;  2BV4 A;  5H9S A;  4UXA A;  1OQ1 A;  1UAI A;  1ZBA 3;  1S4C A;  4HKW A;  2PHT A;  4YM1 A;  3AYD A;  1CAX A;  4NR1 A;  1YLL A;  1HRI 1;  2FHR A;  4XUP A;  3ZFE A;  2R04 1;  4AHY A;  1AZD A;  1YC6 1;  1RUN A;  1UY2 A;  3NV3 A;  4LBK A;  3OD4 A;  1L7Q A;  4MGT A;  4KWJ A;  1LOE A;  4ASK A;  5ANN A;  1NA1 C;  1RL3 A;  2JDN A;  2RR1 2;  1LAJ A;  4XFH A;  2FDF A;  4Q0U A;  1W90 A;  4OYU A;  2F6B A;  2WSV A;  3DPR A;  1GR3 A;  4XDO A;  5JOY A;  4IGP A;  3EXU A;  1J1T A;  2BZD A;  1OUS A;  1HB2 A;  2VUJ A;  2BGC A;  4QMA A;  4XFB A;  3RG0 A;  3ZKU A;  3BTA A;  4OHY A;  2B9U A;  2WII B;  3BOW A;  3DXU A;  4OLL A;  1W3X A;  2VCC A;  1UPI A;  3WF4 A;  2WNU A;  4TTG A;  3PUI A;  5L19 A;  4LHN A;  4CPB D;  2QQP A;  4CRQ A;  4N53 C;  5GAL A;  4ZS3 A;  2WJS A;  3RPQ A;  4WM8 C;  4DXR A;  2RS3 2;  5F37 A;  1MQT B;  1XNB A;  1XPW A;  4S2H A;  1PMJ X;  4CUB A;  3TEZ A;  2JG9 C;  4HN0 A;  1RC6 A;  5EJ3 A;  1QY4 A;  4B1M A;  5FKB A;  5A6Q A;  1CPN A;  1V6J A;  1Z7S 3;  1JOJ A;  4AVS A;  2WZE A;  2PHL A;  4BU2 A;  3OY8 B;  1HV1 A;  1RGS A;  3GBF A;  4S2D A;  3RZG A;  5EJZ B;  2IXK A;  4AAX A;  2JEM A;  4HT1 T;  1A3K A;  1W8U A;  4JRL A;  1PGS A;  3B01 A;  3NNJ A;  3O0W A;  2PLV 3;  5D21 A;  3U75 A;  1Y7B A;  1BBT 1;  3FUQ A;  4LEJ A;  4O61 A;  2VZQ A;  3PTY A;  4W6W A;  3WP5 A;  1CQ9 A;  5IVJ A;  5G05 L;  4OHX A;  5FJK A;  3KS7 A;  3PLQ A;  4XAC A;  3NAP C;  1F5F A;  5JZG B;  2A6V A;  1OXC A;  3TB0 A;  2EAK A;  4XW3 A;  5FPB A;  2YV8 A;  5J48 A;  2W08 A;  4IES A;  2DVA A;  4FPK A;  1F35 A;  3QOP A;  1C8N A;  2VMH A;  4QQH A;  4AI1 A;  4YYO A;  2P3K A;  2YC2 A;  5FZD A;  2XB6 C;  4LE3 A;  5IVV A;  3WX5 A;  1F15 A;  2VZS A;  3ZYF A;  2QZ2 A;  1MS0 A;  3FFZ A;  2P34 A;  2XGX A;  2WFF 2;  3B3Q E;  5A7W A;  1OH3 A;  5GZC A;  3QAC A;  3B93 A;  3OJB A;  1V6O A;  1W0N A;  1VRH 3;  4YZ5 A;  3ACG A;  1ULC A;  3HMY A;  3ZFE C;  4CU9 A;  1ZBE 1;  5DG2 A;  2BOI A;  1UPS A;  3ZXG A;  4I2O A;  1RHI 1;  5IK8 A;  4MGS A;  1TMF 2;  3GBW A;  2CSG A;  2RS3 3;  2ZX4 A;  1DYP A;  3AKT A;  2H0V A;  2UU8 A;  1S2E A;  3DPR C;  2ZGN A;  3LPG A;  3DUI A;  3E1F 1;  4UWD A;  2VCM A;  2JDA A;  4QAW A;  3BGA A;  5JIU A;  1W8N A;  4YM3 A;  2FQP A;  2RS5 1;  3GCW A;  2WNU C;  3LQC A;  4A6S A;  3DEC A;  2XQX A;  4IW3 A;  3WVJ A;  4MGY E;  3JU9 A;  4DEQ A;  1J84 A;  4XDP A;  1ZYB A;  2R1B A;  2V4V A;  3L2H A;  3I2K A;  3ZPO A;  4XZU G;  3LF7 A;  2ZGP A;  1JN2 P;  5D8A B;  5DUX A;  4LHS A;  2YU1 A;  3GYD A;  4GJY A;  4ES8 A;  1RUE 1;  1AYN 2;  3V65 A;  4CXX A;  1UZZ A;  3AXE A;  3EBR A;  3MDP A;  1UY1 A;  5FYB A;  1AVB A;  4QKF A;  3A7Q A;  3AVS A;  5F3G A;  1PMH X;  3WG3 A;  1ZBA 1;  2XG3 A;  4XAA A;  1ND3 A;  2WT0 A;  5JIA A;  1TE1 B;  1SLB A;  3NWK A;  1BXH A;  4AOC A;  4KWL A;  5C7G A;  2MEV 1;  2QZ3 A;  2VO5 A;  3IBM A;  2BDR A;  2E33 A;  5A32 A;  4QX0 A;  2WFF 3;  5DUW A;  3OB8 A;  4CA9 A;  2C1F A;  1HRV 2;  1POQ A;  1MS9 A;  3V0A B;  1XNA A;  2UWA A;  4EWD A;  3WNK A;  3RRD A;  2A1X A;  1TMF 3;  4CSW A;  4XEZ A;  1CAU B;  2XBO 2;  4P5H A;  5FMO S;  4LQR A;  3NNL A;  4BQW A;  2FDH A;  3HEI A;  3ZLI A;  4CYD A;  1KRI A;  4JHZ A;  4J25 A;  4A44 A;  2LW8 A;  2WO2 A;  1UX7 A;  4QGM A;  4ZS2 A;  2PA7 A;  2RS1 2;  3VZO A;  3AMN A;  3VBH B;  2HH9 A;  4KGG A;  3ITQ A;  3KF3 A;  3ME2 A;  4PCR A;  2P3I A;  5A7S A;  5CA6 A;  5HCA A;  2ZBJ A;  3WG1 A;  1Z7S 1;  1NCR B;  4OMC A;  2ID4 A;  5HBA A;  2R16 A;  3T4H B;  4BMB A;  4OZX A;  2HLE A;  3K77 A;  4XJA A;  3QH6 A;  4A7K A;  2DU0 A;  2QQI A;  4LK6 A;  1ZZC A;  4B7K A;  3VKF C;  3AZX A;  2PLV 1;  3AZZ A;  1DGR A;  5EHD A;  2Q4S A;  1RXF A;  3HAG A;  2K9Z A;  4AL9 A;  3POB A;  1AYN 3;  4ZU5 A;  1OOP C;  2ZCW A;  1FMD 2;  2DCT A;  3FLT A;  5A7N A;  1IOA A;  2A7A A;  3O1U A;  5GM0 A;  4AFA A;  4UW3 A;  2VXR A;  2ZEX A;  4QX2 A;  2ZHN A;  4YW3 A;  5DMY A;  4P9L A;  5FPA A;  4ORF A;  1RUJ 2;  3ZFG A;  1PO1 2;  2BRT A;  5BXX A;  5A1L A;  1DQ5 A;  1SMV A;  1ULO A;  3NNG A;  2JKX A;  3OBA A;  5JR2 A;  3MO4 A;  4XMA A;  3NL1 A;  1URX A;  3V56 A;  2RR1 1;  2CWM A;  3BIW E;  5HCB A;  2XJU A;  1D4M 2;  4IEX A;  1CR7 A;  4UF0 B;  3PIG A;  3WIN E;  2V73 A;  4L2N A;  1W6N B;  1GP5 A;  5FAX A;  5IFT A;  1ND3 C;  2ZMN A;  4IDZ A;  3AZW A;  1SDW A;  4YAR A;  4LIV A;  1P8J A;  3NJV A;  1A8D A;  2XBO 3;  1HX6 A;  1S0C A;  1AXK A;  1T2X A;  4YVS B;  2W3J A;  1YIP A;  4H14 A;  3I2O A;  4NAM A;  1X33 A;  3VD9 A;  2J42 A;  1EPZ A;  1QHD A;  2RS3 1;  3FBY A;  3LE0 A;  4YW4 A;  5LEJ A;  4IV3 A;  1QH6 A;  3VBR C;  1JZ4 A;  3AVR A;  2QQV A;  3RMX A;  4CUA A;  1WGP A;  3PJY A;  4QWN A;  4JGY A;  5FP4 A;  2GZW A;  4DIQ A;  1WCQ A;  4XUT A;  4YWA A;  2W1S A;  1NXD 1;  2Y6G A;  4A7Y A;  5ABJ B;  1AL2 2;  4R9B A;  1V6L A;  3ZYJ B;  4HN1 A;  5GZF A;  3H8U A;  5FXV A;  3E97 A;  2RMU 2;  1H8T B;  3RJ2 X;  4I01 A;  5FYU A;  5FO9 B;  2PXJ A;  2WKK A;  2ETE A;  5H9P A;  5A1A A;  3UNP A;  1FMD 3;  1US3 A;  3MF6 A;  2F4L A;  1UKG A;  4PBP A;  1YQ5 A;  4QX5 A;  3VZK A;  4L0P A;  3VB9 A;  1SBE A;  4PDW B;  5KHJ A;  3TN9 2;  5SV5 A;  2P37 A;  3JD7 2;  1W6P B;  4FFF A;  3KVB A;  1PO1 3;  1E57 A;  3KM5 A;  5EQU A;  1PGW 2;  4QXK A;  4DNY A;  4F7Z A;  3ZR5 A;  2A6X A;  1HB3 A;  3IDC B;  3ZXF A;  2JDY A;  2R0H A;  1HIX A;  1SFN A;  5IUQ A;  3AL5 A;  4HET A;  4BIO A;  2V72 A;  1F5J A;  1PVC 2;  1QXJ A;  2WFF 1;  1HN1 A;  4Q0P A;  4RFR B;  1YHF A;  3MGU A;  3ON7 A;  3RYP A;  4XC9 A;  4Y1U A;  2WO7 A;  4H7M A;  4RR3 B;  1IGO A;  5JI9 A;  2FCU A;  2LS6 A;  4MGZ E;  3ZFG C;  3OPW A;  1TMF 1;  1XNC A;  2A75 A;  2HYX A;  4PQQ A;  2ZPX A;  4XOG A;  2GC0 A;  2JKB A;  3U1X A;  4SLI A;  4HOO A;  3MPP G;  4Q27 A;  4AQ6 A;  3ENR A;  1YRZ A;  2RDR A;  2VW2 A;  4M01 A;  3VD7 A;  2JG8 A;  5GZG A;  1V00 A;  1VMF A;  4W6Y A;  3THT A;  4BXS V;  4Y1X A;  4Z1V A;  4QX7 A;  2KM2 A;  4BQ1 A;  5LZ6 A;  1AL2 3;  3WNO A;  1UCX A;  4E2G A;  5IK5 A;  1RIT A;  5JUV A;  1REF A;  2RMU 3;  1SDD B;  3PHM A;  4EWE A;  3KLS A;  3SMH A;  1LOD A;  4LBM A;  4K7J A;  5ERL A;  3AMQ A;  4NIA A;  4Y3O A;  3O1O A;  4LJH A;  1V70 A;  4FI9 A;  3CHX A;  4JGY C;  4BQ3 A;  5CEH A;  5T55 A;  2IVI B;  3RZH A;  1CJD A;  4XHB A;  4OI0 A;  1F31 A;  3RWN A;  2IXH A;  4FO9 A;  1AYN 1;  2YZ4 A;  1NLQ A;  3B69 A;  5APA A;  3TN9 3;  1TEI A;  3JD7 3;  5I0T A;  2QCS B;  3O1T A;  2C5D A;  3AXD A;  4E2Q A;  2CGP A;  4OI4 A;  2B45 X;  4XQ4 A;  3H50 A;  3FHA A;  4AAP A;  3ZO0 B;  5FOJ B;  2VVF A;  1Y9G A;  3VZJ A;  1ONA A;  4MO3 M;  3TEX A;  4F8A A;  3I2J A;  1E5R A;  1PVC 3;  2QJV A;  4IE6 A;  3FJS A;  3ES1 A;  4P9J A;  1JHJ A;  4YSF A;  2I45 A;  4CDU B;  1HRV 1;  4XE9 A;  3SC7 X;  1LRH A;  3MFA A;  5CKN A;  1JUH A;  3WT3 A;  2B8M A;  1PZ7 A;  2PYT A;  3ZDV A;  1L3J A;  3FLR A;  5FBJ A;  1V6I A;  3FZ3 A;  3LPF A;  2XBO 1;  2E6V A;  2ZGO A;  5FMD A;  4BWO A;  1LEN A;  2XJV A;  4PI0 A;  2IC1 A;  3EMR A;  3WP6 A;  1DGR N;  2RS1 1;  4AWD A;  4D8M A;  3VBS B;  2XJS A;  4H55 A;  2BOJ A;  5LA0 A;  1UMZ A;  3BVC A;  1NLR A;  1OKQ A;  4XUO A;  2XLA A;  5HV4 A;  2JB8 A;  5FP8 A;  2A6Y A;  4I0B A;  4B1L A;  1CZT A;  2XHK A;  4J6G A;  4JZR A;  1DU3 D;  1W2U A;  4Q0S A;  4BE3 A;  2NYY A;  2PAM A;  3I2D A;  2BVB A;  2ZGS A;  4DOU A;  2OZJ A;  2WN2 A;  3NST A;  3ILF A;  4QB6 A;  2KA3 A;  2EVX A;  5F3I A;  3R4U A;  4MXW A;  5CG9 A;  3WQ7 A;  2JIC A;  1SFY A;  2VNR A;  1X50 A;  4FT8 A;  4NRQ A;  4FBF A;  1FMD 1;  2FMD A;  2TEP A;  4YVW B;  1VB4 A;  3HOB A;  4UW4 A;  1RUI 2;  5IFP A;  4AEJ A;  2B5H A;  2IFW A;  4X6Q B;  3M2M A;  1ZVF A;  3ASI A;  4IEY A;  1W9T A;  1RUJ 1;  1NE4 A;  1PO1 1;  4BME A;  1GYK A;  5FWJ A;  1PO2 2;  3MIE A;  3HQU A;  4YM0 A;  2V5D A;  4U36 A;  3MV0 1;  5T54 A;  2P3J A;  3BOD A;  3WUD A;  3TEY A;  1QIQ A;  3VDB A;  4NE9 A;  4TLG A;  4CCJ A;  1D4M 1;  4HLT A;  4UOJ A;  2FCT A;  5A6X A;  1FOD 2;  4R4X A;  2JJ6 A;  1EPW A;  1S55 A;  1ZZ8 A;  3ZIW A;  3A4U A;  1WW4 A;  2G1M A;  4M3C E;  5E6H A;  1W2O A;  2ZHM A;  5AVA A;  2WO1 A;  2D3P A;  4I30 A;  1LOF A;  2D3R A;  2J1R A;  3FLP A;  3WHT A;  3WP4 A;  2CGO A;  3MUZ 1;  5LA1 A;  2Y6K A;  3W21 A;  1RUH 2;  3IN9 A;  2A70 A;  4PF1 A;  4XTM A;  1RUD 2;  3UJQ A;  3WG2 A;  1MQT A;  4NIH A;  2Y6J A;  3PVB B;  3A21 A;  4CU6 A;  3W58 A;  4IEQ A;  1HB1 A;  1QQP 2;  5IAV A;  3U14 A;  2O8Q A;  1AL2 1;  1QJU 2;  5LA2 A;  3SHR A;  2C6S A;  2E31 A;  1GOG A;  2RE9 A;  2NZ9 A;  3H9A A;  3OY8 A;  4CCK A;  5C5U A;  3WXP A;  2RMU 1;  3T0B A;  2OPK A;  3PDQ A;  2WA3 A;  2VTX A;  2XUE A;  3ACF A;  1J3P A;  5HXM A;  1GQH A;  1OH4 A;  5C9A B;  4CCM A;  1O4T A;  2N7G A;  1JTZ X;  1EV1 2;  3JUU A;  3UGF A;  3ZYI B;  1Q8O A;  5BNO B;  1RUI 3;  2GH2 A;  1K12 A;  2WLQ A;  3I7D A;  4Q2F A;  4FCA A;  1KIT A;  3TN9 1;  4NO4 A;  3JD7 1;  4HG6 B;  4FXG B;  5FYI A;  5JZG A;  4K6B A;  2EIE A;  1W9S A;  1UWW A;  1PO2 3;  1PGW 1;  1OLM E;  3LEM A;  2R06 2;  3GNE A;  4QM9 A;  2HWE 2;  2GN7 A;  4WZF A;  3C7G A;  1OPO A;  4M3C B;  4Q5O A;  2ARC A;  1LEM A;  2YC4 A;  1YQ2 A;  1FOD 3;  3JCI A;  1PVC 1;  4Z82 A;  4AXO A;  1IZ3 A;  3BTX A;  3FN9 A;  4P14 A;  2XJP A;  1DP0 A;  1GP4 A;  2XON A;  4W8J A;  4IE5 A;  1UO9 A;  4JC1 A;  2YDE A;  4UW5 A;  3VKM A;  2VW0 A;  1VJ2 A;  1RUH 3;  1IS4 A;  1WLD A;  2VC9 A;  5C4W B;  1PNG A;  4MYE A;  1W05 A;  1C5H A;  1CAW A;  5HV0 A;  1CGP A;  1IS3 A;  1STM A;  2VAU A;  1O59 A;  1QQP 3;  3ZPY A;  5IVF A;  3JQX A;  1QJU 3;  3DN7 A;  4E8D A;  1H1I A;  1JXN A;  1LOF C;  1OA4 A;  2WT1 A;  1VBE 2;  5T5O A;  2ZAB A;  2Q8D A;  2ZML A;  4MGQ A;  4LBQ B;  4AVV A;  1LB2 A;  1NT0 A;  3NJY A;  2O0O A;  3TWI A;  1UZV A;  5BYN A;  3H3U A;  4RA0 A;  3T0A A;  2FD8 A;  2GNT A;  4BIS A;  1G7Y A;  1FYU A;  3KT4 A;  5JLV A;  5DUV A;  2AEY A;  2Y8K A;  1W2A X;  4FQZ A;  1MZ6 A;  2CV6 A;  4R9C A;  5D8A A;  1QJE A;  1JZ7 A;  2G19 A;  3J7N A;  3VHP A;  1MPX A;  1PZ9 A;  3AC0 A;  4QQO A;  3VD5 A;  4Y20 B;  2J1E A;  3SKV A;  5IK7 A;  4OI1 A;  3AFK A;  4AVB A;  2R06 3;  5DAW A;  4TZD A;  3CQO A;  4NN0 A;  2HWE 3;  3KGZ A;  1QXP A;  2P1B A;  5F5C A;  5F6K A;  5FXX A;  3ZDS A;  5JMC A;  4EYU A;  4DPN A;  4QDQ A;  5AFB A;  4IE4 A;  2P6H A;  5FZ7 A;  1HW5 A;  1BQP A;  3G6J B;  3FWE A;  3OSD A;  3USS A;  2XOM A;  4N7I A;  5BV6 A;  4QQP A;  2VMC A;  2BGO A;  2VEC A;  1W04 A;  3SXW A;  2JDH A;  4BPZ A;  1RXG A;  4K21 A;  1AR6 2;  3V0A A;  4FP2 A;  5JXH A;  2D97 A;  3JB8 A;  4ZHN A;  1GIC A;  1LES A;  1CAU A;  1W8H A;  1I6X A;  4AFM A;  4EQV A;  1S2K A;  5FZM A;  2QQW A;  3WW3 A;  5CFC B;  3DL3 A;  1H9P A;  1Q8Q A;  2ENR A;  3ZXE A;  1JYN A;  1AYM 2;  3LCP A;  4QKB A;  3U4X A;  2QUO A;  3VBH A;  3JZV A;  4C90 A;  4CCE A;  1VBE 3;  2VXJ A;  5L7O B;  2BWA A;  1NCR A;  4NPL A;  4XCA A;  1D2Q A;  2QQK A;  2GMM A;  4RGA A;  4XAB A;  5F5A A;  4FPF A;  3HNM A;  3MW4 A;  4L9B A;  2P6C A;  1YFX A;  4IEO A;  4D6S A;  4XBQ A;  4MUV A;  2OYZ A;  3BPS A;  1DGL A;  2Y6F A;  3U4S A;  3F2Z A;  2ADD A;  3ZXJ A;  4D0Q A;  5LEK A;  5C70 A;  3O1P A;  3BUC A;  5A1F A;  3IAQ A;  4B4P A;  5C5T A;  1RUI 1;  2Q5T A;  3Q8C A;  3VBO B;  1YNA A;  2E7T A;  1MVE A;  5KC6 A;  2ZZJ A;  4BLI A;  1HLC A;  2XDV A;  2VQU A;  5JOZ A;  2BGP A;  1PO2 1;  3OGS A;  5JWP A;  5D8A C;  4FP3 A;  4QQ2 A;  3GZU C;  4EN0 A;  4O65 A;  5FO7 B;  2AUY A;  3FC0 A;  1D0H A;  2X5I B;  5LBF A;  1JUI A;  3UKV A;  2BP6 A;  1JI6 A;  2I2S A;  2V5Y A;  1FOD 1;  3PME A;  4KBZ A;  5F2W A;  1RB8 G;  2DUO A;  4UF0 A;  3U0Z A;  4AGR A;  1AR6 3;  5BY5 A;  1JYW A;  1OPM A;  2P2K A;  2H6B A;  1W6N A;  4NII A;  4BYY A;  2BBV A;  3OUH A;  1XU2 A;  1NQD A;  3GGL A;  4AQ2 A;  2D3S A;  3KWV A;  3OEB A;  1ZZB A;  2ZZQ A;  4YVS A;  3I3Q A;  1RUH 1;  1G9F A;  2DTY A;  3B5L B;  3GZA A;  1JS9 A;  1RUD 1;  3LD8 A;  4IET A;  4WZC A;  4DRV A;  5IYY A;  5J3U A;  2BPA 2;  2G9G A;  3M3E A;  2P3Y A;  2E63 A;  1HV0 A;  3E5X A;  3KSC A;  4F83 A;  2JDM A;  2XPJ A;  1QQP 1;  5DAB A;  1CON A;  1NKG A;  1QJU 1;  2OT7 A;  1HN0 A;  3LDB A;  4FOV A;  4MZU A;  3R4S A;  3LEI A;  5ABJ A;  3H3L A;  2ET7 A;  2WQZ C;  2W92 A;  1RUC 2;  1QNW A;  2NM1 A;  2O8O A;  1VBC 2;  1YIF A;  1Z0H A;  4KWK A;  4N43 B;  4RYD A;  1XNK A;  1H8T A;  1WA4 A;  4XAE A;  4XDQ A;  5FYM A;  3KCY A;  5LAT A;  3VBH C;  5IK4 A;  1G9D A;  1EV1 1;  4FPL A;  4FPE A;  1DF0 A;  2PQQ A;  4AHX A;  2PEL A;  1UX6 A;  1NCR C;  4Q4Y 2;  4XIK A;  3RYK A;  2A3Y A;  2HKX A;  1XXN A;  2W2I A;  2VZP A;  4PF5 A;  1QJF A;  1WCU A;  4PDW A;  4A41 A;  4HKO A;  2WS9 2;  5A3W A;  5T3N A;  1W6P A;  3EB7 A;  3ZIX A;  2R06 1;  4AI8 A;  2HWE 1;  2VQA A;  4Y5S A;  5FFO C;  3QH7 A;  1AUY A;  4CEY B;  1UOG A;  4OQ9 A;  2QNK A;  3VD3 A;  4AFD A;  1O3T A;  4C0B A;  4RHV 2;  2YBP A;  2Y34 A;  4LK7 A;  1OT5 A;  4AK3 A;  3BTY A;  1DDL A;  3PUS A;  1HDK A;  3ZSJ A;  5DAX A;  5EIY B;  4CCL A;  3WNN A;  4NRO A;  2PAE A;  4RR3 A;  4FPO B;  1W8T A;  1KFU L;  2IXI A;  3NV4 A;  5KHI A;  1BCX A;  4OUM A;  4QXC A;  3TRS B;  3INA A;  4XQD A;  5FY8 A;  1H1M A;  2YU2 A;  3KT7 A;  1F4H A;  3KMH A;  1AHS A;  1RUG 2;  4C8D A;  3E6B A;  2YUE A;  3FHQ A;  2MEV 3;  5GLW A;  5FZB A;  1VBE 1;  1W6M B;  4GWM A;  3ZX7 A;  1XQN A;  4ITC A;  1DZT A;  5F3C A;  3RI8 A;  1RUC 3;  1CZV A;  3MIC A;  4YVS C;  1VBC 3;  2VM9 A;  4Q8L A;  2PAK A;  3WCS A;  3E6D A;  1JHN A;  2O1Q A;  3CMG A;  1N3Q A;  3HN3 A;  4URT A;  1SLC A;  1UOF A;  4URA A;  3HQR A;  2YFZ A;  3H7J A;  4Q4Y 3;  4ZZ5 A;  2ORZ A;  4Y5Z 0;  3DGT A;  5ABJ C;  4DFS A;  2D93 A;  2WS9 3;  3VHN A;  1W9W A;  1H8T C;  4Y5T A;  3SCH A;  4D7T A;  5LRS A;  3AYA A;  1H8V A;  1ULD A;  2IWG B;  2W1Q A;  4QDR A;  4PIX A;  2XJT A;  4Y22 B;  2H0B A;  5BNP B;  4HL0 A;  5FPL A;  5BPX A;  3MYX A;  4NHM A;  3HBK A;  2GSY A;  1VBA 2;  1B09 A;  1H2L A;  4NHY A;  4RHV 3;  1A8M A;  2SBA A;  1LOG A;  3MEP A;  3KF5 A;  4O7X A;  2WIN B;  1RJ7 A;  4IV1 B;  4JTN A;  4PDW C;  5FTT C;  4D69 A;  3PUR A;  4CDU A;  3EQE A;  3O1R A;  1AR6 1;  5DZF A;  4PHZ A;  4P08 A;  1TNF A;  1S0D A;  2E7Q A;  5EZW A;  4UFK A;  1VIW B;  4P9Y A;  5F1R A;  1R1A 2;  4NWW A;  4DXZ A;  4JHT A;  1SQ4 A;  4Q1P A;  4XJZ A;  4BDV B;  3T2Q A;  1RUG 3;  4N9I A;  5DXD A;  1ZRF A;  1AYM 1;  1J3Q A;  2DVB A;  3A23 A;  3VBS A;  4NHL A;  3T2P A;  1GNZ A;  2Q8O A;  4A45 A;  2DVG A;  4KI5 M;  2VPV A;  2RR1 3;  2HEW F;  4FPJ A;  1X7N A;  3IT8 A;  4DY3 A;  1APN A;  1KJR A;  4LPL A;  1V6K A;  5CNA A;  4XUQ A;  1AX1 A;  4S2F A;  3RQ0 A;  4MH0 E;  3N36 A;  2DVF A;  2X8K A;  3UES A;  3UGG A;  1VB2 A;  4LO5 B;  1O6U A;  2B42 B;  2Q30 A;  2WAO A;  3D8C A;  1JYT A;  2LRP A;  1IKP A;  2GU9 A;  4MXV A;  1BVV A;  4FFI A;  3U10 A;  4YVW A;  1BKZ A;  4FFG A;  4JKK A;  1CAW B;  1B35 B;  2R32 A;  1A78 A;  2W95 A;  4UYB A;  5AVP A;  4LUL A;  2AEZ A;  4PQ9 A;  5FP7 A;  3SCF A;  4DXT A;  1AR9 2;  2VZ1 A;  3D0S A;  2WWU A;  4NJ4 A;  2J1V A;  2KD7 A;  3HD8 B;  4LO6 B;  1VBA 3;  2DF7 A;  1Q8V A;  3CBN A;  4ASM B;  4QX8 A;  3TBD A;  3WQ1 A;  3RZK A;  2XJR A;  1MS8 A;  1SPP B;  2K0G A;  4XVH A;  4XFF A;  4FXK B;  1EP0 A;  3I3E A;  5FP9 A;  1NCQ B;  2WFP A;  5FIX A;  2OUJ A;  5KHK A;  3NNF A;  4JX0 A;  3OBT A;  4QGL A;  4D6R A;  3JXS A;  1O8S A;  4FTB A;  4V2W A;  1OF3 A;  2D6O X;  1C4R A;  2WC2 A;  3VBU B;  5J98 B;  3ZYH A;  1R1A 3;  2LM3 A;  4YZ1 A;  5I91 A;  5KHH A;  1KD7 A;  3FFQ A;  3GHN A;  5FYC A;  4A2U A;  3GBG A;  3OTF A;  4AEM A;  2ZX0 A;  4AFB A;  2PHU A;  1O8P A;  4CDU C;  1MZF A;  2GME A;  2QE3 A;  2JX9 A;  2VZU A;  5FZ9 A;  2XWB B;  4B3N A;  1GWL A;  1M06 G;  4K1Z A;  5FZ6 A;  2JDU A;  4U2A A;  1RUC 1;  1VBC 1;  3LDK A;  4H7L A;  3SH4 A;  1OF4 A;  4IUG A;  3VBS C;  3PVN A;  4LOR A;  4ASL A;  4AVT A;  3LOI A;  4EJR A;  4ZY9 A;  2XL9 A;  5C9A A;  2YRO A;  4HVQ A;  3DYO A;  4LBQ D;  1QMJ A;  4SBV A;  3ZFF B;  4DUX A;  5FQ0 B;  4Q4Y 1;  1VAV A;  3WCR A;  1GOH A;  5JPM B;  1BHG A;  1Y9Q A;  3MIG A;  2OX0 A;  5BNO A;  4IER A;  3POY A;  2WS9 1;  1WCS A;  1AR9 3;  1DQ4 A;  4OI2 A;  4AQS A;  2VY0 A;  3S7I A;  3NNM A;  3ZSK A;  2BFU L;  1UN1 A;  5HXV A;  5EPA A;  2PFW A;  3Q9O A;  5EFU A;  2WT2 A;  2VJX A;  4Q4V 2;  4EZ4 A;  4XCB A;  2PN5 A;  2G9Z A;  4KGQ A;  4YVW C;  4XHX A;  4M3C A;  4RHV 1;  3OPT A;  2QQU A;  3WEZ A;  2VUD A;  4BK4 A;  3E5U A;  1X8E A;  1X82 A;  4LLO A;  4QHB A;  5F3E A;  3T2O A;  3BOP A;  3WLU A;  4IEZ A;  2D5H A;  1O4Z A;  4DUV A;  2A6W A;  2J7M A;  5FZ8 A;  1AR7 2;  1OLQ A;  3K46 A;  1GWK A;  1LHW A;  1KFX L;  4NRP A;  1VLN A;  4PLN A;  4AED B;  3BKZ A;  4BQY A;  1FXZ A;  1LU1 A;  3GZE A;  1ACC A;  3M7A A;  5DAV A;  5IVE A;  1RUG 1;  5C4W A;  3VD4 A;  4I3P A;  1ZX5 A;  4JCK A;  3AKQ A;  1OVP A;  4CP2 A;  1JH5 A;  3VDA A;  1UL9 A;  4Y33 A;  1QOS A;  1CZS A;  1WMX A;  5DDJ 2;  2ARE A;  3D82 A;  1RIN A;  4AE2 A;  1LTE A;  3UT0 A;  1HRV 3;  1Q8S A;  4LBQ A;  4NOT A;  5FXZ A;  4JVA A;  3VZM A;  2VL4 A;  4E8C A;  3PUQ A;  4GZ9 A;  1J83 A;  5TSW A;  2R6Q A;  4YW2 A;  3VL9 A;  1CIY A;  2WNE A;  3QLQ A;  4AHW A;  1UYZ A;  1D7P M;  4LKD A;  4XET A;  1HXS 2;  4AI3 A;  1JYV A;  2W52 A;  2RS1 3;  5GKA C;  1OLM A;  2EXJ A;  1GZT A;  2LTN A;  4FOY A;  4P9W A;  1D2S A;  4QKD A;  4QX1 A;  1ULG A;  3VKN A;  3ZYB A;  4Y20 A;  4TSV A;  1LHO A;  3H8X A;  1N3P A;  3L9J T;  2Q0A A;  3VZN A;  4CDQ B;  1H30 A;  5FRE A;  3WNP A;  1WCK A;  2NLR A;  1REE A;  2ERF A;  4FOQ A;  4JGZ B;  1CAV B;  1VBA 1;  5ACA 2;  4J1X A;  4A3Z A;  4D7S A;  3BN6 A;  5BNO C;  2C9A A;  4NHX A;  1CJP A;  4C1X A;  3VHO A;  1WMD A;  5DZE A;  4CCC A;  1LHN A;  4GWI A;  5C8C B;  2GNB A;  2JWP A;  1FI2 A;  3S6P A;  1AR7 3;  2BTV C;  5C6C A;  5JCT A;  1KGY A;  1R1A 1;  3F95 A;  2JIG A;  1OUR A;  4R8H A;  5C33 A;  4LO8 A;  4UW6 A;  1RUJ 3;  5I0S A;  5CFC A;  3PVO A;  1FAY A;  4IGQ A;  5FZK A;  3VDD B;  5AC9 2;  2YYO A;  4KL1 A;  1JOD A;  3AP5 A;  3LSD A;  5DDJ 3;  4GB3 2;  3N9L A;  1MS1 A;  4RQP B;  4S2G A;  2JG9 B;  4JQR A;  1WA6 X;  5FDB A;  5L7O A;  1LJ7 A;  3KHC A;  1AXY A;  4EN7 B;  1D4M 3;  1QDC A;  3N35 A;  3VL8 A;  1GZW B;  2XHN A;  3Q8E A;  5IVC A;  3NV2 A;  5H9R A;  1GUI A;  5C4W C;  2G9F A;  1LGC A;  2VOX A;  3BPZ A;  4ZXK A;  2CAU A;  1CX4 A;  1HXS 3;  3NJX A;  1LNS A;  4IEW A;  3CJX A;  2FCV A;  1W9Y A;  1N1Y A;  3O5S A;  4B7E A;  1CN1 A;  1ULE A;  2QQJ A;  4NMI A;  1X36 A;  3ABZ A;  5FY4 A;  4UFM A;  2PTM A;  3VBO A;  2R49 A;  5FO8 B;  3BIE A;  1AR9 1;  2NMN A;  3KZ4 C;  1QEX A;  4Z07 A;  4HMZ A;  4AI2 A;  4CTE A;  2RM2 2;  5ACA 3;  2V09 A;  3M8L A;  3I3M A;  1VMJ A;  3RYR A;  1GFF 2;  2X5I A;  1DIW A;  1GNY A;  4IV3 C;  3ZXK A;  4W65 A;  5LBE A;  2EXI A;  1LHV A;  1MR5 A;  5GLT A;  4NUB A;  3K48 A;  2BEO A;  3ST7 A;  1HJG A;  1GOF A;  1XNT A;  4K40 A;  5I8Y A;  4K8R B;  1G6N A;  2NQY A;  4OFG A;  4EWA A;  3BB6 A;  4I3G A;  1VP6 A;  1I5P A;  5CFD B;  4IND A;  4YLZ A;  2D6L X;  2AAC A;  3DCQ A;  4OZO A;  4QGN A;  5AC9 3;  4Y4Y A;  4QB2 A;  4YZ2 A;  4GB3 3;  1I1E A;  3K4A A;  1ENR A;  3P6B A;  1WD3 A;  2OS2 A;  4YW6 A;  3OPZ A;  3RS6 A;  5EWS A;  1O3S A;  2VG9 A;  4OUL A;  4W50 A;  5GLU A;  2GAL A;  4WVV A;  4QXB A;  5FUN A;  5G04 L;  3ZXA C;  2FDK A;  1OKO A;  1FV3 A;  2HWC 2;  5CFC C;  3AZY A;  4N43 A;  1FPN 2;  5T52 A;  5FY0 A;  4ZON A;  1S0B A;  3ILN A;  5E89 A;  4LR4 A;  3JB4 C;  1WBL A;  2R30 A;  3FE5 A;  4NHK A;  5KR7 A;  5L7O C;  1LU2 A;  3HJR A;  3NV1 A;  4E4D X;  4HXC A;  3RSJ A;  3AL6 A;  4A4A A;  4RD7 A;  3ZKY A;  2AH2 A;  3WDV A;  3ACL A;  4CUC A;  2CNA A;  3ZMN A;  2RM2 3;  4P02 B;  3WZ1 A;  4AR2 A;  2Z79 A;  4Q4V 1;  3ACI A;  3MUY 1;  5FYY A;  2RDS A;  4PI2 A;  3QBQ A;  2VMG A;  3B9C A;  2BYV E;  3ZVX A;  4CEY A;  4XJU A;  1H6Y A;  1FV2 A;  3VBO C;  5DN2 A;  1IPJ A;  4C91 A;  2JG8 C;  4L11 A;  2Z42 A;  1RTV A;  4NIG A;  3WD5 A;  1S2B A;  3VLB B;  1UF2 C;  1XRU A;  2E51 A;  3GJA A;  1MEC 2;  1AR7 1;  3UGH A;  4BQ5 A;  4D94 A;  3RI9 A;  5FZF A;  2IFR A;  2X5I C;  2DVD A;  5L73 A;  2Q8C A;  2L9L A;  3THP A;  1MZE A;  1WBF A;  3WF2 A;  4CP9 B;  3H8R A;  3AP6 A;  3KV4 A;  4DIN B;  1KS4 A;  4CVU A;  5JXI A;  3S57 A;  3CJI B;  1KDM A;  4E9K A;  4TYS A;  3MID A;  2X05 A;  3D5O A;  5DDJ 1;  3I59 B;  1W6M A;  3N9N A;  1QWR A;  1WMF A;  3MHZ A;  4M0N A;  2PHX A;  1CIW A;  2WYS A;  3PU3 A;  2YPD A;  5F32 A;  3I3D A;  2HWC 3;  1FPN 3;  1KXG A;  2CY6 A;  5J1X A;  4HK9 A;  1Q43 A;  1LGN A;  4WVM B;  4YGC A;  4H3W A;  4YPJ A;  3C7O A;  2JD4 A;  3V64 A;  1RIR A;  5KWR A;  3W5M A;  4Q26 A;  1WWY A;  1MS3 A;  1HXS 1;  2QDR A;  2HWB 2;  3CLP A;  1SAC A;  5GZD A;  5BUV A;  1WD4 A;  3V0B B;  4K8F A;  1JBC A;  1OBN A;  1OOP B;  1U0A A;  4AZZ A;  4HSJ A;  2RVA A;  4N43 C;  1OQE A;  4GH4 B;  4AYU A;  1YI7 A;  1L7R A;  2RDQ A;  2AGS A;  2ATF A;  3MPB A;  1Y43 B;  4Y22 A;  1C57 A;  1CX1 A;  5ACA 1;  5BNP A;  2W5F A;  2P17 A;  1IKQ A;  2VBB A;  2W91 A;  4E2S A;  5J37 A;  4QPW A;  4JDO A;  4LLF A;  4ZU4 A;  1R09 2;  4IV1 A;  3RWK X;  4FAG A;  3HNB M;  1G9A A;  1MEC 3;  5B2G B;  2QQO A;  3ZM8 A;  3MLK A;  5F8P A;  3IIA A;  4LXL A;  5FWE A;  2AEN A;  2EIC A;  2HYK A;  3ETQ A;  4GIQ A;  3WNX A;  4COW A;  5AC9 1;  2VW1 A;  4R9A A;  1GZ9 A;  2DCJ A;  2ZOE B;  4GB3 1;  1WW7 A;  4Q29 A;  3VBR B;  3ACH A;  2OQ7 A;  1X9P A;  5LW9 A;  3NKG A;  1BMV 2;  1XJA A;  5F7U A;  2E26 A;  3TNP B;  5FBZ A;  1SZB A;  2RDN A;  2WNV B;  4YGB A;  1BLZ A;  3ZOI A;  3GM8 A;  4UFH A;  2DFB A;  2Y26 A;  1XC6 A;  2CU5 A;  3MLL A;  4QM8 A;  2BER A;  2VUL A;  3ES4 A;  2HWB 3;  2DUP A;  3OG2 A;  1TME 2;  1N1S A;  2WZR 2;  5JI7 A;  4BHP A;  4CU8 A;  4K1Y A;  5EJ1 B;  1YQ6 A;  2A3X A;  5FUI A;  1RUD 3;  4PJY A;  4E4H A;  3AKS A;  1VBB 2;  1B35 A;  4QPG B;  3UL2 A;  5J36 A;  1S0F A;  3ZN6 B;  5IT6 A;  1QOT A;  1OHF A;  2RM2 1;  2WDB A;  3KV5 A;  3POF A;  1YYN A;  2XLF A;  4IL7 A;  2Z69 A;  3H42 B;  4MG2 A;  2BUK A;  2EXH A;  1GKB A;  4V1P A;  1SPP A;  1R09 3;  3OF1 A;  3S0M A;  4FSJ A;  1MQT C;  5A6Y A;  5A3P A;  1NCQ A;  1O91 A;  3WUC A;  5FLI A;  1EV1 3;  3EJK A;  3ZSL A;  5A3L A;  1TZO A;  2I74 A;  5BNP C;  2QVS B;  5T5J A;  3VBU A;  1NY7 2;  5K0U B;  3HVD A;  3X29 B;  2QQL A;  4HBN A;  1NZC A;  1JMU B;  2VNG A;  1UY3 A;  5E16 A;  2B46 X;  4FTE A;  5FY9 A;  4IV1 C;  2RV9 A;  3T08 A;  1M4W A;  5FZL A;  3Q8F A;  5FZO B;  3N3H A;  4IEV A;  3VKL A;  5FKC A;  5A7P A;  5FZ1 A;  4LOT A;  1KS5 A;  3CU7 A;  1EUU A;  3WQB A;  1NQJ A;  2ZJC A;  1N1T A;  3H1M A;  3O0X A;  5JZG C;  1OFN A;  2V4A A;  1C8M 2;  2HWC 1;  2LRO A;  1FPN 1;  3SEE A;  2R7E B;  4LOS A;  4PBO A;  1WW5 A;  1TME 3;  2WZR 3;  5B4N A;  5FLJ A;  4QPI B;  2A3W A;  1GP6 A;  1HQL A;  2ZTN A;  4ISR A;  3FX3 A;  1QDO A;  2I07 B;  2WA4 A;  3I2G A;  3ZFF A;  3LA7 A;  4L8Q A;  2QBX A;  3TYJ A;  5FQ0 A;  2OXB A;  1VBB 3;  3IMM A;  1QJY 2;  2ZS6 B;  3SNM A;  3T3Y A;  1POV 3;  4XJ8 A;  1YJL A;  1N1V A;  1VPH A;  2BFU S;  3AMM A;  1BEV 2;  3ZN5 A;  4NPM A;  3RZJ A;  2XR4 A;  2R0F A;  4LBN A;  2QTW B;  4AHZ A;  4YZ4 A;  1J3R A;  1SBD A;  3LFI A;  4Q0Q A;  4HVO A;  3N9O A;  3AMP A;  5A3T A;  5A33 B;  4AI9 A;  5LB6 A;  3W9A A;  1B35 C;  1UQX A;  4P9G A;  1QNY A;  1FAT A;  3BU0 A;  4V2V A;  1VBD 2;  4P9X A;  1PK6 B;  2FMY A;  4I0W B;  3C2U A;  1XOY A;  1MEC 1;  2HWF 2;  1NXM A;  1ZA4 A;  5A3M A;  3LAG A;  3KQR A;  3ZYP A;  1UOJ A;  4LO4 B;  1N47 A;  2IXJ A;  4DY5 A;  3III A;  3OGR A;  4AED A;  1O7F A;  1KQR A;  4XTP A;  1UU6 A;  5CIS A;  3WNM A;  1NCQ C;  5FV3 A;  1CWP A;  3N7L A;  4LE4 A;  4DB5 A;  1BVP 1;  2ZKN A;  3B7M A;  4K20 A;  1X9T A;  1LCL A;  1UMH A;  4FFH A;  3C8X A;  4XF4 A;  2GP5 A;  4N90 A;  5JSP A;  4R4Z A;  5C3O A;  1NAE A;  2ZGL A;  1C8M 3;  2CYF A;  2ZX3 A;  3M3O A;  2Q1M A;  2OZ6 A;  4XBN A;  2AC1 A;  3HWJ A;  4X6R B;  4CP0 A;  1DQ2 A;  4DZG A;  3PMS A;  3MIF A;  4LKS A;  3T1L A;  3AZV A;  4GMP 1;  3HIF A;  2DBN A;  1LED A;  2HWB 1;  3WF3 A;  1UIK A;  4AGG A;  4C0H A;  2VOV A;  2NMO A;  2VMF A;  1QJY 3;  1AYM 3;  3QD6 A;  4PLM A;  5DAQ A;  3FUO A;  4IGO A;  4YG3 A;  2EIB A;  3ZYR A;  2W39 A;  4XXP A;  1LR5 A;  1BEV 3;  1XE7 A;  1JZ5 A;  1W8W A;  1HQN A;  2YG0 A;  1XE0 A;  4XF0 A;  5FZC A;  1D0G A;  1N3O A;  4CDQ A;  5IAT A;  1RUO A;  5FPV A;  3USU B;  3P5B A;  3ZFF C;  4JGZ A;  1CAV A;  3J7L A;  4J1W A;  5F9T A;  3J9S A;  5FYH A;  1HQW A;  3LIH A;  3VGI A;  1R09 1;  1OC1 A;  2J22 A;  1FX5 A;  1VBD 3;  1C1F A;  2JD9 A;  2P5B A;  5F5Q A;  4I09 A;  5I0U A;  3RFR A;  1OFS A;  4COZ A;  2HWF 3;  1DCS A;  3MI8 A;  4JV4 A;  1ND2 B;  3OGJ A;  4C1W A;  4UBG A;  2P4E A;  5C8C A;  4QD2 A;  1W8Z A;  5LRR A;  1O5L A;  2Y6L A;  5CBL A;  4KU7 A;  3POE A;  3M3Q A;  4AVA A;  2VBP A;  3SIT A;  4Q0V A;  4Q1R A;  5FYT A;  2AYH A;  2HEY F;  4XIO A;  3NJZ A;  5EV7 A;  3LIG A;  1QJZ A;  4LKE A;  2XVL A;  4P5Y A;  3BYW A;  2RJL A;  2UY9 A;  1PIV 2;  3VDD A;  3IAP A;  2DV9 A;  2WAA A;  4RFT 0;  1BMV 1;  3R0R A;  1EY2 A;  4R52 A;  4RQP A;  2JG9 A;  1ZZ6 A;  3VBF B;  2VE1 A;  1PMI A;  1U5X A;  3PVE A;  4AED C;  3R4D B;  5FOB B;  2DBI A;  1CVN A;  1GZW A;  3A22 A;  3J8F 2;  2EIG A;  4XUR A;  4Z92 B;  1R64 A;  4GAZ A;  2VZO A;  2WRA A;  1UYX A;  1H2K A;  2VZ3 A;  4I02 A;  5FY5 A;  3TAY A;  2KXL A;  4FAH A;  3KCC A;  1TME 1;  2WZR 1;  3M70 A;  3K51 A;  4QU2 A;  1T6B X;  1WLC A;  2Y38 A;  5C8W A;  1KEX A;  2BWC A;  4HPK B;  5LY1 A;  3LEG A;  4R9D A;  1DQ1 A;  3N9M A;  1VBB 1;  1TG7 A;  2YC0 A;  2JIJ A;  3U07 A;  1POV 1;  1BYH A;  1LEC A;  1IG3 A;  2W1U A;  3O0V A;  4XXA A;  3LA2 A;  3LKJ A;  5I8S A;  2ZGT A;  5CAD A;  3C7E A;  1JYC A;  3LA3 A;  2EAA A;  5A7Q A;  4ZU7 A;  4M4R A;  2CTV A;  1DGW X;  2OVU A;  2BNM A;  4M0H A;  5ANQ A;  5JOX A;  2W0X A;  4MGI E;  5M0T A;  4UFL A;  2VTX J;  2YGM A;  1YFU A;  3PNA A;  1RVF 2;  3LZZ A;  1GQG A;  3ORJ A;  1DFQ A;  3BCW A;  3GDB A;  3I2H A;  5T50 A;  4OUS A;  5FK7 A;  3D0J A;  1COV 2;  3I2I A;  1NY7 1;  1LHU A;  2AZ5 A;  4FPY A;  4YW7 A;  4JGZ C;  2WUH A;  5LA9 A;  1H1A A;  2D5F A;  2ZGM A;  1QJX 2;  2FBE A;  3A0N A;  3O14 A;  3K3O A;  3OCP A;  1WW6 A;  5IJR A;  5LY2 A;  5CFD A;  2AR6 A;  2UUR A;  1W99 A;  5F5I A;  4OHZ A;  1DZR A;  4EN6 B;  5GZE A;  3O1V A;  1UIJ A;  1PIV 3;  3OOX A;  1AF9 A;  4HSL A;  2ORX A;  5J7M A;  4FPH A;  2E7A A;  5C8C C;  3WR0 A;  2Q8E A;  1W2T A;  4L92 A;  1VMH A;  2ARA A;  2PMW B;  4KMQ A;  4XFA A;  2VZV A;  4GQ7 A;  2LUW A;  4Q4W 2;  3J8F 3;  1S0G A;  5FPZ A;  1OD3 A;  1C8M 1;  1VRH 2;  4YGD A;  2C4X A;  4YW5 A;  3WF0 A;  4AF9 A;  4ERO A;  4YG0 A;  1QGL A;  5FYS A;  1DBN A;  2GDF A;  2XWJ B;  3OBZ A;  1DZQ A;  3VDD C;  4IXL A;  3RGB A;  4RQP C;  1H2N A;  3K4D A;  3E5Q A;  4GAL A;  4MAD A;  4K3U A;  3UET A;  3POG A;  3I49 A;  4CDW B;  1QJY 1;  2RJK A;  1IPK A;  3IPV B;  1VAL A;  1I3H A;  1KJL A;  1YJK A;  2NN8 A;  3LB9 A;  1BEV 1;  4RR3 C;  1YFY A;  2O14 A;  4A42 A;  4ES9 A;  4MOA A;  2XQR A;  1ST8 A;  1J59 A;  4HK8 A;  5F2S A;  1SLA A;  1DG6 A;  1WUV A;  4CUG A;  2DDU A;  1RVF 3;  4LT5 A;  5DQ0 A;  3VKO A;  4GUL A;  1UZY A;  1GV9 A;  3AP9 A;  4UAP A;  2NP0 A;  1DQ0 A;  1VBD 1;  5KXE A;  3UKN A;  4CU7 A;  3LSE A;  1COV 3;  5KXD A;  2HWF 1;  2OUH A;  1PHM A;  1VAK A;  1NOV A;  3IWZ A;  1QJX 3;  3OGG A;  3H3Z A;  2J1U A;  5IHR A;  2J1A A;  1K5J A;  1Q3E A;  1AR8 2;  1XB9 A;  1DLL A;  3NO8 A;  1H2M A;  4BQX A;  3K75 B;  3MIB A;  2YBS A;  2A6Z A;  2PHF A;  4CP9 A;  1TNR A;  1EYB A;  1ALY A;  3GCX A;  4RL7 A;  1W6O B;  3CJI A;  5KXC A;  2B9V A;  2D6P A;  4A6O A;  4HZF A;  4Q4W 3;  4CPB A;  3RDI A;  2F17 A;  2JDZ A;  3N7J A;  2BVV A;  3I59 A;  5JSR A;  2GH8 A;  1S0E A;  1UZ0 A;  1ZNP A;  2C0Z A;  4AEK A;  5CFD C;  4LO7 A;  3O7O A;  1JW6 A;  1JZ8 A;  1UY4 A;  3ALQ A;  5FZ4 A;  3AP7 A;  2EA7 A;  4CP1 A;  3I97 A;  3M1H A;  2RHP A;  4WVM A;  5IVY A;  1Q56 A;  2ZXQ A;  4EN8 B;  1SLT A;  4BIF A;  2TNF A;  3WDY A;  4CE8 A;  4IE7 A;  4CEW B;  1V6N A;  3IB3 A;  2WR9 A;  4MSV A;  2MPF A;  3HNY M;  3IDA A;  3POI A;  1K5M B;  2Y64 A;  3LDR A;  2GC1 A;  2YMZ A;  3V0B A;  3RZZ A;  2WAB A;  4HAN A;  3WDT A;  1OOP A;  1UY0 A;  5CZK A;  2VQ0 A;  3UK9 A;  5T5P A;  3KB5 A;  2ZGK A;  3MW2 A;  1H6X A;  4GH4 A;  2MNG A;  2D6M A;  3SCG A;  2FZ2 A;  1PVX A;  3NVC A;  3NW4 A;  1OA2 A;  3NRU A;  4WVW A;  1EAH 2;  5JPN B;  1SLI A;  2Y6H A;  3D6E A;  3GJB A;  1ZZ9 A;  5CKQ A;  2CL2 A;  4LMF A;  4UBH A;  2JDP A;  2R1D A;  1I9R A;  1ZRE A;  3WDW A;  3NQH A;  1W39 A;  3ELN A;  4QX3 A;  1GWM A;  2HBT A;  2J1S A;  4ZXE A;  1ZZ7 A;  3H1W A;  4RS5 B;  4KQ7 A;  2X10 A;  2Z4F A;  2ZAA A;  3NKT A;  2QDN A;  1PM7 A;  3DV8 A;  2GC3 A;  5FYV A;  1AR8 3;  2WSU A;  1OSG A;  1AXZ A;  1E5H A;  3I2F A;  3FHI B;  3UKT A;  5K9Y A;  2JE7 A;  4XBL A;  2OKX A;  3DF0 A;  1PIV 1;  4ET7 A;  5CU1 A;  1CES A;  2IZW A;  4ZKT B;  2YXS A;  3VBR A;  1PX3 A;  4BXF A;  2YY1 A;  5FY7 A;  2ZGR A;  1NE6 A;  1MS4 A;  3WOG A;  3MFC A;  3J8F 1;  2TUN A;  5CYY A;  2JEN A;  1PGL 2;  4CDX B;  2WNV A;  4X8N A;  1KDK A;  2Z5W A;  3TOJ A;  4ARX A;  1CPM A;  4P00 B;  1UKR A;  1V0A A;  3CJI C;  3CZJ A;  5FZE A;  4M00 A;  1K3I A;  1OI6 A;  3E6C C;  2YFU A;  5D2A A;  1JOP A;  1YQC A;  2CAV A;  4WBB A;  5FMC A;  5FZI A;  2QKD A;  4UFJ A;  3K3N A;  1R1Z A;  2DTW A;  3C3V A;  3W20 A;  4LA3 A;  2A5Z A;  1D4V B;  4WM7 B;  2A71 A;  2GND A;  2OQ6 A;  1YXW A;  2C26 A;  2VUC A;  1SEF A;  3J7M A;  3FBM A;  1U5Z A;  1XE8 A;  4QPG A;  5FK8 A;  4AW7 A;  2GP3 A;  1U5I A;  2FDG A;  4ONU A;  3ZN6 A;  5KXB A;  3GF6 A;  1EAH 3;  5K4L A;  1JU3 A;  1J58 A;  1QF3 A;  3AP4 A;  1YEW A;  2FZ1 A;  2VOW A;  4YFW A;  1RVF 1;  5FP3 A;  1O3Q A;  4UFI A;  4KU8 A;  1Q5O A;  4QXH A;  4YRD A;  2VH9 A;  1G9B A;  3N4M A;  4MHU A;  4TXW A;  1JZ6 A;  2GMP A;  2YPJ A;  4MVT A;  1K42 A;  1COV 1;  5EYX A;  4GH4 C;  4O9E A;  1Q8P A;  4BCU A;  5C3P A;  1XYN A;  4NID A;  5IW0 A;  2ZEZ A;  1GBG A;  4HON A;  1QJX 1;  4JQT A;  4YFZ A;  5K0U A;  4LA2 A;  5FZG A;  3BTZ A;  3THD A;  1R08 2;  5BNN B;  3ZR6 A;  1JZ3 A;  1BZW A;  2A73 B;  3N7M A;  2OW4 A;  3HQX A;  3WF1 A;  2JEC A;  4YZ3 A;  5E88 A;  4Q4V 3;  5FZO A;  3SIS A;  5C9A C;  3EHK A;  1NX9 A;  4FQ4 A;  5FXW A;  5L9R A;  3MV1 1;  3S30 A;  4PIZ A;  2ZGQ A;  5CIR A;  3LGR A;  3H8O A;  4Q4W 1;  4QB1 A;  5JXJ A;  1F9K A;  5FJH A;  1VRH 1;  2ZGU A;  3L2Y A;  1SCR A;  2CHH A;  3NMB A;  1F8V A;  1CD3 G;  4FPG A;  3I3B A;  4DS0 A;  2IXC A;  1NA1 B;  4OUE A;  4QDS A;  3W5N A;  3O1S A;  3WW2 A;  5LWB A;  4AI0 A;  5FYZ A;  1IQD C;  1HKD A;  5I0D A;  4QPI A;  2D6K A;  3D4K A;  3H0O A;  3O12 A;  4JAA A;  4L99 A;  4QQL A;  3MIH A;  5HCF A;  2DCY A;  3D3A A;  4E4Z A;  2XKP A;  3UV9 A;  1UYY A;  1TVG A;  5F6L B;  4EV0 A;  1UXX X;  5IAX A;  2WNV C;  3HBZ A;  4N53 B;  2WQ4 A;  4XZP A;  2VME A;  3JBG 2;  4WM8 B;  2C24 A;  4RSU A;  1VRB A;  5JSO A;  2X09 A;  1ENX A;  1W2N A;  3ROU A;  1T6G C;  1O5U A;  3FL7 A;  5A7O A;  4DEV A;  2X29 A;  1W0O A;  5I8T A;  1IS5 A;  3EO6 A;  4WV8 A;  4FTS A;  2DWR A;  1FNY A;  5A33 A;  2ZHL A;  1U12 A;  4XIL A;  3RVH A;  4QPG C;  5A3O A;  3R6S A;  3U37 A;  1E5I A;  2UWC A;  4B4Q A;  2XJQ A;  1EUT A;  1PK6 A;  3N7K A;  1I5Z A;  3OYW B;  5JXG A;  3OD0 A;  2WYF A;  2FDI A;  5I93 A;  3K4Z A;  1R08 3;  4BK5 A;  1AR8 1;  1AX0 A;  2VZT A;  1WCD J;  1RED A;  4PIY A;  3ZXL A;  5CKM A;  2UY8 A;  3CZU A;  4LIU A;  2CDO A;  3NAP B;  3WY6 A;  1QH7 A;  4CXY A;  1FT9 A;  1GMM A;  4Q4X 2;  3U78 A;  1DYK A;  4ZZ8 A;  2OPW A;  1OA3 A;  1UU5 A;  4IE0 A;  4Y1Z A;  1LUL A;  2H6C A;  2YB7 A;  4IEP A;  3M4F A;  5K0U C;  2ZHK A;  4BA6 A;  1W6Q B;  4B8E A;  4CCO A;  4E4S A;  1PX4 A;  2B4K A;  2VR4 A;  1XYO A;  4PT6 A;  4DO0 A;  5FPU A;  3ZXD A;  4DXS A;  1YI9 A;  1SCS A;  4DMI A;  2W46 A;  3B02 A;  1W3V A;  4KH9 A;  4AVC A;  1ZRC A;  2BBA A;  4YG6 A;  4QPY A;  4COV A;  5CG8 A;  1CAX B;  2VNV A;  1C1L A;  1S0I A;  3KT1 A;  3MLJ A;  4GA9 A;  1XBF A;  4KG0 A;  3ZFE B;  4UI9 L;  1W03 A;  3ZYG A;  1ULP A;  3T1M A;  1GLH A;  1A34 A;  3JBG 3;  5C3Q A;  5E8A A;  1SLL A;  2XVG A;  3BU7 A;  1US2 A;  1YUD A;  1GU3 A;  1QKQ A;  1RMU 2;  3DPR B;  4TWT A;  5LK5 A;  1WZX A;  4Y26 A;  3WW4 A;  4QPI C;  5IVB A;  1EAH 1;  3USU A;  3OUJ A;  4B29 A;  5J09 A;  2WNU B;  2ADE A;  4B4R A;  2DFC A;  3AKP A;  4E27 A;  5HI0 A;  3O1M A;  4DQA A;  3KD4 A;  4M3C F;  2Q1Z B;  2B7Y A;  3OUI A;  1ND2 A;  4LBJ A;  3AX4 A;  4OCT A;  3BAL A;  2WO3 A;  5K7P A;  3CIH A;  3IKW A;  3PU8 A;  4COY A;  3KQ4 B;  4ZPI A;  3RNS A;  4AGV A;  2VZR A;  3WDX A;  4Z2W A;  5KBF A;  2BNN A;  3CO2 A;  3PTR B;  4MLO A;  4Q4X 3;  3T09 A;  5L9V A;  3PUH A;  3CL1 A;  2FDJ A;  2ZEW A;  3OEA A;  4ISQ A;  4XJW A;  3VHR A;  1PK6 C;  5L36 A;  1IHM A;  1ZRI A;  4CCD A;  2ZKL A;  1WKY A;  4KG8 A;  2HEV F;  2DUQ A;  2ILM A;  1O4Y A;  1LOB A;  2QFE A;  4OHW A;  3MZH A;  4GWN A;  2W47 A;  3QCW A;  1AX2 A;  2W1W A;  3IDE A;  4LIT A;  5FZA A;  3IZO A;  3VBF A;  1NG0 A;  1OMI A;  1XSQ A;  1IS6 A;  1PGL 1;  4XFG A;  2HBU A;  3J7H A;  3AJY A;  1UXZ A;  3LOB A;  3VV1 A;  3I8T A;  1MAC A;  4BJ0 A;  3WNL A;  1W9F A;  3MF9 A;  3SH3 A;  4L97 A;  2JE9 A;  4GKY A;  4XFI A;  1AJK A;  3WDU A;  3VDC A;  4HPK A;  3GZT B;  1FNZ A;  4NWV A;  1IPS A;  5FZH A;  1JYX A;  2W68 A;  1RMU 3;  4XQW A;  5A7W B;  4XUN A;  2GC2 A;  1ZRD A;  1ENS A;  2J1T A;  1YQ8 A;  4N9H A;  1NUK A;  1AL0 G;  1C5I A;  1LOC A;  1RUF 2;  4ATE A;  4GWJ A;  1LGB A;  5FUP A;  4D7Y A;  2ET1 A;  5EP9 A;  1UD1 A;  4OMD A;  3S5Q A;  3DYP A;  5LBB A;  1W0P A;  2WWJ A;  4MV2 A;  1V6M A;  4HKL A;  4YNI A;  1GZC A;  5E1R A;  1R08 1;  4D3W A;  2HWD 2;  1G8W A;  5JOW A;  2VOK A;  3HN1 A;  4CCN A;  2XVK A;  3ZSM A;  2E53 A;  3AMH A;  3ILR A;  3G7D A;  1YWK A;  5LBC A;  1PNF A;  3SKJ E;  1ND2 C;  4NAO A;  2W94 A;  5SV8 A;  1MS5 A;  1S0J A;  2IVJ A;  2VMI A;  2EAL A;  2MHF A;  3N9P A;  4MHR A;  1ULF A;  1PM4 A;  3AK0 A;  3B00 A;  4IQP A;  4BZ4 A;  5HCH A;  5FLH A;  3RZM A;  1OLR A;  2R07 2;  5GJ6 A;  2WLP A;  4BOW A;  3CKH A;  5JDB A;  1GSL A;  4FOW A;  1Y4W A;  1GNH A;  3SEP A;  1ODM A;  1ND3 B;  2Q1F A;  4LUM A;  3UYJ A;  2DUR A;  1Z78 A;  4CEY C;  5FR3 A;  3S5A A;  2WQ8 A;  4XJ9 A;  3VBF C;  3H7Y A;  5C3R A;  1OD5 A;  2ZX2 A;  3CF6 E;  3H1Y A;  2K2S A;  4ATF A;  3LWC A;  4CDW A;  3IPV A;  3AYE A;  4QKN A;  2DYC A;  5A32 B;  3JBG 1;  3N9Q A;  3SLI A;  1QXR A;  1SBF A;  1F2N A;  3AKR A;  4XMI A;  2ZAC A;  4QHO A;  3APB A;  2GNM A;  4Q8K A;  3KVA A;  3A0K A;  4JRA A;  2VVE A;  4N7U A;  2CWS A;  5CAZ A;  2X53 S;  4RN5 A;  2NPI A;  3EYP A;  4IEU A;  5DUU A;  1RUF 3;  3MBW A;  1ENQ A;  2VUA A;  4JDN A;  3RZL A;  2F4P A;  3GAL A;  2BW8 A;  2DU1 A;  5FMO L;  4LHK A;  4G9S B;  5JVV A;  5H9Q A;  1V9U 2;  4TLF A;  2D6N A;  2K46 A;  4GMP 3;  2GN3 A;  2PHR A;  4NRM A;  1ZRR A;  2OA2 A;  3B94 A;  3IM0 A;  4JKL A;  4MET A;  4XF3 A;  3LFM A;  4KWU A;  2WNO A;  1W06 A;  1NLS A;  2UWB A;  3AM2 A;  3PJQ A;  2HWD 3;  5L9B A;  4FPC A;  5A70 A;  2LAL A;  2RG4 A;  4LTA A;  4O9G A;  4D6Q A;  1VAM A;  5BNQ A;  2D40 A;  3ZSE A;  5I0R A;  1IQA A;  4Q4X 1;  2VGD A;  4UT5 A;  3FMG A;  1W6O A;  2BNO A;  2SLI A;  2XLG A;  2W9X A;  2Z2S B;  2VCA A;  2R07 3;  3IDB B;  3KGL A;  3DYM A;  2PHW A;  3ZMO A;  1ASJ 2;  4DRR A;  5FRA A;  4YGE A;  1OQD A;  4QU1 A;  5HPO A;  3DKW A;  4G3Y C;  1VE0 A;  1Y9M A;  3U11 A;  4NVP A;  2VBD A;  3ZFG B;  4CEW A;  3ECQ A;  1JZ2 A;  1H9W A;  1O3R A;  1HRI 2;  4A7Z A;  4GJZ A;  2R04 2;  1W8F A;  4WVZ A;  4A3X A;  3J4U H;  1UYP A;  4EZH A;  1K5M A;  4Y1Y A;  1AJO A;  2CDP A;  4P9I A;  5KHG A;  1DGW A;  4YW1 A;  2YGL A;  3AB0 A;  5LAS A;  1RMU 1;  5DAP A;  5FY1 A;  4AG4 A;  1J1L A;  2PHD A;  2DCZ A;  4JKM A;  4MGK E;  4RGK A;  3AFG A;  2Y33 A;  5AFE A;  3Q8B A;  4TN7 A;  2ARX A;  3DEM A;  4GMP 0;  4AFC A;  4CZS A;  3AYC A;  3W59 A;  4CDW C;  1F4A A;  2VMD A;  1V9U 3;  2WZ8 A;  2HJI A;  1G9C A;  1SG3 A;  2RJ2 A;  1U5Y A;  1DLC A;  2VU9 A;  4IV3 B;  3TEW A;  4NPR A;  1L7L A;  1UZW A;  4Y24 A;  1WME A;  3ETP A;  4RS5 A;  4BH9 A;  5K8S A;  2WBK A;  2VOT A;  1A6C A;  1LOA A;  4JGY B;  4LBO A;  3POW A;  4MX3 A;  4PLO A;  1OVS A;  5JMO A;  4XPV A;  3PIJ A;  1VR3 A;  1G86 A;  1UW8 A;  1RYY A;  3HR9 A;  4QHZ A;  2XL7 A;  4COU A;  1NYW A;  4YM2 A;  4F3J A;  4H2A A;  2OII A;  2WL1 A;  1H0B A;  1ZM1 A;  4JDM A;  1UNB A;  2E9Q A;  3CDZ B;  1X8M A;  3C7H A;  2JE8 A;  1H4G A;  5JR7 B;  3P3P A;  4Z2A A;  3KHB A;  2UYB A;  1WLW A;  2WWS A;  1ASJ 3;  1BBT 2;  1UU4 A;  1QU0 A;  1XND A;  2ZMK A;  3HT2 A;  3KCX A;  5FZ0 A;  1JOB A;  3RJR A;  2E32 A;  1HB4 A;  4CDX A;  2DCK A;  3CEW A;  2Y0O A;  3DXT A;  4K9S A;  5D1I A;  2IUW A;  1YO8 A;  3POS A;  1HRI 3;  2BJS A;  5LK7 B;  1RJ8 A;  1SFP A;  2R04 3;  4BQ4 A;  4G4F A;  4X8P A;  5FZ3 A;  1XSR A;  4AQT A;  2Y60 A;  4OQ8 A;  3R05 A;  4BB3 A;  4CXW A;  3MW3 A;  2VNO A;  4WM7 A;  3ZN4 A;  1E5S A;  3DKQ A;  1JU4 A;  3GHM A;  3VBU C;  4Y4R A;  3VUO A;  5CB7 A;  1PZ8 A;  1SHW B;  4OHV A;  5A3U A;  3BI3 A;  4CEW C;  1OUX A;  1XYP A;  4GKX A;  1RUF 1;  4LUK A;  4N8M A;  4XFC A;  4EN9 B;  5B4X A;  1ZBE 2;  1K5M C;  5DPN A;  1RHI 2;  2D44 A;  2PQS A;  1JYI A;  3SQO A;  1GQP A;  5CVR A;  3M3C A;  3POJ A;  1YFW A;  5ISL A;  3WP3 A;  4I0A A;  5DZG A;  2JG8 B;  4W4Z A;  3WW1 A;  1POV 0;  1NZI A;  2D43 A;  3CNA A;  4KNC A;  4LHL A;  5IWF A;  1IG0 A;  2XKO A;  2C9K A;  2HWD 1;  1C3H A;  5J96 B;  2W87 A;  4OVE A;  3TNQ A;  5KC5 A;  2KR2 A;  5T5L A;  2JB4 A;  3PL0 A;  2YBK A;  2WN3 A;  2RS5 2;  2Y0I A;  2ARB A;  1HJF A;  5BNN A;  2ZEY A;  2JXA A;  1DYO A;  5F39 A;  4Z8B A;  2B39 A;  4XF9 A;  4RS5 C;  5EXO A;  2CGN A;  5EYY A;  2UYA A;  1K45 A;  3HT1 A;  1BBT 3;  2XML A;  2D98 A;  3UJO A;  4M4P A;  4BLJ A;  5DG1 A;  2ZAH A;  2R07 1;  4GXL A;  1XU1 A;  5A80 A;  1MZ5 A;  2GAU A;  3M3I A;  3C7F A;  1RUE 2;  2D7F A;  3VZL A;  2BU9 A;  3OGV A;  1NA1 A;  2XUM A;  5A3N A;  3THC A;  5C3S A; 
#chains in the Genus database with same CATH homology
 5FY4 A;  2XDV A;  5LY1 A;  3N9M A;  5FPA A;  4GJZ A;  4AAP A;  4EZH A;  5A1L A;  3PUA A;  5FZD A;  5FZH A;  5IVV A;  5FPL A;  1VRB A;  5A7W B;  5FY1 A;  2XXZ A;  4EZ4 A;  5A7Q A;  4UF0 B;  5F2W A;  5A7W A;  3OPT A;  5A7O A;  3N9O A;  4TN7 A;  5ANQ A;  5A3T A;  4UF0 A;  3PUR A;  4AI9 A;  4LIV A;  4NUB A;  5F3E A;  5FBJ A;  5FUP A;  4V2V A;  3RVH A;  3KV9 A;  5FZ8 A;  5FYV A;  2WWJ A;  3LD8 A;  4LXL A;  3AVR A;  5IVE A;  4QWN A;  3K3O A;  5FWE A;  3KV6 A;  5LY2 A;  5FP4 A;  5FV3 A;  5IVF A;  4DIQ A;  5F5I A;  5FP8 A;  4CCN A;  4LIU A;  2Q8D A;  4GD4 A;  2OT7 A;  2OS2 A;  4Y33 A;  3U78 A;  3LDB A;  2OQ7 A;  5LW9 A;  2Q8E A;  2GP5 A;  5FXV A;  3NJY A;  4XDP A;  4BXF A;  5FYU A;  5FY7 A;  5FXZ A;  2PXJ A;  3ZPO A;  3N9P A;  5FUN A;  4QXB A;  4BIS A;  5FYM A;  3PUQ A;  5F3I A;  4CCO A;  4DO0 A;  5FZ0 A;  5FY0 A;  5FYS A;  2YU1 A;  5FPU A;  4GJY A;  5FZE A;  5KR7 A;  3K2O A;  3DXT A;  5FYB A;  2VD7 A;  2W2I A;  3AVS A;  5F3G A;  3UYJ A;  5FZI A;  3AL6 A;  3KVB A;  4E4H A;  3K3N A;  5FP7 A;  5A3W A;  4IGO A;  5FWJ A;  2WWU A;  2OQ6 A;  5FZ3 A;  5F5C A;  5FZC A;  5FXX A;  3N9Q A;  3KV5 A;  2GP3 A;  4ASK A;  4EYU A;  3KVA A;  5FPV A;  4QX8 A;  5FYY A;  5K4L A;  3AL5 A;  5FZ7 A;  5F2S A;  4Y4R A;  5IVB A;  4CUG A;  2YBP A;  4XDO A;  5FP9 A;  4IGP A;  3PUS A;  5FYH A;  4CCL A;  5FP3 A;  2P5B A;  5E6H A;  4CCJ A;  4D6R A;  5A3P A;  4QXH A;  3DXU A;  4V2W A;  4CSW A;  3OPW A;  3ZLI A;  5ISL A;  4HOO A;  4QXC A;  5F37 A;  5FY8 A;  2YU2 A;  4HON A;  5FZM A;  5IW0 A;  5FZF A;  3PU8 A;  2Q8C A;  5IWF A;  5FYC A;  5FYT A;  5FZG A;  5A7S A;  5FY9 A;  3KV4 A;  4C8D A;  5FZL A;  4IGQ A;  4D6Q A;  5FZK A;  5FZO B;  2YBS A;  3PTR B;  4QX7 A;  4BU2 A;  5FZ9 A;  2YBK A;  5A7P A;  5FZB A;  5FZ1 A;  5FZO A;  3N9L A;  5F39 A;  5FXW A;  5F3C A;  4CCK A;  3N9N A;  5FZ6 A;  3PU3 A;  2YPD A;  3PDQ A;  5F32 A;  5IVC A;  5F5A A;  4Y3O A;  2XUE A;  5FJH A;  2XML A;  4LIT A;  5FZA A;  4D6S A;  5CEH A;  4CCM A;  5FZ4 A;  4GAZ A;  3U4S A;  5IVJ A;  5FY5 A;  4URA A;  5A80 A;  5FJK A;  4QU1 A;  5IVY A;  5A7N A;  5LWB A;  5FYZ A;  5A1F A;  5A3N A;  5FYI A;  2OX0 A;  5FPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...