4GD9A

Circular permuted streptavidin n49/g48
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
131
structure length
120
Chain Sequence
b'NAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural consequences of cutting a binding loop: two circularly permuted variants of streptavidin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 25
structure length 120
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4gd9A00
1MEPA 4EKVA 4BX7B 2MF6A 1N43A 3WZQA 1VWPB 4GGRA 2C1SA 2IZKA 2RTHB 4BCSA 1LUQA 4JHQA 1SWDA 2G5LA 3SZHA 2AVIA 3T2WA 3RY1A 4CPIA 3EW1A 5IRAA 5K68A 4JNJA 4DNEA 5B5FA 4GD9A 3T6LA 1SWPA 2OF8A 3FDCA 3VHHA 2IZBA 2IZLB 4CPEA 1VWDB 3T2XA 2FHLA 1KL4A 1NDJA 1SWLA 1SWRA 1SWTA 4YVBA 2A8GA 1NC9A 1HQQA 3RDSA 3RDOA 4Z6JA 4Z27A 1LCVA 5F2BA 1SWUA 1VWEB 1AVDA 1SRFA 3RDQA 1SWOA 4OKAA 1SRGA 1MK5A 2IZHB 2IZAA 1IJ8A 2RTAA 2RTDB 2C1QA 1Y55X 1RXJA 1Y53X 2IZFB 2WPUA 1RXKA 1N4JA 4Y5DA 4I60A 4Z28A 1STRB 3VHIA 5L3YA 2RTPB 2FHNX 4GGZA 1KL3A 1SWHA 1VYOA 2Y3EA 1VWAB 1I9HA 1LCZA 1DF8A 1NQNA 1SWQA 1Y52X 4GJVA 4JO6A 1HY2A 1VWJB 1VWLB 2OFAA 1RSUB 2CAMA 3RDMA 1N9YA 4GJSA 1RSTB 2JGSA 1NQMA 3WZPA 1VWCB 1LDQA 3WZNA 4Z2PA 4Z2OA 2OF9A 2C4IA 2A5BA 2RTRB 3RDXA 2F01A 3VHMA 1LDOA 1VWRB 1SWAA 1VWOB 1VWFB 1AVEA 4GDAA 3VGWA 1WBIA 1SWFA 4CPHA 1VWBB 3MM0A 1VWKB 3PK2A 1SWGA 2RTLA 2RTFB 1SLDB 1VWGB 2RTBB 4BX5A 4BX6A 2RTKA 1VWMB 2Y32A 1HXZA 1N9MA 2RTNB 5CHKA 2IZCB 2RTOB 2QCBA 2RTQB 3T6FA 2RTEB 1HXLA 3RE6A 3SZJA 3WZOA 1VWIB 2RTIB 4Z2VA 2A5CA 3WYQA 3MG5A 1SLFB 2IZJA 3RDUA 3X00A 4BBOA 4CPHB 2ZSCA 1VWNB 4IRWA 1SWBA 4BX5B 2IZGB 3SZIA 4U46A 2OFBA 4CPFA 5CSEA 1SWEA 1STPA 1RXHA 1MOYA 2Y3FA 2RTCB 2RTJA 2UYWA 3EW2A 5JD2A 1SLGB 1PTSA 1VWHB 5IRWA 2IZDB 1VWQB 3WYPA 1SWCA 1SLEB 1KFFA 1LELA 4Y59A 4BJ8A 5K67A 4BX7A 1RAVA 1NBXA 1SRHA 1SREA 1N7YA 1SWJA 1SWKA 4GGTA 5B5GA 5IRUA 1LCWA 2GH7A 4BX6B 3RY2A 1SWNA 3RE5A 1STSB 2IZEB 1SWSA 2BC3A 2IZIA 1MM9A 1SRJA 1KL5A 2RTMA 1SRIA 2RTGB 2UZ2A
chains in the Genus database with same CATH superfamily
2NNQA 4QYPA 1BBPA 5L8IA 3QKGA 1TOUA 1Z24A 2FLJA 2YMSA 4KCAA 1VWPB 4GGRA 1E06A 5B11O 2RTHB 4FQBB 4Y0RA 3VU1A 2OVAA 3HK1A 4NNSA 4BCSA 4JHQA 3CKFA 1P6PA 4QGVA 1O8VA 1D2UA 3CWKA 4AZOA 1B0OA 1B8EA 4DNEA 4JNJA 4NNTA 3T6LA 1SWPA 2OF8A 1SXUA 2X4MA 3AKMA 3BS2A 4TNNA 4NYRA 2OL7A 2OVDA 5AJBA 3ZW1B 3RBYA 2Q2MA 3SOTA 1YWBA 1GT1A 2FTBA 4XMHA 1NDJA 2POAA 5HTEA 1X8UA 4NV7A 1Y9LA 1LPJA 1U18A 4CSBA 3RDQA 3BX7A 3NQ3A 4OKAA 3OD9A 5H9KA 2AMMX 2F09A 2IZHB 2IZAA 3FYFA 5EDBA 4A1HA 1RXJA 5F6BA 4Y5DA 1N4JA 4RUNA 2KTSA 2RTPB 1VYOA 1NP1A 5HCDC 4NP1A 3VG2A 5B3MO 2FGSA 4N7DA 3SAOA 1BWYA 4ORRA 3BU1A 3FEKA 3Q34A 1L6MA 2CAMA 2OFAA 1KXOA 5HA1A 1LIFA 1K3BA 3PH5A 1MX7A 1VWCB 4Z2OA 2LBVA 1GXAA 1AB0A 2A5BA 3HWFA 1DZPA 3VHMA 3ZUIA 2FR2A 1VWRB 1SWAA 3WZQA 4MISA 4XMDA 3HWGA 5F6ZA 3KVNA 2JOZA 3OJYC 1O1VA 3APVA 4QGWA 1A3YA 3VG7A 1JJUA 1SLDB 5LJDA 2RTKA 3U03A 3PP6A 2KD2A 1ZNGA 1N9MA 2WQ9A 3PDFA 2KT4B 5B2AO 3BX8A 1ALBA 4ORUA 4ODDA 1HXLA 3RE6A 3SZJA 3L4RA 4O3WA 4O49A 2DJGA 4LQZA 1GX8A 1EPBA 1ZNEA 1SXXA 5EEEA 4DQ4A 4IMOA 3X00A 2ZSCA 4IRWA 4ON1A 1SWBA 1X8NA 2G79A 4EQAC 2HMBA 1BRPA 2IZGB 3NX2A 2LBAA 2OVEA 5B27A 5DG4A 3SZIA 4YMYA 2PI3O 2FS7A 2LB6A 3HOEA 4ID2A 1MX8A 3LV4A 1FE3A 2VFBA 1MOYA 1E5PA 2RTJA 1DZJA 1AVGI 2FT9A 2RA6A 3DTQA 4QQ1A 3B2KA 2G78A 3EM0A 4B55A 1HBPA 1SLGB 2HZRA 3FW5A 3MX7A 2HNXA 4O4UA 4ZHHA 3VE1A 2IZDB 4YDBA 1CJ5A 1VWQB 1ZNKA 3T6FA 1SY1A 2ANSA 2DJFA 1SLEB 1SY2A 2OY8A 3BY0A 4QNIA 4UU3A 1LIBA 1NGLA 4U3QA 4AZRA 2CM9A 3D97A 4YCEA 1JYDA 4GUZA 2QO5A 3HPEA 5IXGA 5HA0A 1RAVA 5D8JA 3AEHA 1ICNA 1SRHA 3TGAA 3U9PC 2A0AA 2OFMX 3CQNA 3TGCA 1OEKA 1Y9TA 1N7YA 2Z4IA 1SWKA 2OZQA 5IRUA 2Q4NA 2GH7A 3ZI8A 3UAQA 3ZUOA 1OBPA 1SWSA 3F6ZB 5HTDA 1SRJA 1YP7A 3FR5A 3O19A 4QYNA 3WJCA 3WJGA 5LKEA 2UZ2A 1EXSA 1MEPA 2OVSA 2X32A 4I9SA 3WJDA 4YFQA 5KIDA 1E02A 4ZHDA 5B29A 3MBTA 4ORXA 1A2DA 3FA6A 1IKJA 1BSYA 3S5XA 4GETA 1ADLA 1LUQA 4YFPA 1FELA 2G5LA 4HWMA 4O3XB 3S26A 2AVIA 3T2WA 4CPIA 3C77X 4TJZA 2I5VO 5HBSA 2BLGA 1DZMA 3FDCA 5JR8A 2IZBA 2IZLB 2R56A 4AYHA 3ZZVA 1I04A 2EU7X 5LJGA 4YBPA 1KL4A 3BDRA 3P24A 1G7NA 2MWHA 4EEJA 5HZ8A 3AKNA 1KZXA 4MEEA 3WJBA 2BT9A 3RDOA 1B4MA 2X8SA 4Z27A 1CBRA 1LCVA 1E00A 1CBSA 2QMIA 5F2BA 1MDCA 4HPCA 1MVGA 2OY5O 4XMFA 2MJIA 1SRFA 2GTFX 5F58A 4ZHFA 4KT5A 1SWOA 5L8NA 4I95A 4U8UO 2WPUA 2RTDB 1QQSA 1Y55X 5FENA 3JQOA 3QQ2A 1RXKA 4L1NA 4LKPA 1CBIA 2JU3A 1TXLA 2JMBA 2R73A 4I60A 4Z28A 5L3YA 3F9DA 4GDZA 1SWHA 1BLRA 1GT4A 1DF8A 5IO5A 3FR2A 3FELA 3IA8A 2GTLN 1VWLB 1BJ7A 3B2JA 3RDMA 4I9RA 1N9YA 1RSTB 2JGSA 1NQMA 3VPJE 3WZNA 2WEWA 1SXWA 4PJ2A 3FR4A 4WBKA 1LDOA 2P8GA 2L67A 1QFVA 1UYOX 4LZVA 1WBIA 3P6EA 1SWFA 3N91A 3Q6LA 4NLIA 1VWBB 1DV9A 4GE1A 4I3DA 1OPAA 2JU7A 4KC8A 3PK2A 1DFVA 1HBQA 2RTLA 1VWGB 2AT5X 2RTBB 2X56A 3PEDA 4O4XA 3STKA 1E2TA 2BHVA 1W5RA 1FDQA 2X8FA 2Y32A 1HXZA 4GH7A 5CHKA 2IZCB 5K06A 1FENA 5AEOA 4OMXA 3PH6A 3ZW0A 1I06A 1TVQA 1U0XA 3WZOA 5D47A 2WWPA 3APWA 2Z4HA 3VG6A 3P6CA 4OS3A 3WYQA 2PY1A 1QFTA 3MG5A 1KZWA 2FWVA 3STNA 4IMNA 5EPQA 3HWEA 2IZJA 1OEEA 3VG3A 1A18A 1EI5A 1VWNB 2WQAE 2RCTA 1FEMA 1GKAB 3RKGA 3P02A 4A1YA 3UEUA 3D9WA 4QZUA 2OFBA 2QOSC 3KFIA 4OEMA 4CPFA 3CR6A 4CDEA 2RD7C 1R0UA 1T8VA 3ZW1A 1GT3A 2UYWA 1SMPI 3C78X 4NW4A 1B56A 1GGLA 3EW2A 3D4RA 4RUUA 2L9CA 4COTA 3S5VA 2K23A 5JD2A 1DC9A 4I6SA 1PTSA 1VWHB 4IBAA 4Y0QA 3BRNA 5LKFA 2X46A 4IB9A 1UREA 3OE3A 2OY7A 1KFFA 1KQWA 4Y0SA 4ZH6A 3UEWA 2AL0X 4FBRA 2IFBA 2GC9A 4BJ8A 3CKGA 4DQ3A 5HAEA 3B2LA 2A13A 2AT3X 5K67A 2QO6A 3APUA 3NP1A 4BX7A 5AJCA 2CZUA 3MVFA 1G5WA 3SLTA 1BSQA 4ORWA 2BS6A 4BX6B 2CBSA 2ZAIA 4HPAA 1X89A 3RE5A 4YGGA 1STSB 2IZEB 2KTDA 2IZIA 2WEXA 3WJFA 4AZPA 1KT4A 3EMMA 5K68A 5BVTA 3ZQ3A 3WVMA 1ICMA 3PECA 1ZNDA 2MF6A 4WFUA 1N43A 1JMXA 5HCEC 4A60A 3EBKA 4O9SA 5BVSA 4QRLA 2OYBO 1SWDA 3HOLA 3KFFA 1LICA 4I3BA 4INNA 2CBRA 3EC5A 3EW1A 3RY1A 3RZYA 3I0AA 1FJ1E 1QY2A 4GD9A 5EDCA 3VHHA 4BGFA 1ACDA 5B5FA 4GNYA 5EEDA 1HQPA 5LJKA 1IIUA 2OL6O 3APXA 3FENA 4MVIA 1DF3A 4O3YA 4CDCA 4U8UM 3T2XA 5LJEA 4ZGUA 4TKBA 1EW3A 4YVBA 2A8GA 1HMTA 1YWCA 1SY0A 1NC9A 1HQQA 3CBCA 1ERBA 1GX3A 4Z6JA 4MVEA 3P6FA 4Y0PA 3NBXX 4BQUA 2X34A 3T1DA 1QWDA 3JSQA 5D48A 2RCQA 1HMSA 1SRGA 2FS6A 1MK5A 2RTAA 4R0BA 1IJ8A 4MVLA 2C1QA 1Y53X 1IFCA 5CE4A 2ASNX 1STRB 3VHIA 2QOMA 2FHNX 2NP1A 4GGZA 1SY3A 2Y3EA 1VWAB 1I9HA 1LCZA 1SWQA 1KGLA 1Y52X 1AQBA 4YKMA 4GU8A 3K3LA 1HN2A 5LJCA 2Q2PA 1PBYA 3KZAA 1KT6A 2ALLX 2HKDA 3D96A 3WZPA 3WJEA 1LDQA 2LFOA 4IB8A 2OF9A 1X71A 1A57A 2F01A 4JGLA 3ELXA 2RQ0A 1VYFA 1U17A 3VE2A 4O4OA 5H9NA 5H9AA 1IKEA 1GX9A 2JN3A 3TGBA 2R74A 4CPHA 4D6BA 3MM0A 2AT0X 4BX5A 3NQ9A 1SWGA 2RTFB 2WR6A 2O62A 4ZR2A 4N7CA 2RTNB 3GE2A 1LKEA 1LIEA 1I78A 2YG2A 4IB6A 4NV8A 2RTQB 1X8PA 5D4AA 5F1EA 4EDEA 5HZ9A 4ZJ0A 1S7DA 3E3CA 1JYJA 2RTIB 4QGXA 3FA8A 4M7MA 4CV7A 2W2BA 1QY1A 1KT5A 1BM5A 3RDUA 3CQRA 3FA7A 2Q39A 2BS5A 2MM3A 4ZH9A 1BSOA 2X8TA 2GTLO 5DPQA 1LIDA 3HTYA 4LZUA 4YH0A 5AQ6A 3TF6A 1KQXA 5CSEA 1YIVA 5B10O 3WBGA 4AZMA 3KQ0A 4K19A 4ORSA 3ZW0B 1Y0GA 4WFVA 5FAZA 3BLGA 1S44A 4YFRA 3LHNA 3VG5A 1WUBA 2W2AA 2A3FX 4QAEA 2NNDA 5FFHA 3V8UA 3ELZA 1JIWI 5KICA 4TKJA 4BVMA 5HCCC 1G85A 5BYPA 5LJHA 1I4UA 1SXYA 4TKHA 1JJXA 1LELA 2N93A 1HMRA 1YWAA 1ZRYA 1EPAA 2A2GA 4Y59A 3CBSA 5BVQA 4L3RA 1T68X 4GKCA 1JJJA 2DM5A 2MHDA 4FBVA 1YWDA 1NBXA 3KFGA 3BSZE 4HPDA 1OPBA 3FMZA 4ZFXA 4ZHCA 4KH8A 2XSTA 1SWJA 4CDFA 5B5GA 1LCWA 1AELA 1EALA 3NQKA 1IW2A 2L68A 1QG5A 1SWNA 4IAWA 4FGIB 3RY2A 1W4TA 3NX1A 3UEVA 3ZWEA 2BC3A 5L8OA 4LKTA 1ZNHA 3STMX 1KL5A 2ACOA 4YKOA 5H8TA 2RTGB 4ML7B 1BRQA 2F73A 1XKIA 4EKVA 2WUTA 3B2HA 3LTWA 2FKJA 4DCBA 2G8CO 5H9LA 4ALBA 4BX7B 1X8OA 2K62A 2ZAGA 2C1SA 2IZKA 4YCHA 4ZCBA 1PMPA 3SLOA 3SZHA 2HLVA 1ERXA 1EIOA 3PQUA 5IRAA 1OSPO 1PBOA 1LNMA 2LA7A 3HWDA 4GNWA 3FEPA 4CK4A 1NP4A 1EUOA 5EZ2A 4CPEA 2RTMA 1VWDB 5IO7A 4UU2A 5C0NA 2FHLA 1SWLA 1SWRA 2BSZA 4ORYA 1SWTA 4MIRA 1UYNX 4YDAA 1KT3A 2GJ5A 4HPBA 4NLJA 5FQ6E 4A8ZA 3RDSA 4MVKA 4IB7A 3FA9A 4KC7A 1H91A 1VWEB 1SWUA 1AVDA 1GKAA 3GAQA 1IFBA 5FQ8E 1CRBA 1OBQA 1OBUA 2A2UA 4D6AA 3P6DA 4OS0A 1UZ2X 1VPRA 3P6GA 1JBHA 2IZFB 4AW8A 2FR3A 2RN4A 3TZSA 4PSQA 4BOEA 1KL3A 1JZUA 1NQNA 2LKKA 2OFRX 3NPOA 4GJVA 3CMPA 4JO6A 1HY2A 3C76X 4NYQA 5D45A 1VWJB 3I17A 4XMEA 4GZVA 2CZTA 4FBOA 3D95A 4EXZA 1RSUB 2HZQA 1O1UA 4GJSA 4O3ZA 4XMCA 3ZW2A 3O22A 1QABE 4Z2PA 2KW1A 5F7GA 3DSZA 2C4IA 1K24A 2RTRB 3RDXA 3IFBA 1XCAA 2G7BA 3EYCA 3VG4A 4CDDA 4O4SA 4YGZA 1YP6A 4TQ2A 1VWOB 1VWFB 4YGHA 1TOWA 5CYBA 1AVEA 4GDAA 3VGWA 3P6HA 1BEBA 4EFGA 3KFHA 1PEEA 1VWKB 4AZQA 4BX6A 4ES7A 5IO6A 1RLBE 3NR3A 1JQPA 1JV4A 2W2FA 4IABA 4WHIA 1VWMB 3UEXA 1GM6A 2GTLM 1G74A 2VDFA 2RTOB 1ZNLA 1X8QA 2QCBA 2XKLA 3AUMO 1W6FA 2AF5A 2RTEB 1QY0A 3O2YA 4U9CA 3RWXA 5HZ6A 1VWIB 5HZ5A 2JU8A 4Z2VA 2A5CA 4KIIA 1KT7A 2X45A 3G7XA 1SLFB 4XMGA 3RSWA 2OY1O 4OS8A 4BBOA 4C5PA 4CPHB 4TLJA 1YUPA 2OL8O 4BX5B 3S60A 5LJBA 3F8AA 4AZNA 1S2PA 1MUPA 2VFCA 4GK9A 2M4LA 4U46A 3JS1A 2WSJA 2FKGA 1SWEA 1STPA 1RXHA 3BU9A 2I5ZO 4YBUA 2Q9SA 2Y3FA 2JW1A 2RTCB 3NADA 5FQ7E 1SA8A 3B2IA 2MO5A 4QZTA 1GT5A 2QO4A 1KOIA 3FLLA 1N0SA 1OEJA 4HFOA 5IRWA 1DZKA 5KHPA 1I05A 3WYPA 1SWCA 2FRSA 3PPTA 4ZGFA 1D3SA 2AT6X 4I3CA 3SLJA 1T0VA 2HYSA 2X55A 4ALOA 1ML7A 4ARHA 3FIDA 3PQSA 2E4JA 5HWZA 1TW4A 2AKQA 4OMWA 2AT8X 1JMZA 1EQDA 2L5PA 1EIIA 3EBWA 1SREA 2ACPX 1VYGA 4GRJA 4GGTA 1FTPA 1LFOA 1PM1X 1RBPA 2CM4A 3WXQA 4IAXA 1LF7A 4OELA 4ZHGA 3U0DA 3H3IA 3WOVA 3FW4A 2AH7X 1MM9A 4M6SA 2NNEA 3FIQA 2QM9A 3OBLA 1SRIA 1CBQA 5HZQA 4U8UN
chains in the Genus database with same CATH topology
1MEPA 4EKVA 4BX7B 2MF6A 1N43A 3WZQA 1VWPB 4GGRA 2C1SA 2IZKA 2RTHB 4BCSA 1LUQA 4JHQA 1SWDA 2G5LA 3SZHA 2AVIA 3T2WA 3RY1A 4CPIA 3EW1A 5IRAA 5K68A 4JNJA 4DNEA 5B5FA 4GD9A 3T6LA 1SWPA 2OF8A 3FDCA 3VHHA 2IZBA 2IZLB 4CPEA 1VWDB 3T2XA 2FHLA 1KL4A 1NDJA 1SWLA 1SWRA 1SWTA 4YVBA 2A8GA 1NC9A 1HQQA 3RDSA 3RDOA 4Z6JA 4Z27A 1LCVA 5F2BA 1SWUA 1VWEB 1AVDA 1SRFA 3RDQA 1SWOA 4OKAA 1SRGA 1MK5A 2IZHB 2IZAA 1IJ8A 2RTAA 2RTDB 2C1QA 1Y55X 1RXJA 1Y53X 2IZFB 2WPUA 1RXKA 1N4JA 4Y5DA 4I60A 4Z28A 1STRB 3VHIA 5L3YA 2RTPB 2FHNX 4GGZA 1KL3A 1SWHA 1VYOA 2Y3EA 1VWAB 1I9HA 1LCZA 1DF8A 1NQNA 1SWQA 1Y52X 4GJVA 4JO6A 1HY2A 1VWJB 1VWLB 2OFAA 1RSUB 2CAMA 3RDMA 1N9YA 4GJSA 1RSTB 2JGSA 1NQMA 3WZPA 1VWCB 1LDQA 3WZNA 4Z2PA 4Z2OA 2OF9A 2C4IA 2A5BA 2RTRB 3RDXA 2F01A 3VHMA 1LDOA 1VWRB 1SWAA 1VWOB 1VWFB 1AVEA 4GDAA 3VGWA 1WBIA 1SWFA 4CPHA 1VWBB 3MM0A 1VWKB 3PK2A 1SWGA 2RTLA 2RTFB 1SLDB 1VWGB 2RTBB 4BX5A 4BX6A 2RTKA 1VWMB 2Y32A 1HXZA 1N9MA 2RTNB 5CHKA 2IZCB 2RTOB 2QCBA 2RTQB 3T6FA 2RTEB 1HXLA 3RE6A 3SZJA 3WZOA 1VWIB 2RTIB 4Z2VA 2A5CA 3WYQA 3MG5A 1SLFB 2IZJA 3RDUA 3X00A 4BBOA 4CPHB 2ZSCA 1VWNB 4IRWA 1SWBA 4BX5B 2IZGB 3SZIA 4U46A 2OFBA 4CPFA 5CSEA 1SWEA 1STPA 1RXHA 1MOYA 2Y3FA 2RTCB 2RTJA 2UYWA 3EW2A 5JD2A 1SLGB 1PTSA 1VWHB 5IRWA 2IZDB 1VWQB 3WYPA 1SWCA 1SLEB 1KFFA 1LELA 4Y59A 4BJ8A 5K67A 4BX7A 1RAVA 1NBXA 1SRHA 1SREA 1N7YA 1SWJA 1SWKA 4GGTA 5B5GA 5IRUA 1LCWA 2GH7A 4BX6B 3RY2A 1SWNA 3RE5A 1STSB 2IZEB 1SWSA 2BC3A 2IZIA 1MM9A 1SRJA 1KL5A 2RTMA 1SRIA 2RTGB 2UZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEP A;  4EKV A;  4BX7 B;  2MF6 A;  1N43 A;  3WZQ A;  1VWP B;  4GGR A;  2C1S A;  2IZK A;  2RTH B;  4BCS A;  1LUQ A;  4JHQ A;  1SWD A;  2G5L A;  3SZH A;  2AVI A;  3T2W A;  3RY1 A;  4CPI A;  3EW1 A;  5IRA A;  5K68 A;  4JNJ A;  4DNE A;  5B5F A;  4GD9 A;  3T6L A;  1SWP A;  2OF8 A;  3FDC A;  3VHH A;  2IZB A;  2IZL B;  4CPE A;  1VWD B;  3T2X A;  2FHL A;  1KL4 A;  1NDJ A;  1SWL A;  1SWR A;  1SWT A;  4YVB A;  2A8G A;  1NC9 A;  1HQQ A;  3RDS A;  3RDO A;  4Z6J A;  4Z27 A;  1LCV A;  5F2B A;  1SWU A;  1VWE B;  1AVD A;  1SRF A;  3RDQ A;  1SWO A;  4OKA A;  1SRG A;  1MK5 A;  2IZH B;  2IZA A;  1IJ8 A;  2RTA A;  2RTD B;  2C1Q A;  1Y55 X;  1RXJ A;  1Y53 X;  2IZF B;  2WPU A;  1RXK A;  1N4J A;  4Y5D A;  4I60 A;  4Z28 A;  1STR B;  3VHI A;  5L3Y A;  2RTP B;  2FHN X;  4GGZ A;  1KL3 A;  1SWH A;  1VYO A;  2Y3E A;  1VWA B;  1I9H A;  1LCZ A;  1DF8 A;  1NQN A;  1SWQ A;  1Y52 X;  4GJV A;  4JO6 A;  1HY2 A;  1VWJ B;  1VWL B;  2OFA A;  1RSU B;  2CAM A;  3RDM A;  1N9Y A;  4GJS A;  1RST B;  2JGS A;  1NQM A;  3WZP A;  1VWC B;  1LDQ A;  3WZN A;  4Z2P A;  4Z2O A;  2OF9 A;  2C4I A;  2A5B A;  2RTR B;  3RDX A;  2F01 A;  3VHM A;  1LDO A;  1VWR B;  1SWA A;  1VWO B;  1VWF B;  1AVE A;  4GDA A;  3VGW A;  1WBI A;  1SWF A;  4CPH A;  1VWB B;  3MM0 A;  1VWK B;  3PK2 A;  1SWG A;  2RTL A;  2RTF B;  1SLD B;  1VWG B;  2RTB B;  4BX5 A;  4BX6 A;  2RTK A;  1VWM B;  2Y32 A;  1HXZ A;  1N9M A;  2RTN B;  5CHK A;  2IZC B;  2RTO B;  2QCB A;  2RTQ B;  3T6F A;  2RTE B;  1HXL A;  3RE6 A;  3SZJ A;  3WZO A;  1VWI B;  2RTI B;  4Z2V A;  2A5C A;  3WYQ A;  3MG5 A;  1SLF B;  2IZJ A;  3RDU A;  3X00 A;  4BBO A;  4CPH B;  2ZSC A;  1VWN B;  4IRW A;  1SWB A;  4BX5 B;  2IZG B;  3SZI A;  4U46 A;  2OFB A;  4CPF A;  5CSE A;  1SWE A;  1STP A;  1RXH A;  1MOY A;  2Y3F A;  2RTC B;  2RTJ A;  2UYW A;  3EW2 A;  5JD2 A;  1SLG B;  1PTS A;  1VWH B;  5IRW A;  2IZD B;  1VWQ B;  3WYP A;  1SWC A;  1SLE B;  1KFF A;  1LEL A;  4Y59 A;  4BJ8 A;  5K67 A;  4BX7 A;  1RAV A;  1NBX A;  1SRH A;  1SRE A;  1N7Y A;  1SWJ A;  1SWK A;  4GGT A;  5B5G A;  5IRU A;  1LCW A;  2GH7 A;  4BX6 B;  3RY2 A;  1SWN A;  3RE5 A;  1STS B;  2IZE B;  1SWS A;  2BC3 A;  2IZI A;  1MM9 A;  1SRJ A;  1KL5 A;  2RTM A;  1SRI A;  2RTG B;  2UZ2 A; 
#chains in the Genus database with same CATH topology
 2NNQ A;  4QYP A;  1BBP A;  5L8I A;  3QKG A;  1TOU A;  1Z24 A;  2FLJ A;  2YMS A;  4KCA A;  1VWP B;  4GGR A;  1E06 A;  5B11 O;  2RTH B;  4FQB B;  4Y0R A;  3VU1 A;  2OVA A;  3HK1 A;  4NNS A;  4BCS A;  4JHQ A;  3CKF A;  1P6P A;  4QGV A;  1O8V A;  1D2U A;  3CWK A;  4AZO A;  1B0O A;  1B8E A;  4DNE A;  4JNJ A;  4NNT A;  3T6L A;  1SWP A;  2OF8 A;  1SXU A;  2X4M A;  3AKM A;  3BS2 A;  4TNN A;  4NYR A;  2OL7 A;  2OVD A;  5AJB A;  3ZW1 B;  3RBY A;  2Q2M A;  3SOT A;  1YWB A;  1GT1 A;  2FTB A;  4XMH A;  1NDJ A;  2POA A;  5HTE A;  1X8U A;  4NV7 A;  1Y9L A;  1LPJ A;  1U18 A;  4CSB A;  3RDQ A;  3BX7 A;  3NQ3 A;  4OKA A;  3OD9 A;  5H9K A;  2AMM X;  2F09 A;  2IZH B;  2IZA A;  3FYF A;  5EDB A;  4A1H A;  1RXJ A;  5F6B A;  4Y5D A;  1N4J A;  4RUN A;  2KTS A;  2RTP B;  1VYO A;  1NP1 A;  5HCD C;  4NP1 A;  3VG2 A;  5B3M O;  2FGS A;  4N7D A;  3SAO A;  1BWY A;  4ORR A;  3BU1 A;  3FEK A;  3Q34 A;  1L6M A;  2CAM A;  2OFA A;  1KXO A;  5HA1 A;  1LIF A;  1K3B A;  3PH5 A;  1MX7 A;  1VWC B;  4Z2O A;  2LBV A;  1GXA A;  1AB0 A;  2A5B A;  3HWF A;  1DZP A;  3VHM A;  3ZUI A;  2FR2 A;  1VWR B;  1SWA A;  3WZQ A;  4MIS A;  4XMD A;  3HWG A;  5F6Z A;  3KVN A;  2JOZ A;  3OJY C;  1O1V A;  3APV A;  4QGW A;  1A3Y A;  3VG7 A;  1JJU A;  1SLD B;  5LJD A;  2RTK A;  3U03 A;  3PP6 A;  2KD2 A;  1ZNG A;  1N9M A;  2WQ9 A;  3PDF A;  2KT4 B;  5B2A O;  3BX8 A;  1ALB A;  4ORU A;  4ODD A;  1HXL A;  3RE6 A;  3SZJ A;  3L4R A;  4O3W A;  4O49 A;  2DJG A;  4LQZ A;  1GX8 A;  1EPB A;  1ZNE A;  1SXX A;  5EEE A;  4DQ4 A;  4IMO A;  3X00 A;  2ZSC A;  4IRW A;  4ON1 A;  1SWB A;  1X8N A;  2G79 A;  4EQA C;  2HMB A;  1BRP A;  2IZG B;  3NX2 A;  2LBA A;  2OVE A;  5B27 A;  5DG4 A;  3SZI A;  4YMY A;  2PI3 O;  2FS7 A;  2LB6 A;  3HOE A;  4ID2 A;  1MX8 A;  3LV4 A;  1FE3 A;  2VFB A;  1MOY A;  1E5P A;  2RTJ A;  1DZJ A;  1AVG I;  2FT9 A;  2RA6 A;  3DTQ A;  4QQ1 A;  3B2K A;  2G78 A;  3EM0 A;  4B55 A;  1HBP A;  1SLG B;  2HZR A;  3FW5 A;  3MX7 A;  2HNX A;  4O4U A;  4ZHH A;  3VE1 A;  2IZD B;  4YDB A;  1CJ5 A;  1VWQ B;  1ZNK A;  3T6F A;  1SY1 A;  2ANS A;  2DJF A;  1SLE B;  1SY2 A;  2OY8 A;  3BY0 A;  4QNI A;  4UU3 A;  1LIB A;  1NGL A;  4U3Q A;  4AZR A;  2CM9 A;  3D97 A;  4YCE A;  1JYD A;  4GUZ A;  2QO5 A;  3HPE A;  5IXG A;  5HA0 A;  1RAV A;  5D8J A;  3AEH A;  1ICN A;  1SRH A;  3TGA A;  3U9P C;  2A0A A;  2OFM X;  3CQN A;  3TGC A;  1OEK A;  1Y9T A;  1N7Y A;  2Z4I A;  1SWK A;  2OZQ A;  5IRU A;  2Q4N A;  2GH7 A;  3ZI8 A;  3UAQ A;  3ZUO A;  1OBP A;  1SWS A;  3F6Z B;  5HTD A;  1SRJ A;  1YP7 A;  3FR5 A;  3O19 A;  4QYN A;  3WJC A;  3WJG A;  5LKE A;  2UZ2 A;  1EXS A;  1MEP A;  2OVS A;  2X32 A;  4I9S A;  3WJD A;  4YFQ A;  5KID A;  1E02 A;  4ZHD A;  5B29 A;  3MBT A;  4ORX A;  1A2D A;  3FA6 A;  1IKJ A;  1BSY A;  3S5X A;  4GET A;  1ADL A;  1LUQ A;  4YFP A;  1FEL A;  2G5L A;  4HWM A;  4O3X B;  3S26 A;  2AVI A;  3T2W A;  4CPI A;  3C77 X;  4TJZ A;  2I5V O;  5HBS A;  2BLG A;  1DZM A;  3FDC A;  5JR8 A;  2IZB A;  2IZL B;  2R56 A;  4AYH A;  3ZZV A;  1I04 A;  2EU7 X;  5LJG A;  4YBP A;  1KL4 A;  3BDR A;  3P24 A;  1G7N A;  2MWH A;  4EEJ A;  5HZ8 A;  3AKN A;  1KZX A;  4MEE A;  3WJB A;  2BT9 A;  3RDO A;  1B4M A;  2X8S A;  4Z27 A;  1CBR A;  1LCV A;  1E00 A;  1CBS A;  2QMI A;  5F2B A;  1MDC A;  4HPC A;  1MVG A;  2OY5 O;  4XMF A;  2MJI A;  1SRF A;  2GTF X;  5F58 A;  4ZHF A;  4KT5 A;  1SWO A;  5L8N A;  4I95 A;  4U8U O;  2WPU A;  2RTD B;  1QQS A;  1Y55 X;  5FEN A;  3JQO A;  3QQ2 A;  1RXK A;  4L1N A;  4LKP A;  1CBI A;  2JU3 A;  1TXL A;  2JMB A;  2R73 A;  4I60 A;  4Z28 A;  5L3Y A;  3F9D A;  4GDZ A;  1SWH A;  1BLR A;  1GT4 A;  1DF8 A;  5IO5 A;  3FR2 A;  3FEL A;  3IA8 A;  2GTL N;  1VWL B;  1BJ7 A;  3B2J A;  3RDM A;  4I9R A;  1N9Y A;  1RST B;  2JGS A;  1NQM A;  3VPJ E;  3WZN A;  2WEW A;  1SXW A;  4PJ2 A;  3FR4 A;  4WBK A;  1LDO A;  2P8G A;  2L67 A;  1QFV A;  1UYO X;  4LZV A;  1WBI A;  3P6E A;  1SWF A;  3N91 A;  3Q6L A;  4NLI A;  1VWB B;  1DV9 A;  4GE1 A;  4I3D A;  1OPA A;  2JU7 A;  4KC8 A;  3PK2 A;  1DFV A;  1HBQ A;  2RTL A;  1VWG B;  2AT5 X;  2RTB B;  2X56 A;  3PED A;  4O4X A;  3STK A;  1E2T A;  2BHV A;  1W5R A;  1FDQ A;  2X8F A;  2Y32 A;  1HXZ A;  4GH7 A;  5CHK A;  2IZC B;  5K06 A;  1FEN A;  5AEO A;  4OMX A;  3PH6 A;  3ZW0 A;  1I06 A;  1TVQ A;  1U0X A;  3WZO A;  5D47 A;  2WWP A;  3APW A;  2Z4H A;  3VG6 A;  3P6C A;  4OS3 A;  3WYQ A;  2PY1 A;  1QFT A;  3MG5 A;  1KZW A;  2FWV A;  3STN A;  4IMN A;  5EPQ A;  3HWE A;  2IZJ A;  1OEE A;  3VG3 A;  1A18 A;  1EI5 A;  1VWN B;  2WQA E;  2RCT A;  1FEM A;  1GKA B;  3RKG A;  3P02 A;  4A1Y A;  3UEU A;  3D9W A;  4QZU A;  2OFB A;  2QOS C;  3KFI A;  4OEM A;  4CPF A;  3CR6 A;  4CDE A;  2RD7 C;  1R0U A;  1T8V A;  3ZW1 A;  1GT3 A;  2UYW A;  1SMP I;  3C78 X;  4NW4 A;  1B56 A;  1GGL A;  3EW2 A;  3D4R A;  4RUU A;  2L9C A;  4COT A;  3S5V A;  2K23 A;  5JD2 A;  1DC9 A;  4I6S A;  1PTS A;  1VWH B;  4IBA A;  4Y0Q A;  3BRN A;  5LKF A;  2X46 A;  4IB9 A;  1URE A;  3OE3 A;  2OY7 A;  1KFF A;  1KQW A;  4Y0S A;  4ZH6 A;  3UEW A;  2AL0 X;  4FBR A;  2IFB A;  2GC9 A;  4BJ8 A;  3CKG A;  4DQ3 A;  5HAE A;  3B2L A;  2A13 A;  2AT3 X;  5K67 A;  2QO6 A;  3APU A;  3NP1 A;  4BX7 A;  5AJC A;  2CZU A;  3MVF A;  1G5W A;  3SLT A;  1BSQ A;  4ORW A;  2BS6 A;  4BX6 B;  2CBS A;  2ZAI A;  4HPA A;  1X89 A;  3RE5 A;  4YGG A;  1STS B;  2IZE B;  2KTD A;  2IZI A;  2WEX A;  3WJF A;  4AZP A;  1KT4 A;  3EMM A;  5K68 A;  5BVT A;  3ZQ3 A;  3WVM A;  1ICM A;  3PEC A;  1ZND A;  2MF6 A;  4WFU A;  1N43 A;  1JMX A;  5HCE C;  4A60 A;  3EBK A;  4O9S A;  5BVS A;  4QRL A;  2OYB O;  1SWD A;  3HOL A;  3KFF A;  1LIC A;  4I3B A;  4INN A;  2CBR A;  3EC5 A;  3EW1 A;  3RY1 A;  3RZY A;  3I0A A;  1FJ1 E;  1QY2 A;  4GD9 A;  5EDC A;  3VHH A;  4BGF A;  1ACD A;  5B5F A;  4GNY A;  5EED A;  1HQP A;  5LJK A;  1IIU A;  2OL6 O;  3APX A;  3FEN A;  4MVI A;  1DF3 A;  4O3Y A;  4CDC A;  4U8U M;  3T2X A;  5LJE A;  4ZGU A;  4TKB A;  1EW3 A;  4YVB A;  2A8G A;  1HMT A;  1YWC A;  1SY0 A;  1NC9 A;  1HQQ A;  3CBC A;  1ERB A;  1GX3 A;  4Z6J A;  4MVE A;  3P6F A;  4Y0P A;  3NBX X;  4BQU A;  2X34 A;  3T1D A;  1QWD A;  3JSQ A;  5D48 A;  2RCQ A;  1HMS A;  1SRG A;  2FS6 A;  1MK5 A;  2RTA A;  4R0B A;  1IJ8 A;  4MVL A;  2C1Q A;  1Y53 X;  1IFC A;  5CE4 A;  2ASN X;  1STR B;  3VHI A;  2QOM A;  2FHN X;  2NP1 A;  4GGZ A;  1SY3 A;  2Y3E A;  1VWA B;  1I9H A;  1LCZ A;  1SWQ A;  1KGL A;  1Y52 X;  1AQB A;  4YKM A;  4GU8 A;  3K3L A;  1HN2 A;  5LJC A;  2Q2P A;  1PBY A;  3KZA A;  1KT6 A;  2ALL X;  2HKD A;  3D96 A;  3WZP A;  3WJE A;  1LDQ A;  2LFO A;  4IB8 A;  2OF9 A;  1X71 A;  1A57 A;  2F01 A;  4JGL A;  3ELX A;  2RQ0 A;  1VYF A;  1U17 A;  3VE2 A;  4O4O A;  5H9N A;  5H9A A;  1IKE A;  1GX9 A;  2JN3 A;  3TGB A;  2R74 A;  4CPH A;  4D6B A;  3MM0 A;  2AT0 X;  4BX5 A;  3NQ9 A;  1SWG A;  2RTF B;  2WR6 A;  2O62 A;  4ZR2 A;  4N7C A;  2RTN B;  3GE2 A;  1LKE A;  1LIE A;  1I78 A;  2YG2 A;  4IB6 A;  4NV8 A;  2RTQ B;  1X8P A;  5D4A A;  5F1E A;  4EDE A;  5HZ9 A;  4ZJ0 A;  1S7D A;  3E3C A;  1JYJ A;  2RTI B;  4QGX A;  3FA8 A;  4M7M A;  4CV7 A;  2W2B A;  1QY1 A;  1KT5 A;  1BM5 A;  3RDU A;  3CQR A;  3FA7 A;  2Q39 A;  2BS5 A;  2MM3 A;  4ZH9 A;  1BSO A;  2X8T A;  2GTL O;  5DPQ A;  1LID A;  3HTY A;  4LZU A;  4YH0 A;  5AQ6 A;  3TF6 A;  1KQX A;  5CSE A;  1YIV A;  5B10 O;  3WBG A;  4AZM A;  3KQ0 A;  4K19 A;  4ORS A;  3ZW0 B;  1Y0G A;  4WFV A;  5FAZ A;  3BLG A;  1S44 A;  4YFR A;  3LHN A;  3VG5 A;  1WUB A;  2W2A A;  2A3F X;  4QAE A;  2NND A;  5FFH A;  3V8U A;  3ELZ A;  1JIW I;  5KIC A;  4TKJ A;  4BVM A;  5HCC C;  1G85 A;  5BYP A;  5LJH A;  1I4U A;  1SXY A;  4TKH A;  1JJX A;  1LEL A;  2N93 A;  1HMR A;  1YWA A;  1ZRY A;  1EPA A;  2A2G A;  4Y59 A;  3CBS A;  5BVQ A;  4L3R A;  1T68 X;  4GKC A;  1JJJ A;  2DM5 A;  2MHD A;  4FBV A;  1YWD A;  1NBX A;  3KFG A;  3BSZ E;  4HPD A;  1OPB A;  3FMZ A;  4ZFX A;  4ZHC A;  4KH8 A;  2XST A;  1SWJ A;  4CDF A;  5B5G A;  1LCW A;  1AEL A;  1EAL A;  3NQK A;  1IW2 A;  2L68 A;  1QG5 A;  1SWN A;  4IAW A;  4FGI B;  3RY2 A;  1W4T A;  3NX1 A;  3UEV A;  3ZWE A;  2BC3 A;  5L8O A;  4LKT A;  1ZNH A;  3STM X;  1KL5 A;  2ACO A;  4YKO A;  5H8T A;  2RTG B;  4ML7 B;  1BRQ A;  2F73 A;  1XKI A;  4EKV A;  2WUT A;  3B2H A;  3LTW A;  2FKJ A;  4DCB A;  2G8C O;  5H9L A;  4ALB A;  4BX7 B;  1X8O A;  2K62 A;  2ZAG A;  2C1S A;  2IZK A;  4YCH A;  4ZCB A;  1PMP A;  3SLO A;  3SZH A;  2HLV A;  1ERX A;  1EIO A;  3PQU A;  5IRA A;  1OSP O;  1PBO A;  1LNM A;  2LA7 A;  3HWD A;  4GNW A;  3FEP A;  4CK4 A;  1NP4 A;  1EUO A;  5EZ2 A;  4CPE A;  2RTM A;  1VWD B;  5IO7 A;  4UU2 A;  5C0N A;  2FHL A;  1SWL A;  1SWR A;  2BSZ A;  4ORY A;  1SWT A;  4MIR A;  1UYN X;  4YDA A;  1KT3 A;  2GJ5 A;  4HPB A;  4NLJ A;  5FQ6 E;  4A8Z A;  3RDS A;  4MVK A;  4IB7 A;  3FA9 A;  4KC7 A;  1H91 A;  1VWE B;  1SWU A;  1AVD A;  1GKA A;  3GAQ A;  1IFB A;  5FQ8 E;  1CRB A;  1OBQ A;  1OBU A;  2A2U A;  4D6A A;  3P6D A;  4OS0 A;  1UZ2 X;  1VPR A;  3P6G A;  1JBH A;  2IZF B;  4AW8 A;  2FR3 A;  2RN4 A;  3TZS A;  4PSQ A;  4BOE A;  1KL3 A;  1JZU A;  1NQN A;  2LKK A;  2OFR X;  3NPO A;  4GJV A;  3CMP A;  4JO6 A;  1HY2 A;  3C76 X;  4NYQ A;  5D45 A;  1VWJ B;  3I17 A;  4XME A;  4GZV A;  2CZT A;  4FBO A;  3D95 A;  4EXZ A;  1RSU B;  2HZQ A;  1O1U A;  4GJS A;  4O3Z A;  4XMC A;  3ZW2 A;  3O22 A;  1QAB E;  4Z2P A;  2KW1 A;  5F7G A;  3DSZ A;  2C4I A;  1K24 A;  2RTR B;  3RDX A;  3IFB A;  1XCA A;  2G7B A;  3EYC A;  3VG4 A;  4CDD A;  4O4S A;  4YGZ A;  1YP6 A;  4TQ2 A;  1VWO B;  1VWF B;  4YGH A;  1TOW A;  5CYB A;  1AVE A;  4GDA A;  3VGW A;  3P6H A;  1BEB A;  4EFG A;  3KFH A;  1PEE A;  1VWK B;  4AZQ A;  4BX6 A;  4ES7 A;  5IO6 A;  1RLB E;  3NR3 A;  1JQP A;  1JV4 A;  2W2F A;  4IAB A;  4WHI A;  1VWM B;  3UEX A;  1GM6 A;  2GTL M;  1G74 A;  2VDF A;  2RTO B;  1ZNL A;  1X8Q A;  2QCB A;  2XKL A;  3AUM O;  1W6F A;  2AF5 A;  2RTE B;  1QY0 A;  3O2Y A;  4U9C A;  3RWX A;  5HZ6 A;  1VWI B;  5HZ5 A;  2JU8 A;  4Z2V A;  2A5C A;  4KII A;  1KT7 A;  2X45 A;  3G7X A;  1SLF B;  4XMG A;  3RSW A;  2OY1 O;  4OS8 A;  4BBO A;  4C5P A;  4CPH B;  4TLJ A;  1YUP A;  2OL8 O;  4BX5 B;  3S60 A;  5LJB A;  3F8A A;  4AZN A;  1S2P A;  1MUP A;  2VFC A;  4GK9 A;  2M4L A;  4U46 A;  3JS1 A;  2WSJ A;  2FKG A;  1SWE A;  1STP A;  1RXH A;  3BU9 A;  2I5Z O;  4YBU A;  2Q9S A;  2Y3F A;  2JW1 A;  2RTC B;  3NAD A;  5FQ7 E;  1SA8 A;  3B2I A;  2MO5 A;  4QZT A;  1GT5 A;  2QO4 A;  1KOI A;  3FLL A;  1N0S A;  1OEJ A;  4HFO A;  5IRW A;  1DZK A;  5KHP A;  1I05 A;  3WYP A;  1SWC A;  2FRS A;  3PPT A;  4ZGF A;  1D3S A;  2AT6 X;  4I3C A;  3SLJ A;  1T0V A;  2HYS A;  2X55 A;  4ALO A;  1ML7 A;  4ARH A;  3FID A;  3PQS A;  2E4J A;  5HWZ A;  1TW4 A;  2AKQ A;  4OMW A;  2AT8 X;  1JMZ A;  1EQD A;  2L5P A;  1EII A;  3EBW A;  1SRE A;  2ACP X;  1VYG A;  4GRJ A;  4GGT A;  1FTP A;  1LFO A;  1PM1 X;  1RBP A;  2CM4 A;  3WXQ A;  4IAX A;  1LF7 A;  4OEL A;  4ZHG A;  3U0D A;  3H3I A;  3WOV A;  3FW4 A;  2AH7 X;  1MM9 A;  4M6S A;  2NNE A;  3FIQ A;  2QM9 A;  3OBL A;  1SRI A;  1CBQ A;  5HZQ A;  4U8U N; 
#chains in the Genus database with same CATH homology
 1MEP A;  4EKV A;  4BX7 B;  2MF6 A;  1N43 A;  3WZQ A;  1VWP B;  4GGR A;  2C1S A;  2IZK A;  2RTH B;  4BCS A;  1LUQ A;  4JHQ A;  1SWD A;  2G5L A;  3SZH A;  2AVI A;  3T2W A;  3RY1 A;  4CPI A;  3EW1 A;  5IRA A;  5K68 A;  4JNJ A;  4DNE A;  5B5F A;  4GD9 A;  3T6L A;  1SWP A;  2OF8 A;  3FDC A;  3VHH A;  2IZB A;  2IZL B;  4CPE A;  1VWD B;  3T2X A;  2FHL A;  1KL4 A;  1NDJ A;  1SWL A;  1SWR A;  1SWT A;  4YVB A;  2A8G A;  1NC9 A;  1HQQ A;  3RDS A;  3RDO A;  4Z6J A;  4Z27 A;  1LCV A;  5F2B A;  1SWU A;  1VWE B;  1AVD A;  1SRF A;  3RDQ A;  1SWO A;  4OKA A;  1SRG A;  1MK5 A;  2IZH B;  2IZA A;  1IJ8 A;  2RTA A;  2RTD B;  2C1Q A;  1Y55 X;  1RXJ A;  1Y53 X;  2IZF B;  2WPU A;  1RXK A;  1N4J A;  4Y5D A;  4I60 A;  4Z28 A;  1STR B;  3VHI A;  5L3Y A;  2RTP B;  2FHN X;  4GGZ A;  1KL3 A;  1SWH A;  1VYO A;  2Y3E A;  1VWA B;  1I9H A;  1LCZ A;  1DF8 A;  1NQN A;  1SWQ A;  1Y52 X;  4GJV A;  4JO6 A;  1HY2 A;  1VWJ B;  1VWL B;  2OFA A;  1RSU B;  2CAM A;  3RDM A;  1N9Y A;  4GJS A;  1RST B;  2JGS A;  1NQM A;  3WZP A;  1VWC B;  1LDQ A;  3WZN A;  4Z2P A;  4Z2O A;  2OF9 A;  2C4I A;  2A5B A;  2RTR B;  3RDX A;  2F01 A;  3VHM A;  1LDO A;  1VWR B;  1SWA A;  1VWO B;  1VWF B;  1AVE A;  4GDA A;  3VGW A;  1WBI A;  1SWF A;  4CPH A;  1VWB B;  3MM0 A;  1VWK B;  3PK2 A;  1SWG A;  2RTL A;  2RTF B;  1SLD B;  1VWG B;  2RTB B;  4BX5 A;  4BX6 A;  2RTK A;  1VWM B;  2Y32 A;  1HXZ A;  1N9M A;  2RTN B;  5CHK A;  2IZC B;  2RTO B;  2QCB A;  2RTQ B;  3T6F A;  2RTE B;  1HXL A;  3RE6 A;  3SZJ A;  3WZO A;  1VWI B;  2RTI B;  4Z2V A;  2A5C A;  3WYQ A;  3MG5 A;  1SLF B;  2IZJ A;  3RDU A;  3X00 A;  4BBO A;  4CPH B;  2ZSC A;  1VWN B;  4IRW A;  1SWB A;  4BX5 B;  2IZG B;  3SZI A;  4U46 A;  2OFB A;  4CPF A;  5CSE A;  1SWE A;  1STP A;  1RXH A;  1MOY A;  2Y3F A;  2RTC B;  2RTJ A;  2UYW A;  3EW2 A;  5JD2 A;  1SLG B;  1PTS A;  1VWH B;  5IRW A;  2IZD B;  1VWQ B;  3WYP A;  1SWC A;  1SLE B;  1KFF A;  1LEL A;  4Y59 A;  4BJ8 A;  5K67 A;  4BX7 A;  1RAV A;  1NBX A;  1SRH A;  1SRE A;  1N7Y A;  1SWJ A;  1SWK A;  4GGT A;  5B5G A;  5IRU A;  1LCW A;  2GH7 A;  4BX6 B;  3RY2 A;  1SWN A;  3RE5 A;  1STS B;  2IZE B;  1SWS A;  2BC3 A;  2IZI A;  1MM9 A;  1SRJ A;  1KL5 A;  2RTM A;  1SRI A;  2RTG B;  2UZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...