4GDAA

Circular permuted streptavidin a50/n49
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
124
Chain Sequence
b'AESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural consequences of cutting a binding loop: two circularly permuted variants of streptavidin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 28
structure length 124
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4gdaA00
2IZHB 1STPA 3RE6A 2RTIB 3RY1A 3RDXA 1SWKA 1N4JA 3WZPA 2GH7A 1SWOA 1Y55X 2A5BA 2OFBA 4U46A 2IZAA 4BX6A 1LDOA 4GDAA 1VWHB 2Y3FA 1Y52X 3WYQA 1SWCA 1N7YA 2QCBA 1DF8A 5B5FA 5F2BA 4BX5B 2IZLB 1RXHA 1LDQA 1NBXA 1SREA 1VWNB 1LCZA 1SWHA 5IRUA 4GGZA 2FHNX 1SWGA 4CPEA 1AVDA 1VWGB 5K68A 1VWLB 1WBIA 1VWMB 3T2XA 1HQQA 1SWEA 1LELA 2MF6A 3RDUA 4GJVA 3SZHA 4EKVA 1NDJA 3EW1A 1LCWA 1SWDA 2RTHB 3T2WA 4BX5A 3RDMA 4YVBA 3T6FA 2RTJA 2UZ2A 2RTOB 1VYOA 2G5LA 1KL3A 1SWRA 2RTLA 3FDCA 2RTFB 1VWPB 1MK5A 1MOYA 1SRJA 3SZJA 1KL4A 2BC3A 4Z6JA 2C4IA 1RXJA 4Y5DA 2OF8A 2RTNB 2C1QA 1VWIB 5B5GA 2RTDB 4Z28A 3VHIA 2OFAA 1SWAA 3RDSA 3WZOA 4BJ8A 4Z2OA 2IZGB 5CSEA 4JHQA 1SLDB 1VWOB 2RTBB 1HXLA 3T6LA 4CPFA 2IZKA 1SRGA 3SZIA 3X00A 5L3YA 1HXZA 5IRWA 3WYPA 4GGRA 1RSTB 2Y32A 4GJSA 1N9YA 3MG5A 1NC9A 1VWBB 2C1SA 2IZIA 2IZJA 5K67A 4I60A 1SWQA 1N9MA 1VWDB 4Y59A 3WZQA 1SWJA 2AVIA 3MM0A 4BX7A 1I9HA 1SWTA 1VWJB 3EW2A 4IRWA 2RTEB 2RTAA 1LCVA 2A8GA 2IZEB 4JNJA 4CPHB 1SWSA 2A5CA 1KFFA 1SLEB 1SWPA 1HY2A 4GD9A 2RTKA 2UYWA 2RTGB 2IZCB 2RTQB 3PK2A 5CHKA 3RE5A 4DNEA 2RTCB 1N43A 1VWAB 4GGTA 4BCSA 4CPIA 1RXKA 4JO6A 1SLGB 2WPUA 2RTRB 2ZSCA 4BX7B 2IZBA 1NQNA 2CAMA 3VHHA 3WZNA 1MM9A 2OF9A 1PTSA 1VWFB 1KL5A 4CPHA 1STSB 3RY2A 2FHLA 3VHMA 1AVEA 1SWNA 1VWKB 4BBOA 4OKAA 3RDOA 2JGSA 1LUQA 1SWUA 5IRAA 1RSUB 1SWBA 2IZFB 1SWLA 1VWQB 4Z27A 1VWRB 1SRIA 2IZDB 1RAVA 1VWEB 1VWCB 1Y53X 2RTMA 2RTPB 1NQMA 3RDQA 1SLFB 1SWFA 1SRFA 2F01A 2Y3EA 5JD2A 1SRHA 4BX6B 4Z2VA 1STRB 1MEPA 3VGWA 4Z2PA 1IJ8A
chains in the Genus database with same CATH superfamily
5HWZA 2IZHB 2NP1A 4HPDA 4LQZA 3CQRA 1P6PA 4LZVA 4UU2A 3APWA 3RY1A 1SWKA 2R73A 1MX7A 4YH0A 2ASNX 3O22A 5HA1A 2LBAA 4BVMA 5DPQA 5HZ5A 1KT7A 1TVQA 3ZW1A 3HTYA 4U46A 5D47A 4A8ZA 1EALA 1G5WA 5LJGA 2WUTA 4GDAA 4O4XA 3ZUIA 2CBSA 1W5RA 3PDFA 1Y52X 4TNNA 2OY1O 5L8OA 2X46A 2OVDA 3C77X 2HMBA 2X8FA 1W6FA 1PMPA 5F2BA 2CM4A 3FR5A 1RXHA 1SREA 4NV7A 1CBSA 4MVEA 1A2DA 2FHNX 4QGWA 1CBIA 3FEKA 4YGHA 4CK4A 3B2LA 3QKGA 2W2FA 3KFGA 1SWEA 2MF6A 1SXUA 3RDUA 4GJVA 4EKVA 3PP6A 1LIBA 3EW1A 1ZNKA 2RTHB 2AF5A 4B55A 3T6FA 3APVA 2LKKA 3I17A 3DSZA 3HPEA 2RTLA 1E5PA 4ORRA 1BSYA 5H9NA 4GH7A 1YWAA 1CBQA 1KL4A 5D48A 4YKMA 2C4IA 2GTLO 1BRQA 5IXGA 2C1QA 1X8NA 2RTDB 3VHIA 5BVSA 3RDSA 1U0XA 5HZ8A 2WR6A 1IFBA 2IZGB 2N93A 5F58A 2K62A 3OD9A 4JGLA 1HXLA 4C5PA 4MIRA 4XMHA 1EI5A 2IZKA 2QM9A 2WQAE 4GRJA 1HXZA 3X00A 5L3YA 2ACOA 1OBQA 4NW4A 2GTLN 3NQKA 1JJXA 3NR3A 4YBPA 4I6SA 5F7GA 2MO5A 1LPJA 2WWPA 1RSTB 2X32A 3F8AA 4NNTA 4ZCBA 3L4RA 1KXOA 3MG5A 4M7MA 3SLOA 2YG2A 1OBUA 4TJZA 2IZIA 2X45A 2CBRA 5K67A 2HYSA 3NP1A 4YCHA 2Z4IA 3ELXA 1E02A 3HWGA 4XMDA 1ERXA 2AVIA 5HBSA 4ZHCA 3JS1A 1NP1A 1I78A 3EW2A 3WJBA 2RTEB 4QRLA 1SY2A 1YIVA 1X8PA 3IA8A 1QG5A 2A8GA 4GNWA 1OSPO 1MUPA 2BLGA 4TKHA 4QYNA 1SWSA 1GT4A 1EXSA 3HOEA 2X56A 1HY2A 3CQNA 4GZVA 4EQAC 2RTKA 3D4RA 3FENA 3EYCA 4NV8A 2RTGB 2RTQB 2GTFX 4DNEA 3C76X 2I5VO 1RXKA 4JO6A 2WPUA 3S60A 3WOVA 2RTRB 4L1NA 1RLBE 2NNEA 4O9SA 1MX8A 3ZI8A 4BX7B 3CKGA 2CAMA 4GE1A 3MBTA 1PTSA 1KL5A 4LZUA 4MISA 1STSB 1KZWA 2FHLA 3U9PC 1N0SA 4YFQA 1CBRA 1DZMA 1UZ2X 1E2TA 2OVAA 4ORSA 5H9AA 4AZPA 1LUQA 4FGIB 3NPOA 5IRAA 1KT5A 4WBKA 3P02A 4Z27A 4YMYA 2JOZA 1VWRB 2Q9SA 3HOLA 3NBXX 4I95A 1RAVA 1NP4A 4RUUA 1ACDA 1KGLA 2WSJA 5IO5A 3OE3A 4CSBA 1OEKA 1GX8A 1KT3A 1NQMA 2RTPB 3FA7A 4IAXA 1X71A 3JSQA 1SWFA 1HBQA 4QYPA 2KW1A 5B27A 3RDQA 3TGBA 3BS2A 4WFVA 1SRHA 4U3QA 1MEPA 2QO6A 3BU9A 3Q34A 3SOTA 1GT1A 4U8UO 1IJ8A 1T68X 2M4LA 3PQUA 3KVNA 4BOEA 3RE6A 2RTIB 4CV7A 3BSZE 5HZ9A 4QZTA 2P8GA 3RDXA 4ON1A 5HTEA 1A3YA 1PM1X 2GH7A 2IZAA 3AKNA 1ZRYA 1QQSA 2RD7C 3SAOA 1DV9A 4U8UN 1R0UA 4IB6A 2FWVA 3WYQA 1DC9A 1SWCA 1N7YA 4Y0RA 1K3BA 3D95A 5FQ7E 1A57A 1X89A 4YFPA 1UREA 3BLGA 1SWGA 2A0AA 3ZZVA 4CDCA 3UEVA 3FLLA 4ZGFA 1BWYA 1VPRA 1VWMB 5D45A 4Y0PA 3T2XA 3VG6A 2GTLM 5LJKA 4D6BA 1Z24A 3SZHA 1GGLA 2ACPX 4KIIA 2G79A 2MWHA 1LCWA 2G7BA 1ICMA 2OFRX 1QY1A 1ZNGA 2I5ZO 4NYQA 2AT0X 2R74A 2G5LA 2E4JA 4MVKA 5LKEA 3AEHA 1CRBA 1MK5A 2LA7A 3I0AA 1QABE 2BC3A 2VFCA 3E3CA 4INNA 5EEEA 2OF8A 3FYFA 1O1VA 1HN2A 2RTNB 4OS3A 5B5GA 4Z2OA 3VG3A 2YMSA 2G8CO 4JHQA 4I9SA 1SLDB 2RTBB 4ZHFA 2FLJA 4CPFA 1JJJA 3SZIA 2ANSA 3H3IA 5EPQA 2Q4NA 1IIUA 1EW3A 4FBOA 5IRWA 2X4MA 1E00A 3KFIA 4GGRA 4CDEA 1KZXA 2L5PA 5B11O 2VFBA 2HZRA 4IB8A 5H9KA 5IO7A 3CMPA 3LHNA 2DJFA 1U17A 1SY0A 5LJBA 1Y9TA 4OMWA 4TLJA 2JMBA 4Y0SA 1VWDB 1JMXA 4Y59A 4ARHA 3MM0A 5F1EA 2DJGA 4GUZA 4IRWA 4TKBA 1OPBA 2RTAA 2MHDA 4CPHB 4QGVA 1SLEB 3TZSA 4EFGA 3ZW2A 3NADA 1ZNEA 2DM5A 2FS7A 3B2KA 2UYWA 4L3RA 2RA6A 2QO5A 3PK2A 2HKDA 3U03A 2RTCB 1VWAB 1SA8A 4BCSA 3P6CA 3AUMO 3EC5A 4M6SA 1NQNA 3IFBA 3WZNA 2X8TA 3Q6LA 3F6ZB 3P6DA 4ZHGA 2F73A 1BSQA 1MVGA 4CPHA 3VHMA 4OEMA 1EPBA 1ML7A 2Q2PA 3O19A 1VWKB 1IKEA 4ZFXA 4BBOA 4XMEA 1BLRA 3OBLA 3D97A 1ALBA 2MJIA 1SY1A 1XKIA 2JGSA 2R56A 3RDOA 1SWUA 1JIWI 5HZQA 1Y0GA 3BY0A 3KFFA 1SWBA 2EU7X 2IZFB 1LF7A 1QFVA 1SWLA 1VWQB 2KT4B 3F9DA 3UEUA 3FA9A 3PECA 4U8UM 4UU3A 1VWCB 3PH6A 3AKMA 3KQ0A 5BYPA 3HWEA 4COTA 1ADLA 3PPTA 4GK9A 5H9LA 4IB7A 1BBPA 4HPCA 1YWDA 1O8VA 4RUNA 5FAZA 5FFHA 4Y0QA 4EEJA 3VGWA 4ORWA 1XCAA 1ZNHA 2PI3O 3P24A 1STPA 1B8EA 1OPAA 1AB0A 1JYDA 3HWDA 3FR2A 5FQ6E 3S5VA 1PBYA 1DZKA 4ZR2A 4PJ2A 3WZPA 3LTWA 1GT5A 2OFBA 3APXA 3CWKA 4XMGA 3TGAA 2A2UA 3BDRA 4WFUA 3DTQA 4YKOA 4ZHHA 3WXQA 1VWHB 3V8UA 5HAEA 3ZW0B 2CZTA 1X8UA 1KT6A 2RN4A 1S44A 1DF8A 5B5FA 2A3FX 4BX5B 5L8NA 4EDEA 1VWNB 1KT4A 3WJEA 1LCZA 1X8OA 1SWHA 3CKFA 1QY2A 1GXAA 3P6EA 4FBVA 4GGZA 5IRUA 4FBRA 1EQDA 1AQBA 1EUOA 4CPEA 1AVDA 1VWGB 5K68A 1VWLB 3EBKA 1WBIA 4IABA 1LKEA 4O3ZA 1H91A 4QQ1A 4Z2PA 5CE4A 4A60A 1EIIA 1OEEA 2HLVA 3ZW0A 4KC7A 4HPAA 1LIEA 1BEBA 1B0OA 1NDJA 4PSQA 4O3WA 3FR4A 3TGCA 2CM9A 2FTBA 4IB9A 3T2WA 3WJGA 4BX5A 2GJ5A 3FIDA 1RBPA 2RTJA 4YVBA 2UZ2A 1LICA 1VYOA 1SWRA 4NYRA 3FDCA 2OFMX 2RTFB 1SRJA 3B2HA 4AYHA 4ZHDA 3SZJA 5LJDA 3NX2A 4YGZA 1TXLA 5AJCA 2K23A 2ZAGA 3NX1A 4Y5DA 4Z6JA 1JQPA 1T8VA 3FA8A 1VWIB 4AZOA 3D96A 1OEJA 4Z28A 1UYNX 4AZNA 1DF3A 2KD2A 4BJ8A 1O1UA 3WZOA 4A1YA 3APUA 1A18A 4I3BA 3VG2A 1VWOB 3BX7A 3ZUOA 4ALOA 2BT9A 4TKJA 1AELA 2HZQA 2FKGA 1I06A 2X8SA 3EBWA 2AH7X 3HK1A 5LJHA 2FS6A 5F6BA 2ZAIA 1WUBA 3STMX 3U0DA 4BQUA 3WYPA 1U18A 5C0NA 2BS6A 2Y32A 3CR6A 4KC8A 2Z4HA 1QWDA 4GJSA 4I3CA 4I3DA 2X34A 2L67A 5EDCA 4ALBA 3MVFA 1VWBB 4DQ3A 2POAA 5LJEA 4I60A 5HA0A 4AZQA 1N9MA 4NNSA 3VU1A 1SWJA 3BU1A 1SWTA 4R0BA 1VWJB 4GDZA 1D3SA 3STNA 1GKAA 1JJUA 4BGFA 1LCVA 3RZYA 1LIDA 4JNJA 1KQXA 2OVEA 4AZRA 4O4OA 2A5CA 1GT3A 1SWPA 2JN3A 3CBSA 3WVMA 4N7DA 4GD9A 1YWBA 5CHKA 2WEXA 3BX8A 1SXWA 3FW4A 5KICA 4O3YA 5EDBA 1FEMA 4CPIA 2FR3A 5B2AO 2ZSCA 2IZBA 3T1DA 5L8IA 4K19A 1VWFB 2MM3A 1W4TA 2KTSA 4GU8A 4LKTA 1T0VA 1PEEA 2X55A 2OYBO 3RWXA 1FTPA 1BJ7A 1ERBA 1TW4A 4U9CA 2RQ0A 3ZQ3A 1FJ1E 4MVIA 4YGGA 2OL7A 1RSUB 3KZAA 1TOUA 4FQBB 3STKA 3FEPA 1VWEB 1ZNDA 2OZQA 1HMSA 1Y53X 3B2JA 4CDDA 4NP1A 1EIOA 4KT5A 4QAEA 3VPJE 4OS8A 5HTDA 1SRFA 2F01A 2Y3EA 3FELA 4NLJA 4BX6B 4Z2VA 2IFBA 3P6GA 3RSWA 2BS5A 1SMPI 2JU8A 2NNDA 3EM0A 2L9CA 3VE2A 1GX9A 3FIQA 2A2GA 3ZWEA 1YWCA 3JQOA 1G85A 2LFOA 4O4UA 1N4JA 2FR2A 2QOMA 2QMIA 1SWOA 1FENA 1Y55X 2A5BA 2OVSA 3B2IA 3FMZA 3SLTA 1JYJA 1X8QA 4BX6A 4I9RA 3UEWA 1LDOA 2AT5X 5LJCA 1CJ5A 4O4SA 3PQSA 2Y3FA 2XSTA 3S5XA 5LKFA 3TF6A 2QCBA 4IBAA 4MEEA 5D8JA 1IKJA 2CZUA 2IZLB 4ZJ0A 1LDQA 1NBXA 3UAQA 5FQ8E 1QY0A 5EEDA 2OY8A 1D2UA 2PY1A 3SLJA 1S7DA 2KTDA 4HFOA 2W2AA 5AQ6A 5EZ2A 1GX3A 4AZMA 2AL0X 1HQQA 1LELA 3VE1A 2LB6A 2FRSA 4OELA 1SWDA 1ICNA 3WJCA 4NLIA 3VG4A 3RDMA 4OS0A 2RTOB 2RCQA 1DZJA 1KL3A 5CYBA 1HMRA 4ORUA 1VWPB 2O62A 3C78X 1MOYA 2Q2MA 1IW2A 5AJBA 4WHIA 1RXJA 3D9WA 1NGLA 4O3XB 1S2PA 3S26A 1IFCA 1L6MA 4GNYA 2OFAA 1SWAA 3GE2A 1YP7A 4IMOA 2HNXA 5CSEA 1BM5A 2XKLA 2W2BA 3MX7A 2BSZA 5KHPA 2AKQA 3T6LA 5JR8A 3WJDA 1SRGA 3WJFA 4HWMA 5IO6A 1OBPA 3N91A 5DG4A 4IAWA 1VYFA 5B3MO 3RBYA 2Q39A 1I4UA 4ES7A 3EMMA 4ZH6A 2AT8X 4GKCA 5AEOA 1G74A 5HCEC 4YBUA 1N9YA 1FELA 4ORXA 4QNIA 2L68A 2OL6O 3CBCA 1LNMA 1NC9A 2JU7A 3K3LA 4QGXA 1HMTA 2QO4A 2JW1A 4YDAA 2C1SA 1VYGA 1E06A 2IZJA 5H8TA 1JZUA 1SWQA 3ELZA 3GAQA 3WZQA 3HWFA 4DCBA 2AT3X 4BX7A 1G7NA 1I9HA 2ALLX 2WEWA 3FW5A 3OJYC 4HPBA 4IMNA 1B56A 5HZ6A 4XMFA 4ORYA 2FKJA 3P6FA 4DQ4A 2IZEB 2QOSC 1FDQA 1LIFA 3PEDA 3G7XA 1KFFA 2OL8O 1DZPA 4D6AA 1YUPA 2JU3A 2LBVA 2IZCB 1QFTA 2AT6X 1I04A 1LFOA 1JMZA 2NNQA 3RE5A 1K24A 1N43A 1SXYA 1HQPA 4GGTA 1KOIA 4A1HA 4N7CA 1SLGB 5D4AA 5HCCC 2FGSA 2VDFA 2GC9A 1EPAA 4EXZA 5B29A 1BRPA 5FENA 3VHHA 1MM9A 1YP6A 2OF9A 1DFVA 1B4MA 1BSOA 1GKAB 2F09A 5BVQA 4ZGUA 4KCAA 1TOWA 1GM6A 1SY3A 2RCTA 3LV4A 1AVEA 3RKGA 1Y9LA 3RY2A 3UEXA 3VG7A 3WBGA 1KQWA 1SWNA 3P6HA 1UYOX 4ID2A 4O49A 3VG5A 1JBHA 3BRNA 4OKAA 3KFHA 5B10O 2A13A 4YCEA 2G78A 1HBPA 3NQ3A 1SXXA 4QZUA 4XMCA 4CDFA 4YFRA 4GETA 5KIDA 3FA6A 1SRIA 5BVTA 4ML7B 2AMMX 1MDCA 1ZNLA 2IZDB 4MVLA 5F6ZA 2OY5O 5K06A 3PH5A 1AVGI 4KH8A 2FT9A 4LKPA 1FE3A 2RTMA 3NQ9A 1PBOA 3QQ2A 1SLFB 4OMXA 2OY7A 5JD2A 3ZW1B 4TQ2A 1I05A 1JV4A 3O2YA 4ODDA 1STRB 5HCDC 4ZH9A 4AW8A 2WQ9A 4YDBA 2BHVA
chains in the Genus database with same CATH topology
2IZHB 1STPA 3RE6A 2RTIB 3RY1A 3RDXA 1SWKA 1N4JA 3WZPA 2GH7A 1SWOA 1Y55X 2A5BA 2OFBA 4U46A 2IZAA 4BX6A 1LDOA 4GDAA 1VWHB 2Y3FA 1Y52X 3WYQA 1SWCA 1N7YA 2QCBA 1DF8A 5B5FA 5F2BA 4BX5B 2IZLB 1RXHA 1LDQA 1NBXA 1SREA 1VWNB 1LCZA 1SWHA 5IRUA 4GGZA 2FHNX 1SWGA 4CPEA 1AVDA 1VWGB 5K68A 1VWLB 1WBIA 1VWMB 3T2XA 1HQQA 1SWEA 1LELA 2MF6A 3RDUA 4GJVA 3SZHA 4EKVA 1NDJA 3EW1A 1LCWA 1SWDA 2RTHB 3T2WA 4BX5A 3RDMA 4YVBA 3T6FA 2RTJA 2UZ2A 2RTOB 1VYOA 2G5LA 1KL3A 1SWRA 2RTLA 3FDCA 2RTFB 1VWPB 1MK5A 1MOYA 1SRJA 3SZJA 1KL4A 2BC3A 4Z6JA 2C4IA 1RXJA 4Y5DA 2OF8A 2RTNB 2C1QA 1VWIB 5B5GA 2RTDB 4Z28A 3VHIA 2OFAA 1SWAA 3RDSA 3WZOA 4BJ8A 4Z2OA 2IZGB 5CSEA 4JHQA 1SLDB 1VWOB 2RTBB 1HXLA 3T6LA 4CPFA 2IZKA 1SRGA 3SZIA 3X00A 5L3YA 1HXZA 5IRWA 3WYPA 4GGRA 1RSTB 2Y32A 4GJSA 1N9YA 3MG5A 1NC9A 1VWBB 2C1SA 2IZIA 2IZJA 5K67A 4I60A 1SWQA 1N9MA 1VWDB 4Y59A 3WZQA 1SWJA 2AVIA 3MM0A 4BX7A 1I9HA 1SWTA 1VWJB 3EW2A 4IRWA 2RTEB 2RTAA 1LCVA 2A8GA 2IZEB 4JNJA 4CPHB 1SWSA 2A5CA 1KFFA 1SLEB 1SWPA 1HY2A 4GD9A 2RTKA 2UYWA 2RTGB 2IZCB 2RTQB 3PK2A 5CHKA 3RE5A 4DNEA 2RTCB 1N43A 1VWAB 4GGTA 4BCSA 4CPIA 1RXKA 4JO6A 1SLGB 2WPUA 2RTRB 2ZSCA 4BX7B 2IZBA 1NQNA 2CAMA 3VHHA 3WZNA 1MM9A 2OF9A 1PTSA 1VWFB 1KL5A 4CPHA 1STSB 3RY2A 2FHLA 3VHMA 1AVEA 1SWNA 1VWKB 4BBOA 4OKAA 3RDOA 2JGSA 1LUQA 1SWUA 5IRAA 1RSUB 1SWBA 2IZFB 1SWLA 1VWQB 4Z27A 1VWRB 1SRIA 2IZDB 1RAVA 1VWEB 1VWCB 1Y53X 2RTMA 2RTPB 1NQMA 3RDQA 1SLFB 1SWFA 1SRFA 2F01A 2Y3EA 5JD2A 1SRHA 4BX6B 4Z2VA 1STRB 1MEPA 3VGWA 4Z2PA 1IJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZH B;  1STP A;  3RE6 A;  2RTI B;  3RY1 A;  3RDX A;  1SWK A;  1N4J A;  3WZP A;  2GH7 A;  1SWO A;  1Y55 X;  2A5B A;  2OFB A;  4U46 A;  2IZA A;  4BX6 A;  1LDO A;  4GDA A;  1VWH B;  2Y3F A;  1Y52 X;  3WYQ A;  1SWC A;  1N7Y A;  2QCB A;  1DF8 A;  5B5F A;  5F2B A;  4BX5 B;  2IZL B;  1RXH A;  1LDQ A;  1NBX A;  1SRE A;  1VWN B;  1LCZ A;  1SWH A;  5IRU A;  4GGZ A;  2FHN X;  1SWG A;  4CPE A;  1AVD A;  1VWG B;  5K68 A;  1VWL B;  1WBI A;  1VWM B;  3T2X A;  1HQQ A;  1SWE A;  1LEL A;  2MF6 A;  3RDU A;  4GJV A;  3SZH A;  4EKV A;  1NDJ A;  3EW1 A;  1LCW A;  1SWD A;  2RTH B;  3T2W A;  4BX5 A;  3RDM A;  4YVB A;  3T6F A;  2RTJ A;  2UZ2 A;  2RTO B;  1VYO A;  2G5L A;  1KL3 A;  1SWR A;  2RTL A;  3FDC A;  2RTF B;  1VWP B;  1MK5 A;  1MOY A;  1SRJ A;  3SZJ A;  1KL4 A;  2BC3 A;  4Z6J A;  2C4I A;  1RXJ A;  4Y5D A;  2OF8 A;  2RTN B;  2C1Q A;  1VWI B;  5B5G A;  2RTD B;  4Z28 A;  3VHI A;  2OFA A;  1SWA A;  3RDS A;  3WZO A;  4BJ8 A;  4Z2O A;  2IZG B;  5CSE A;  4JHQ A;  1SLD B;  1VWO B;  2RTB B;  1HXL A;  3T6L A;  4CPF A;  2IZK A;  1SRG A;  3SZI A;  3X00 A;  5L3Y A;  1HXZ A;  5IRW A;  3WYP A;  4GGR A;  1RST B;  2Y32 A;  4GJS A;  1N9Y A;  3MG5 A;  1NC9 A;  1VWB B;  2C1S A;  2IZI A;  2IZJ A;  5K67 A;  4I60 A;  1SWQ A;  1N9M A;  1VWD B;  4Y59 A;  3WZQ A;  1SWJ A;  2AVI A;  3MM0 A;  4BX7 A;  1I9H A;  1SWT A;  1VWJ B;  3EW2 A;  4IRW A;  2RTE B;  2RTA A;  1LCV A;  2A8G A;  2IZE B;  4JNJ A;  4CPH B;  1SWS A;  2A5C A;  1KFF A;  1SLE B;  1SWP A;  1HY2 A;  4GD9 A;  2RTK A;  2UYW A;  2RTG B;  2IZC B;  2RTQ B;  3PK2 A;  5CHK A;  3RE5 A;  4DNE A;  2RTC B;  1N43 A;  1VWA B;  4GGT A;  4BCS A;  4CPI A;  1RXK A;  4JO6 A;  1SLG B;  2WPU A;  2RTR B;  2ZSC A;  4BX7 B;  2IZB A;  1NQN A;  2CAM A;  3VHH A;  3WZN A;  1MM9 A;  2OF9 A;  1PTS A;  1VWF B;  1KL5 A;  4CPH A;  1STS B;  3RY2 A;  2FHL A;  3VHM A;  1AVE A;  1SWN A;  1VWK B;  4BBO A;  4OKA A;  3RDO A;  2JGS A;  1LUQ A;  1SWU A;  5IRA A;  1RSU B;  1SWB A;  2IZF B;  1SWL A;  1VWQ B;  4Z27 A;  1VWR B;  1SRI A;  2IZD B;  1RAV A;  1VWE B;  1VWC B;  1Y53 X;  2RTM A;  2RTP B;  1NQM A;  3RDQ A;  1SLF B;  1SWF A;  1SRF A;  2F01 A;  2Y3E A;  5JD2 A;  1SRH A;  4BX6 B;  4Z2V A;  1STR B;  1MEP A;  3VGW A;  4Z2P A;  1IJ8 A; 
#chains in the Genus database with same CATH topology
 5HWZ A;  2IZH B;  2NP1 A;  4HPD A;  4LQZ A;  3CQR A;  1P6P A;  4LZV A;  4UU2 A;  3APW A;  3RY1 A;  1SWK A;  2R73 A;  1MX7 A;  4YH0 A;  2ASN X;  3O22 A;  5HA1 A;  2LBA A;  4BVM A;  5DPQ A;  5HZ5 A;  1KT7 A;  1TVQ A;  3ZW1 A;  3HTY A;  4U46 A;  5D47 A;  4A8Z A;  1EAL A;  1G5W A;  5LJG A;  2WUT A;  4GDA A;  4O4X A;  3ZUI A;  2CBS A;  1W5R A;  3PDF A;  1Y52 X;  4TNN A;  2OY1 O;  5L8O A;  2X46 A;  2OVD A;  3C77 X;  2HMB A;  2X8F A;  1W6F A;  1PMP A;  5F2B A;  2CM4 A;  3FR5 A;  1RXH A;  1SRE A;  4NV7 A;  1CBS A;  4MVE A;  1A2D A;  2FHN X;  4QGW A;  1CBI A;  3FEK A;  4YGH A;  4CK4 A;  3B2L A;  3QKG A;  2W2F A;  3KFG A;  1SWE A;  2MF6 A;  1SXU A;  3RDU A;  4GJV A;  4EKV A;  3PP6 A;  1LIB A;  3EW1 A;  1ZNK A;  2RTH B;  2AF5 A;  4B55 A;  3T6F A;  3APV A;  2LKK A;  3I17 A;  3DSZ A;  3HPE A;  2RTL A;  1E5P A;  4ORR A;  1BSY A;  5H9N A;  4GH7 A;  1YWA A;  1CBQ A;  1KL4 A;  5D48 A;  4YKM A;  2C4I A;  2GTL O;  1BRQ A;  5IXG A;  2C1Q A;  1X8N A;  2RTD B;  3VHI A;  5BVS A;  3RDS A;  1U0X A;  5HZ8 A;  2WR6 A;  1IFB A;  2IZG B;  2N93 A;  5F58 A;  2K62 A;  3OD9 A;  4JGL A;  1HXL A;  4C5P A;  4MIR A;  4XMH A;  1EI5 A;  2IZK A;  2QM9 A;  2WQA E;  4GRJ A;  1HXZ A;  3X00 A;  5L3Y A;  2ACO A;  1OBQ A;  4NW4 A;  2GTL N;  3NQK A;  1JJX A;  3NR3 A;  4YBP A;  4I6S A;  5F7G A;  2MO5 A;  1LPJ A;  2WWP A;  1RST B;  2X32 A;  3F8A A;  4NNT A;  4ZCB A;  3L4R A;  1KXO A;  3MG5 A;  4M7M A;  3SLO A;  2YG2 A;  1OBU A;  4TJZ A;  2IZI A;  2X45 A;  2CBR A;  5K67 A;  2HYS A;  3NP1 A;  4YCH A;  2Z4I A;  3ELX A;  1E02 A;  3HWG A;  4XMD A;  1ERX A;  2AVI A;  5HBS A;  4ZHC A;  3JS1 A;  1NP1 A;  1I78 A;  3EW2 A;  3WJB A;  2RTE B;  4QRL A;  1SY2 A;  1YIV A;  1X8P A;  3IA8 A;  1QG5 A;  2A8G A;  4GNW A;  1OSP O;  1MUP A;  2BLG A;  4TKH A;  4QYN A;  1SWS A;  1GT4 A;  1EXS A;  3HOE A;  2X56 A;  1HY2 A;  3CQN A;  4GZV A;  4EQA C;  2RTK A;  3D4R A;  3FEN A;  3EYC A;  4NV8 A;  2RTG B;  2RTQ B;  2GTF X;  4DNE A;  3C76 X;  2I5V O;  1RXK A;  4JO6 A;  2WPU A;  3S60 A;  3WOV A;  2RTR B;  4L1N A;  1RLB E;  2NNE A;  4O9S A;  1MX8 A;  3ZI8 A;  4BX7 B;  3CKG A;  2CAM A;  4GE1 A;  3MBT A;  1PTS A;  1KL5 A;  4LZU A;  4MIS A;  1STS B;  1KZW A;  2FHL A;  3U9P C;  1N0S A;  4YFQ A;  1CBR A;  1DZM A;  1UZ2 X;  1E2T A;  2OVA A;  4ORS A;  5H9A A;  4AZP A;  1LUQ A;  4FGI B;  3NPO A;  5IRA A;  1KT5 A;  4WBK A;  3P02 A;  4Z27 A;  4YMY A;  2JOZ A;  1VWR B;  2Q9S A;  3HOL A;  3NBX X;  4I95 A;  1RAV A;  1NP4 A;  4RUU A;  1ACD A;  1KGL A;  2WSJ A;  5IO5 A;  3OE3 A;  4CSB A;  1OEK A;  1GX8 A;  1KT3 A;  1NQM A;  2RTP B;  3FA7 A;  4IAX A;  1X71 A;  3JSQ A;  1SWF A;  1HBQ A;  4QYP A;  2KW1 A;  5B27 A;  3RDQ A;  3TGB A;  3BS2 A;  4WFV A;  1SRH A;  4U3Q A;  1MEP A;  2QO6 A;  3BU9 A;  3Q34 A;  3SOT A;  1GT1 A;  4U8U O;  1IJ8 A;  1T68 X;  2M4L A;  3PQU A;  3KVN A;  4BOE A;  3RE6 A;  2RTI B;  4CV7 A;  3BSZ E;  5HZ9 A;  4QZT A;  2P8G A;  3RDX A;  4ON1 A;  5HTE A;  1A3Y A;  1PM1 X;  2GH7 A;  2IZA A;  3AKN A;  1ZRY A;  1QQS A;  2RD7 C;  3SAO A;  1DV9 A;  4U8U N;  1R0U A;  4IB6 A;  2FWV A;  3WYQ A;  1DC9 A;  1SWC A;  1N7Y A;  4Y0R A;  1K3B A;  3D95 A;  5FQ7 E;  1A57 A;  1X89 A;  4YFP A;  1URE A;  3BLG A;  1SWG A;  2A0A A;  3ZZV A;  4CDC A;  3UEV A;  3FLL A;  4ZGF A;  1BWY A;  1VPR A;  1VWM B;  5D45 A;  4Y0P A;  3T2X A;  3VG6 A;  2GTL M;  5LJK A;  4D6B A;  1Z24 A;  3SZH A;  1GGL A;  2ACP X;  4KII A;  2G79 A;  2MWH A;  1LCW A;  2G7B A;  1ICM A;  2OFR X;  1QY1 A;  1ZNG A;  2I5Z O;  4NYQ A;  2AT0 X;  2R74 A;  2G5L A;  2E4J A;  4MVK A;  5LKE A;  3AEH A;  1CRB A;  1MK5 A;  2LA7 A;  3I0A A;  1QAB E;  2BC3 A;  2VFC A;  3E3C A;  4INN A;  5EEE A;  2OF8 A;  3FYF A;  1O1V A;  1HN2 A;  2RTN B;  4OS3 A;  5B5G A;  4Z2O A;  3VG3 A;  2YMS A;  2G8C O;  4JHQ A;  4I9S A;  1SLD B;  2RTB B;  4ZHF A;  2FLJ A;  4CPF A;  1JJJ A;  3SZI A;  2ANS A;  3H3I A;  5EPQ A;  2Q4N A;  1IIU A;  1EW3 A;  4FBO A;  5IRW A;  2X4M A;  1E00 A;  3KFI A;  4GGR A;  4CDE A;  1KZX A;  2L5P A;  5B11 O;  2VFB A;  2HZR A;  4IB8 A;  5H9K A;  5IO7 A;  3CMP A;  3LHN A;  2DJF A;  1U17 A;  1SY0 A;  5LJB A;  1Y9T A;  4OMW A;  4TLJ A;  2JMB A;  4Y0S A;  1VWD B;  1JMX A;  4Y59 A;  4ARH A;  3MM0 A;  5F1E A;  2DJG A;  4GUZ A;  4IRW A;  4TKB A;  1OPB A;  2RTA A;  2MHD A;  4CPH B;  4QGV A;  1SLE B;  3TZS A;  4EFG A;  3ZW2 A;  3NAD A;  1ZNE A;  2DM5 A;  2FS7 A;  3B2K A;  2UYW A;  4L3R A;  2RA6 A;  2QO5 A;  3PK2 A;  2HKD A;  3U03 A;  2RTC B;  1VWA B;  1SA8 A;  4BCS A;  3P6C A;  3AUM O;  3EC5 A;  4M6S A;  1NQN A;  3IFB A;  3WZN A;  2X8T A;  3Q6L A;  3F6Z B;  3P6D A;  4ZHG A;  2F73 A;  1BSQ A;  1MVG A;  4CPH A;  3VHM A;  4OEM A;  1EPB A;  1ML7 A;  2Q2P A;  3O19 A;  1VWK B;  1IKE A;  4ZFX A;  4BBO A;  4XME A;  1BLR A;  3OBL A;  3D97 A;  1ALB A;  2MJI A;  1SY1 A;  1XKI A;  2JGS A;  2R56 A;  3RDO A;  1SWU A;  1JIW I;  5HZQ A;  1Y0G A;  3BY0 A;  3KFF A;  1SWB A;  2EU7 X;  2IZF B;  1LF7 A;  1QFV A;  1SWL A;  1VWQ B;  2KT4 B;  3F9D A;  3UEU A;  3FA9 A;  3PEC A;  4U8U M;  4UU3 A;  1VWC B;  3PH6 A;  3AKM A;  3KQ0 A;  5BYP A;  3HWE A;  4COT A;  1ADL A;  3PPT A;  4GK9 A;  5H9L A;  4IB7 A;  1BBP A;  4HPC A;  1YWD A;  1O8V A;  4RUN A;  5FAZ A;  5FFH A;  4Y0Q A;  4EEJ A;  3VGW A;  4ORW A;  1XCA A;  1ZNH A;  2PI3 O;  3P24 A;  1STP A;  1B8E A;  1OPA A;  1AB0 A;  1JYD A;  3HWD A;  3FR2 A;  5FQ6 E;  3S5V A;  1PBY A;  1DZK A;  4ZR2 A;  4PJ2 A;  3WZP A;  3LTW A;  1GT5 A;  2OFB A;  3APX A;  3CWK A;  4XMG A;  3TGA A;  2A2U A;  3BDR A;  4WFU A;  3DTQ A;  4YKO A;  4ZHH A;  3WXQ A;  1VWH B;  3V8U A;  5HAE A;  3ZW0 B;  2CZT A;  1X8U A;  1KT6 A;  2RN4 A;  1S44 A;  1DF8 A;  5B5F A;  2A3F X;  4BX5 B;  5L8N A;  4EDE A;  1VWN B;  1KT4 A;  3WJE A;  1LCZ A;  1X8O A;  1SWH A;  3CKF A;  1QY2 A;  1GXA A;  3P6E A;  4FBV A;  4GGZ A;  5IRU A;  4FBR A;  1EQD A;  1AQB A;  1EUO A;  4CPE A;  1AVD A;  1VWG B;  5K68 A;  1VWL B;  3EBK A;  1WBI A;  4IAB A;  1LKE A;  4O3Z A;  1H91 A;  4QQ1 A;  4Z2P A;  5CE4 A;  4A60 A;  1EII A;  1OEE A;  2HLV A;  3ZW0 A;  4KC7 A;  4HPA A;  1LIE A;  1BEB A;  1B0O A;  1NDJ A;  4PSQ A;  4O3W A;  3FR4 A;  3TGC A;  2CM9 A;  2FTB A;  4IB9 A;  3T2W A;  3WJG A;  4BX5 A;  2GJ5 A;  3FID A;  1RBP A;  2RTJ A;  4YVB A;  2UZ2 A;  1LIC A;  1VYO A;  1SWR A;  4NYR A;  3FDC A;  2OFM X;  2RTF B;  1SRJ A;  3B2H A;  4AYH A;  4ZHD A;  3SZJ A;  5LJD A;  3NX2 A;  4YGZ A;  1TXL A;  5AJC A;  2K23 A;  2ZAG A;  3NX1 A;  4Y5D A;  4Z6J A;  1JQP A;  1T8V A;  3FA8 A;  1VWI B;  4AZO A;  3D96 A;  1OEJ A;  4Z28 A;  1UYN X;  4AZN A;  1DF3 A;  2KD2 A;  4BJ8 A;  1O1U A;  3WZO A;  4A1Y A;  3APU A;  1A18 A;  4I3B A;  3VG2 A;  1VWO B;  3BX7 A;  3ZUO A;  4ALO A;  2BT9 A;  4TKJ A;  1AEL A;  2HZQ A;  2FKG A;  1I06 A;  2X8S A;  3EBW A;  2AH7 X;  3HK1 A;  5LJH A;  2FS6 A;  5F6B A;  2ZAI A;  1WUB A;  3STM X;  3U0D A;  4BQU A;  3WYP A;  1U18 A;  5C0N A;  2BS6 A;  2Y32 A;  3CR6 A;  4KC8 A;  2Z4H A;  1QWD A;  4GJS A;  4I3C A;  4I3D A;  2X34 A;  2L67 A;  5EDC A;  4ALB A;  3MVF A;  1VWB B;  4DQ3 A;  2POA A;  5LJE A;  4I60 A;  5HA0 A;  4AZQ A;  1N9M A;  4NNS A;  3VU1 A;  1SWJ A;  3BU1 A;  1SWT A;  4R0B A;  1VWJ B;  4GDZ A;  1D3S A;  3STN A;  1GKA A;  1JJU A;  4BGF A;  1LCV A;  3RZY A;  1LID A;  4JNJ A;  1KQX A;  2OVE A;  4AZR A;  4O4O A;  2A5C A;  1GT3 A;  1SWP A;  2JN3 A;  3CBS A;  3WVM A;  4N7D A;  4GD9 A;  1YWB A;  5CHK A;  2WEX A;  3BX8 A;  1SXW A;  3FW4 A;  5KIC A;  4O3Y A;  5EDB A;  1FEM A;  4CPI A;  2FR3 A;  5B2A O;  2ZSC A;  2IZB A;  3T1D A;  5L8I A;  4K19 A;  1VWF B;  2MM3 A;  1W4T A;  2KTS A;  4GU8 A;  4LKT A;  1T0V A;  1PEE A;  2X55 A;  2OYB O;  3RWX A;  1FTP A;  1BJ7 A;  1ERB A;  1TW4 A;  4U9C A;  2RQ0 A;  3ZQ3 A;  1FJ1 E;  4MVI A;  4YGG A;  2OL7 A;  1RSU B;  3KZA A;  1TOU A;  4FQB B;  3STK A;  3FEP A;  1VWE B;  1ZND A;  2OZQ A;  1HMS A;  1Y53 X;  3B2J A;  4CDD A;  4NP1 A;  1EIO A;  4KT5 A;  4QAE A;  3VPJ E;  4OS8 A;  5HTD A;  1SRF A;  2F01 A;  2Y3E A;  3FEL A;  4NLJ A;  4BX6 B;  4Z2V A;  2IFB A;  3P6G A;  3RSW A;  2BS5 A;  1SMP I;  2JU8 A;  2NND A;  3EM0 A;  2L9C A;  3VE2 A;  1GX9 A;  3FIQ A;  2A2G A;  3ZWE A;  1YWC A;  3JQO A;  1G85 A;  2LFO A;  4O4U A;  1N4J A;  2FR2 A;  2QOM A;  2QMI A;  1SWO A;  1FEN A;  1Y55 X;  2A5B A;  2OVS A;  3B2I A;  3FMZ A;  3SLT A;  1JYJ A;  1X8Q A;  4BX6 A;  4I9R A;  3UEW A;  1LDO A;  2AT5 X;  5LJC A;  1CJ5 A;  4O4S A;  3PQS A;  2Y3F A;  2XST A;  3S5X A;  5LKF A;  3TF6 A;  2QCB A;  4IBA A;  4MEE A;  5D8J A;  1IKJ A;  2CZU A;  2IZL B;  4ZJ0 A;  1LDQ A;  1NBX A;  3UAQ A;  5FQ8 E;  1QY0 A;  5EED A;  2OY8 A;  1D2U A;  2PY1 A;  3SLJ A;  1S7D A;  2KTD A;  4HFO A;  2W2A A;  5AQ6 A;  5EZ2 A;  1GX3 A;  4AZM A;  2AL0 X;  1HQQ A;  1LEL A;  3VE1 A;  2LB6 A;  2FRS A;  4OEL A;  1SWD A;  1ICN A;  3WJC A;  4NLI A;  3VG4 A;  3RDM A;  4OS0 A;  2RTO B;  2RCQ A;  1DZJ A;  1KL3 A;  5CYB A;  1HMR A;  4ORU A;  1VWP B;  2O62 A;  3C78 X;  1MOY A;  2Q2M A;  1IW2 A;  5AJB A;  4WHI A;  1RXJ A;  3D9W A;  1NGL A;  4O3X B;  1S2P A;  3S26 A;  1IFC A;  1L6M A;  4GNY A;  2OFA A;  1SWA A;  3GE2 A;  1YP7 A;  4IMO A;  2HNX A;  5CSE A;  1BM5 A;  2XKL A;  2W2B A;  3MX7 A;  2BSZ A;  5KHP A;  2AKQ A;  3T6L A;  5JR8 A;  3WJD A;  1SRG A;  3WJF A;  4HWM A;  5IO6 A;  1OBP A;  3N91 A;  5DG4 A;  4IAW A;  1VYF A;  5B3M O;  3RBY A;  2Q39 A;  1I4U A;  4ES7 A;  3EMM A;  4ZH6 A;  2AT8 X;  4GKC A;  5AEO A;  1G74 A;  5HCE C;  4YBU A;  1N9Y A;  1FEL A;  4ORX A;  4QNI A;  2L68 A;  2OL6 O;  3CBC A;  1LNM A;  1NC9 A;  2JU7 A;  3K3L A;  4QGX A;  1HMT A;  2QO4 A;  2JW1 A;  4YDA A;  2C1S A;  1VYG A;  1E06 A;  2IZJ A;  5H8T A;  1JZU A;  1SWQ A;  3ELZ A;  3GAQ A;  3WZQ A;  3HWF A;  4DCB A;  2AT3 X;  4BX7 A;  1G7N A;  1I9H A;  2ALL X;  2WEW A;  3FW5 A;  3OJY C;  4HPB A;  4IMN A;  1B56 A;  5HZ6 A;  4XMF A;  4ORY A;  2FKJ A;  3P6F A;  4DQ4 A;  2IZE B;  2QOS C;  1FDQ A;  1LIF A;  3PED A;  3G7X A;  1KFF A;  2OL8 O;  1DZP A;  4D6A A;  1YUP A;  2JU3 A;  2LBV A;  2IZC B;  1QFT A;  2AT6 X;  1I04 A;  1LFO A;  1JMZ A;  2NNQ A;  3RE5 A;  1K24 A;  1N43 A;  1SXY A;  1HQP A;  4GGT A;  1KOI A;  4A1H A;  4N7C A;  1SLG B;  5D4A A;  5HCC C;  2FGS A;  2VDF A;  2GC9 A;  1EPA A;  4EXZ A;  5B29 A;  1BRP A;  5FEN A;  3VHH A;  1MM9 A;  1YP6 A;  2OF9 A;  1DFV A;  1B4M A;  1BSO A;  1GKA B;  2F09 A;  5BVQ A;  4ZGU A;  4KCA A;  1TOW A;  1GM6 A;  1SY3 A;  2RCT A;  3LV4 A;  1AVE A;  3RKG A;  1Y9L A;  3RY2 A;  3UEX A;  3VG7 A;  3WBG A;  1KQW A;  1SWN A;  3P6H A;  1UYO X;  4ID2 A;  4O49 A;  3VG5 A;  1JBH A;  3BRN A;  4OKA A;  3KFH A;  5B10 O;  2A13 A;  4YCE A;  2G78 A;  1HBP A;  3NQ3 A;  1SXX A;  4QZU A;  4XMC A;  4CDF A;  4YFR A;  4GET A;  5KID A;  3FA6 A;  1SRI A;  5BVT A;  4ML7 B;  2AMM X;  1MDC A;  1ZNL A;  2IZD B;  4MVL A;  5F6Z A;  2OY5 O;  5K06 A;  3PH5 A;  1AVG I;  4KH8 A;  2FT9 A;  4LKP A;  1FE3 A;  2RTM A;  3NQ9 A;  1PBO A;  3QQ2 A;  1SLF B;  4OMX A;  2OY7 A;  5JD2 A;  3ZW1 B;  4TQ2 A;  1I05 A;  1JV4 A;  3O2Y A;  4ODD A;  1STR B;  5HCD C;  4ZH9 A;  4AW8 A;  2WQ9 A;  4YDB A;  2BHV A; 
#chains in the Genus database with same CATH homology
 2IZH B;  1STP A;  3RE6 A;  2RTI B;  3RY1 A;  3RDX A;  1SWK A;  1N4J A;  3WZP A;  2GH7 A;  1SWO A;  1Y55 X;  2A5B A;  2OFB A;  4U46 A;  2IZA A;  4BX6 A;  1LDO A;  4GDA A;  1VWH B;  2Y3F A;  1Y52 X;  3WYQ A;  1SWC A;  1N7Y A;  2QCB A;  1DF8 A;  5B5F A;  5F2B A;  4BX5 B;  2IZL B;  1RXH A;  1LDQ A;  1NBX A;  1SRE A;  1VWN B;  1LCZ A;  1SWH A;  5IRU A;  4GGZ A;  2FHN X;  1SWG A;  4CPE A;  1AVD A;  1VWG B;  5K68 A;  1VWL B;  1WBI A;  1VWM B;  3T2X A;  1HQQ A;  1SWE A;  1LEL A;  2MF6 A;  3RDU A;  4GJV A;  3SZH A;  4EKV A;  1NDJ A;  3EW1 A;  1LCW A;  1SWD A;  2RTH B;  3T2W A;  4BX5 A;  3RDM A;  4YVB A;  3T6F A;  2RTJ A;  2UZ2 A;  2RTO B;  1VYO A;  2G5L A;  1KL3 A;  1SWR A;  2RTL A;  3FDC A;  2RTF B;  1VWP B;  1MK5 A;  1MOY A;  1SRJ A;  3SZJ A;  1KL4 A;  2BC3 A;  4Z6J A;  2C4I A;  1RXJ A;  4Y5D A;  2OF8 A;  2RTN B;  2C1Q A;  1VWI B;  5B5G A;  2RTD B;  4Z28 A;  3VHI A;  2OFA A;  1SWA A;  3RDS A;  3WZO A;  4BJ8 A;  4Z2O A;  2IZG B;  5CSE A;  4JHQ A;  1SLD B;  1VWO B;  2RTB B;  1HXL A;  3T6L A;  4CPF A;  2IZK A;  1SRG A;  3SZI A;  3X00 A;  5L3Y A;  1HXZ A;  5IRW A;  3WYP A;  4GGR A;  1RST B;  2Y32 A;  4GJS A;  1N9Y A;  3MG5 A;  1NC9 A;  1VWB B;  2C1S A;  2IZI A;  2IZJ A;  5K67 A;  4I60 A;  1SWQ A;  1N9M A;  1VWD B;  4Y59 A;  3WZQ A;  1SWJ A;  2AVI A;  3MM0 A;  4BX7 A;  1I9H A;  1SWT A;  1VWJ B;  3EW2 A;  4IRW A;  2RTE B;  2RTA A;  1LCV A;  2A8G A;  2IZE B;  4JNJ A;  4CPH B;  1SWS A;  2A5C A;  1KFF A;  1SLE B;  1SWP A;  1HY2 A;  4GD9 A;  2RTK A;  2UYW A;  2RTG B;  2IZC B;  2RTQ B;  3PK2 A;  5CHK A;  3RE5 A;  4DNE A;  2RTC B;  1N43 A;  1VWA B;  4GGT A;  4BCS A;  4CPI A;  1RXK A;  4JO6 A;  1SLG B;  2WPU A;  2RTR B;  2ZSC A;  4BX7 B;  2IZB A;  1NQN A;  2CAM A;  3VHH A;  3WZN A;  1MM9 A;  2OF9 A;  1PTS A;  1VWF B;  1KL5 A;  4CPH A;  1STS B;  3RY2 A;  2FHL A;  3VHM A;  1AVE A;  1SWN A;  1VWK B;  4BBO A;  4OKA A;  3RDO A;  2JGS A;  1LUQ A;  1SWU A;  5IRA A;  1RSU B;  1SWB A;  2IZF B;  1SWL A;  1VWQ B;  4Z27 A;  1VWR B;  1SRI A;  2IZD B;  1RAV A;  1VWE B;  1VWC B;  1Y53 X;  2RTM A;  2RTP B;  1NQM A;  3RDQ A;  1SLF B;  1SWF A;  1SRF A;  2F01 A;  2Y3E A;  5JD2 A;  1SRH A;  4BX6 B;  4Z2V A;  1STR B;  1MEP A;  3VGW A;  4Z2P A;  1IJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...