4GE1A

Structure of the tryptamine complex of the amine binding protein of rhodnius prolixus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
195
Chain Sequence
SGCSTVDTVKDFNKDNFFTGSWYITHYKLGDSTLEVGDKNCTKFLHQKTADGKIKEVFSNYNPNAKTYSYDISFAKVSDFDGNNGKYTAKNVIVEKDGRKIDERTLQVSYIDTDYSKYSVVHVCDPAAPDYYLYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGNKCQYDDETLQKLLKQSFPNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biogenic amine-binding protein
publication title Structure and ligand-binding properties of the biogenic amine-binding protein from the saliva of a blood-feeding insect vector of Trypanosoma cruzi.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Amine-binding protein
total genus 57
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ge1A00
1VYGA 2KT4B 4MVIA 1XKIA 2F73A 3D97A 3CWKA 2HZQA 5KIDA 4NNSA 1GT5A 2WQAE 5K06A 1LFOA 4M6SA 1SY3A 4ALOA 3JSQA 4HPDA 3BDRA 3CBCA 1SXUA 1SXYA 3ELZA 4N7CA 3TF6A 2CZTA 1JYJA 2FTBA 1ADLA 5LJDA 4A60A 3VG7A 2WWPA 4BOEA 5D8JA 1G5WA 2QM9A 1ERXA 1HBPA 2AT5X 3BX8A 2OVAA 1U17A 1LICA 4AW8A 4Y0RA 5HZ9A 1A18A 4TNNA 3FW4A 3ZQ3A 2FT9A 3B2HA 5EEDA 2A2UA 5F6ZA 3FR5A 2Q2MA 3P6DA 3SAOA 1CJ5A 1LPJA 3HWFA 4ARHA 4XMHA 3PEDA 1E5PA 4GH7A 3NQ3A 4R0BA 3KZAA 3VG6A 1OBPA 5KICA 1HN2A 1I04A 2AT6X 4LKTA 3BY0A 1DZPA 5FENA 4IB7A 2LKKA 2WUTA 1QY0A 1N0SA 1OPBA 3C78X 3S26A 2MM3A 1A3YA 2QO5A 3D96A 3CBSA 4MVLA 4XMEA 4ZHCA 1SY2A 3DTQA 2PY1A 3STNA 3WJCA 3BSZE 1O1UA 1T8VA 4NLJA 5LJBA 1AB0A 3UEXA 3FEPA 1BSOA 1QY2A 1QWDA 2Q2PA 1TOUA 5HTDA 4IMOA 2G79A 5D48A 1PMPA 4IB6A 1OBQA 1HQPA 3BRNA 3CMPA 3PPTA 4QGVA 1EALA 3WXQA 4XMCA 4NLIA 4I3DA 4ZR2A 4QAEA 1S2PA 2A3FX 1IKEA 4ZHFA 2Q39A 3D95A 4ODDA 1G7NA 2G7BA 1YP6A 3NADA 2LBVA 3VG5A 3NX1A 1LNMA 4IB9A 1EUOA 4EEJA 5AQ6A 5H9NA 1KT4A 1QFVA 2QO6A 2R56A 3NX2A 1IW2A 3BU1A 3DSZA 1RBPA 1UREA 3F9DA 4I9SA 2RD7C 2LFOA 4WBKA 4YBPA 1EW3A 3AKNA 4AZQA 4YGZA 4YFPA 1DC9A 1HMSA 4YFQA 1I05A 3PH5A 1DF3A 5L8IA 1OEJA 2JU3A 4IAWA 1GT3A 4WFUA 1GKAB 3WJDA 3WVMA 3KFGA 4HFOA 1PBOA 5H8TA 3VG3A 2A0AA 2AT3X 2POAA 1RLBE 4IBAA 3O2YA 2CBSA 1X71A 1QABE 1EPAA 3L4RA 4QGWA 1KZXA 4XMDA 2LBAA 4QYPA 2FS6A 4KIIA 2GTFX 4ORSA 5D45A 1JV4A 2AKQA 1IFBA 2W2AA 3EBKA 3WJBA 2MO5A 1BEBA 3Q6LA 2OVDA 3U03A 4QZUA 1EPBA 1MUPA 1JJJA 3JS1A 3APXA 1ZNLA 1GT1A 2ACPX 2HZRA 3CQNA 3FR2A 3TGAA 1ERBA 3B2LA 1LF7A 4XMGA 4DQ3A 3MBTA 1IKJA 4TKHA 3PP6A 2FR2A 5LJGA 4GETA 3STMX 1DZKA 4RUNA 3FA8A 2JU7A 3NQ9A 2Q9SA 3FEKA 4YBUA 4D6AA 1E02A 1SY0A 2OVEA 1QQSA 2JOZA 4AYHA 2NNDA 4ORXA 1HBQA 2EU7X 1FEMA 4A8ZA 4GE1A 1SXXA 3APUA 5EZ2A 3MVFA 3VG2A 1U18A 1FE3A 1I4UA 4ZJ0A 2E4JA 4RUUA 4ZHHA 5FAZA 4YDBA 2CBRA 5DG4A 3B2KA 1SY1A 2RCQA 4AZNA 4GNWA 5H9KA 4QGXA 1MDCA 1YWDA 4AZRA 1ZNDA 4TLJA 4OS8A 3OJYC 2DM5A 2NP1A 4NP1A 1O8VA 4ZHGA 3FR4A 2CM9A 2FR3A 5JR8A 3I0AA 5HZ6A 2RQ0A 2ASNX 1A57A 3I17A 5HCDC 5BVQA 2A2GA 1CBIA 1OPAA 4YCHA 2CM4A 1AQBA 3BS2A 1L6MA 1QY1A 1T0VA 3FELA 5KHPA 1MX8A 5LJKA 5EEEA 1SA8A 2R74A 5LKEA 3P6EA 2FWVA 2AMMX 5BVSA 1ICMA 4ORWA 5B29A 1BWYA 4O9SA 1NP1A 3FA9A 4YGGA 5LJCA 1S7DA 1QG5A 1HMTA 1BM5A 2X45A 2AH7X 4TQ2A 4UU3A 3TGCA 3APVA 3WJFA 1PM1X 3PH6A 1GKAA 3HWEA 1ML7A 3P6GA 4Y0SA 1PEEA 3FMZA 1ACDA 4ALBA 4QZTA 4QYNA 5BVTA 3BLGA 3BU9A 3U9PC 2K62A 1KQWA 3P6CA 1ZNEA 3WBGA 4EFGA 4AZPA 3K3LA 5F7GA 4YGHA 5F58A 1OBUA 1HMRA 1E06A 1GX8A 1I06A 1LIBA 5HBSA 3STKA 1IIUA 4AZMA 4HPCA 5HAEA 1BRPA 2A13A 1P6PA 1ZNGA 3FA7A 5C0NA 4Y0QA 4LZUA 1R0UA 4IMNA 1G74A 4NYRA 4WFVA 5EDCA 1CBRA 4YFRA 1VPRA 3P6FA 4LZVA 2W2FA 3HWDA 1YWAA 1ZNKA 1AVGI 5FFHA 5HWZA 1KOIA 2NNEA 4TKBA 3TZSA 3B2IA 4K19A 1E00A 1LIFA 4GNYA 3WJEA 1MVGA 4GKCA 4Y0PA 2ALLX 4EXZA 1YP7A 1GXAA 1JZUA 1MX7A 1GM6A 2K23A 3EMMA 3KFIA 5L8OA 1X8OA 5HZ8A 2MJIA 1T68X 1GX9A 3IA8A 1TOWA 1KT3A 4TKJA 5LKFA 2Q4NA 5HA1A 2GJ5A 4OS0A 4HPBA 1VYFA 5D4AA 5EDBA 1ICNA 4ZH6A 2RCTA 2G78A 3CQRA 2L68A 3KFHA 3NPOA 4I3BA 2OZQA 4OMWA 5IO7A 4A1YA 4MVKA 3KQ0A 1JBHA 3IFBA 1LIEA 3TGBA 3FIQA 4I3CA 5L8NA 4ZH9A 3U0DA 5H9AA 1X8PA 5F1EA 1ZRYA 3RZYA 1YIVA 2KTDA 3O22A 1FELA 1FTPA 3APWA 3EYCA 1B4MA 1FDQA 4PSQA 1D3SA 3NP1A 1JYDA 2N93A 3FLLA 1A2DA 5H9LA 3KFFA 4YMYA 3EM0A 4IB8A 5IO6A 1ZNHA 4YH0A 4IAXA 4M7MA 1X8UA 2OFRX 5LJHA 1YWCA 5HA0A 2WQ9A 3G7XA 3ZUIA 3ZUOA 2P8GA 1B8EA 1BBPA 3AKMA 2X46A 1EQDA 1KXOA 1LIDA 1XCAA 4N7DA 4ORUA 2AT8X 1X8NA 2HNXA 1O1VA 4HPAA 2HMBA 3F8AA 1EIOA 1EXSA 2W2BA 3UEWA 4AZOA 4BVMA 3EBWA 1OEEA 1YWBA 1YUPA 5HCEC 3B2JA 3C76X 1IFCA 2ANSA 4I9RA 1TW4A 3FENA 3PECA 5HZ5A 2HLVA 1BJ7A 2XKLA 2AT0X 1NP4A 3UEUA 3WJGA 1BLRA 4CK4A 3GAQA 3T1DA 2OFMX 4ZHDA 2FS7A 2R73A 2WEXA 4DQ4A 5HZQA 5LJEA 1CRBA 1H91A 1FENA 1SXWA 1KGLA 1GT4A 3NR3A 4ZFXA 5IO5A 1ALBA 2YG2A 4BQUA 2RA6A 1EIIA 1D2UA 4TJZA 3QKGA 4ORYA 4XMFA 1DV9A 4ZGUA 1JJXA 1KT6A 1LKEA 4YKMA 5HTEA 2AL0X 1DFVA 5D47A 1KT7A 4YKOA 3BX7A 2JU8A 2FLJA 5B27A 1NGLA 1Z24A 4OS3A 2L9CA 2NNQA 4OMXA 2L67A 2QOSC 3FA6A 3UEVA 1GGLA 2CZUA 2QO4A 5DPQA 1TXLA 2XSTA 4LKPA 3CR6A 3O19A 2BLGA 1KT5A 4EDEA 1KZWA 3FW5A 1QFTA 3HWGA 4NYQA 2JN3A 1BSQA 4YDAA 4ES7A 1B56A 5CE4A 2WR6A 1KQXA 3C77X 2O62A 2WSJA 1DZJA 4GRJA 1G85A 4A1HA 2IFBA 1AELA 3P6HA 1B0OA 4ORRA 4ZCBA 2WEWA 2HYSA 1OEKA 1X89A 4NNTA 5EPQA 5HCCC 4YCEA 3VG4A 1DZMA 4UU2A 5F6BA 2L5PA 3HK1A 2ACOA 2LB6A 1CBSA 1BRQA 1TVQA 1CBQA 2GC9A 1S44A 1BSYA 1U0XA 3RSWA 1X8QA 1UZ2X 4D6BA 3ELXA 2FRSA
chains in the Genus database with same CATH superfamily
2RTQB 1UYOX 4GDZA 1VYGA 2KT4B 4MVIA 4WHIA 1XKIA 1SWAA 2F73A 3CWKA 3D97A 2HZQA 2QOMA 3P02A 3AEHA 3E3CA 5KIDA 4NNSA 1HXLA 2OY5O 5B11O 1GT5A 2WQAE 3ZW0A 5K06A 1LFOA 2X34A 4M6SA 1SY3A 4ALOA 3JSQA 1Y9LA 4HPDA 1LUQA 3BDRA 4U8UM 3CBCA 1SXUA 1SXYA 3ELZA 4N7CA 3RE6A 3TF6A 2CZTA 1JYJA 2FTBA 1ADLA 5CHKA 5LJDA 4A60A 4BX7A 3VG7A 2WWPA 4BOEA 1WBIA 2QMIA 5D8JA 1G5WA 3H3IA 4I95A 2QM9A 1ERXA 2UYWA 1HBPA 2AT5X 2FKJA 4O4XA 3BX8A 2OVAA 1U17A 2OF8A 1LICA 1K3BA 1JJUA 4AW8A 1PTSA 1SRJA 4Y0RA 1JMZA 3WZOA 3ZI8A 5HZ9A 4JHQA 2LA7A 1VWKB 1A18A 4TNNA 2VDFA 3FW4A 3ZQ3A 2FT9A 1MEPA 4GJSA 3B2HA 5EEDA 3S60A 3VU1A 2A2UA 5F6ZA 3FR5A 2Q2MA 3P6DA 4OEMA 1STSB 3HTYA 4BX7B 3SAOA 1CJ5A 3VHIA 1LPJA 2X8TA 3HWFA 4ARHA 4XMHA 5AJCA 3PEDA 1E5PA 4GH7A 2CAMA 2C4IA 2RTGB 3NQ3A 4R0BA 3MG5A 5F2BA 4CDCA 3KZAA 3VG6A 1OBPA 5KICA 1HN2A 1I04A 1HY2A 2RTOB 3VE1A 2AT6X 3KVNA 4LKTA 1RXJA 2IZLB 3BY0A 1N7YA 1DZPA 2MF6A 5FENA 4IB7A 3ZW1B 2LKKA 2OVSA 2WUTA 1QY0A 1N0SA 1OPBA 3C78X 3HPEA 3S26A 2MM3A 1A3YA 2QO5A 3D96A 3CBSA 4MVLA 4XMEA 1LCVA 4BJ8A 4O4OA 4ZHCA 1SY2A 3DTQA 2PY1A 3STNA 3WJCA 3BSZE 1O1UA 1T8VA 1SWHA 1VWBB 4NLJA 1SLFB 5LJBA 1AB0A 4I6SA 2A8GA 3UEXA 3FEPA 1BSOA 1QY2A 1QWDA 1TOUA 2Q2PA 2I5ZO 4IMOA 4MIRA 5HTDA 2G79A 5D48A 1PMPA 4IB6A 1OBQA 1HQPA 1VWQB 2RTMA 4DCBA 3BRNA 3CMPA 3PPTA 4QGVA 2GTLN 2MWHA 1EALA 3WXQA 1GX3A 4XMCA 4NLIA 4I3DA 4ZR2A 1VWHB 4QAEA 1VWRB 1S2PA 2WPUA 2A3FX 4O3XB 1IKEA 1AVEA 4ZHFA 1SWDA 2Q39A 3D95A 4CDEA 1VYOA 4ODDA 1G7NA 2G7BA 1YP6A 3NADA 2LBVA 3VG5A 1SLDB 4IRWA 3NX1A 3RY2A 1VWAB 4LQZA 1LNMA 4IB9A 1EUOA 4EEJA 5AQ6A 4U3QA 5H9NA 1KT4A 1QFVA 2QO6A 2R56A 4BX6B 1OSPO 3FYFA 3NX2A 1IW2A 3MX7A 1SLEB 3BU1A 3DSZA 1RBPA 1UREA 4L3RA 3HOEA 4NV7A 3F9DA 4KT5A 3V8UA 4I9SA 2RD7C 2LFOA 4U9CA 4WBKA 4YBPA 1EW3A 3AKNA 4AZQA 4YGZA 4YFPA 4NV8A 1DC9A 4I60A 4NW4A 1HMSA 4FGIB 4YFQA 1VWGB 1I05A 1SMPI 2BT9A 3F6ZB 3PH5A 1SWOA 1DF3A 5L8IA 1OEJA 3VE2A 2GTLO 4Z27A 2JU3A 4IAWA 1GT3A 4WFUA 1GKAB 2OF9A 3WJDA 3WVMA 3KFGA 4HFOA 2RTFB 1PBOA 5H8TA 2Y3EA 3RDQA 2A0AA 2AT3X 3VG3A 2POAA 4GGZA 1RLBE 5FQ7E 4IBAA 3O2YA 2CBSA 4GJVA 1X71A 2RTHB 1QABE 1EPAA 3L4RA 4QGWA 1WUBA 4CV7A 1KZXA 3SLJA 4GK9A 2RTBB 4XMDA 2LBAA 4QYPA 4GD9A 2FS6A 2A5CA 2IZJA 2KW1A 4IABA 4KIIA 1VWPB 2GTFX 4ORSA 5D45A 1JV4A 4ON1A 2AKQA 3S5XA 1IFBA 2W2AA 3EBKA 3Q34A 2MO5A 3WJBA 1BEBA 1NDJA 3Q6LA 2OVDA 3U03A 4JNJA 4QZUA 1EPBA 1MUPA 1VWFB 1JQPA 2RTDB 5IRAA 1JJJA 3JS1A 3APXA 3NBXX 1ZNLA 1GT1A 2G8CO 2ACPX 2HZRA 3CQNA 3FR2A 1I78A 1ERBA 2FKGA 2IZDB 3B2LA 3RDOA 3TGAA 1LF7A 1W4TA 2X4MA 4XMGA 4DQ3A 3MBTA 1IKJA 4TKHA 3PP6A 2FR2A 3WZQA 5LJGA 3RDXA 2RTJA 4GETA 4ID2A 4ML7B 3RWXA 3STMX 1DZKA 4RUNA 3FA8A 2JU7A 1MM9A 4OKAA 4Z2PA 1VWOB 3JQOA 4CPFA 3NQ9A 4CPHB 2Q9SA 1VWCB 2OL8O 1LELA 3FEKA 1SWUA 4YBUA 5AEOA 1LDOA 4D6AA 1E02A 1JMXA 1N9MA 1SY0A 1QQSA 2JOZA 2OVEA 4AYHA 2NNDA 2IZIA 4ORXA 1HBQA 2EU7X 3FDCA 3SZHA 1FEMA 3OD9A 1E2TA 4A8ZA 4GE1A 1SXXA 2GH7A 2JGSA 3APUA 5EZ2A 3S5VA 3D9WA 3MVFA 3ZW1A 3VG2A 4CPEA 1U18A 1FE3A 1I4UA 4ZJ0A 2E4JA 1SWRA 1NQNA 2X56A 4GU8A 4RUUA 4ZHHA 5FAZA 4YDBA 2CBRA 2OL7A 2RN4A 5DG4A 3B2KA 1SY1A 4O3ZA 2RCQA 4AZNA 4GNWA 4ZGFA 5H9KA 1SREA 4QGXA 3WYQA 1MDCA 1YWDA 4AZRA 1ZNDA 4TLJA 4OS8A 3OJYC 4CDDA 2DM5A 2NP1A 5CYBA 4NP1A 1N9YA 4FBRA 1O8VA 3RDMA 4ZHGA 3SLTA 3FR4A 3GE2A 4O4UA 1DF8A 2CM9A 2FR3A 4KCAA 2FHNX 1SWCA 5JR8A 4U46A 3I0AA 5HZ6A 1SWKA 2Z4IA 3FIDA 2RQ0A 2Y32A 2ASNX 1A57A 1RSUB 3I17A 5HCDC 3ZWEA 5BVQA 2RTKA 2A2GA 1SRGA 4QNIA 2DJGA 1CBIA 1OPAA 4YCHA 2X8SA 3P24A 2CM4A 1AQBA 1LCWA 1L6MA 1QY1A 1T0VA 3BS2A 3FELA 1MX8A 4KC8A 5EEEA 1SA8A 2R74A 4BX6A 3P6EA 5KHPA 5LKEA 1NC9A 2BS5A 2AMMX 2FWVA 5BVSA 1ICMA 1Y53X 4ORWA 2IZEB 5B29A 1LCZA 1W5RA 2JW1A 3EW1A 1BWYA 3NQKA 4O9SA 1NP1A 3FA9A 4YGGA 3WOVA 1STRB 5LJCA 1S7DA 4GUZA 4MVEA 4CPIA 1QG5A 4BX5B 1HMTA 1KL3A 2X45A 2AH7X 4TQ2A 1SWLA 1BM5A 1STPA 4UU3A 3TGCA 3APVA 4YVBA 1Y9TA 3SZJA 3WJFA 3WZNA 1PM1X 3PH6A 1GKAA 4Z2VA 1I9HA 3HWEA 1ML7A 2IZAA 4QQ1A 4BGFA 3P6GA 4Y0SA 5B3MO 1PEEA 3FMZA 1ACDA 4ALBA 5B5FA 2VFBA 4QZTA 1PBYA 4QYNA 2OY8A 4BCSA 5BVTA 1VWLB 3BLGA 1SLGB 2F01A 3BU9A 5K68A 3U9PC 2K62A 1KQWA 5B5GA 3P6CA 1ZNEA 3WBGA 2JMBA 4EFGA 4AZPA 3K3LA 4MEEA 5F7GA 1RSTB 1HXZA 4YGHA 1JIWI 2I5VO 3PDFA 1OBUA 1HMRA 4U8UN 5F58A 1E06A 4BBOA 1GX8A 2BC3A 2X8FA 1I06A 1SWTA 1LIBA 2IZFB 1SWGA 5HBSA 3STKA 1IIUA 3VPJE 4AZMA 4HPCA 4INNA 5HAEA 1BRPA 2A13A 1P6PA 1ZNGA 2QCBA 3FA7A 4Z2OA 5BYPA 4GGTA 4Y0QA 1SWJA 5C0NA 4LZUA 1R0UA 4IMNA 1G74A 4NYRA 4WFVA 5EDCA 1CBRA 4YFRA 1VPRA 3P6FA 1AVDA 4LZVA 2OYBO 4CDFA 2RTRB 2W2FA 3HWDA 1YWAA 1ZNKA 4O49A 4CPHA 1AVGI 5FFHA 5HWZA 1KOIA 1VWEB 2FGSA 2NNEA 5CSEA 1VWDB 3B2IA 4TKBA 4K19A 3TZSA 2KD2A 1E00A 1LIFA 4GNYA 2A5BA 1MVGA 4GKCA 3WJEA 4Y0PA 2ALLX 2ZSCA 2OY7A 1YP7A 4EXZA 2RTPB 1GXAA 1RXKA 1W6FA 1Y55X 4HWMA 1JZUA 1MX7A 4U8UO 1GM6A 1SWFA 3RE5A 2K23A 2C1QA 3EMMA 3KFIA 2ZAIA 5L8OA 1X8OA 4KH8A 4C5PA 5HZ8A 2MJIA 1T68X 3OBLA 2GTLM 1GX9A 3D4RA 3IA8A 4Y5DA 1TOWA 5JD2A 4O4SA 1KT3A 2RTIB 4TKJA 3SLOA 4FBOA 5LKFA 2Q4NA 3RDUA 5HA1A 3ZW2A 2GJ5A 4OS0A 4HPBA 1VYFA 5D4AA 3PQSA 5EDBA 1ICNA 4ZH6A 2G78A 2RCTA 2VFCA 3CQRA 2L68A 3KFHA 3NPOA 4I3BA 2OZQA 4OMWA 5IO7A 4A1YA 2IZGB 3KQ0A 4MVKA 4KC7A 2UZ2A 1JBHA 2IZHB 3IFBA 1LIEA 3SZIA 3TGBA 3FIQA 4I3CA 5L8NA 4ZH9A 3U0DA 5H9AA 1X8PA 4O3WA 5F1EA 1ZRYA 4OELA 3RZYA 4EKVA 1YIVA 2KTDA 3O22A 1FELA 2YMSA 1FTPA 3APWA 3EYCA 1B4MA 1FDQA 3LHNA 4PSQA 1D3SA 2BHVA 3NP1A 1JYDA 2N93A 1KL4A 3QQ2A 3FLLA 1A2DA 3AUMO 5H9LA 3KFFA 1NBXA 4YMYA 3EM0A 4IB8A 5IO6A 5K67A 1ZNHA 4YH0A 4IAXA 4M7MA 1X8UA 2OFRX 1Y0GA 5LJHA 1YWCA 5HA0A 1SRIA 1SWNA 2WQ9A 4GGRA 3G7XA 1VWIB 2AVIA 3ZUIA 4PJ2A 2P8GA 3ZUOA 3UAQA 1B8EA 1BBPA 4CSBA 3AKMA 1HQQA 2X46A 1EQDA 1MOYA 1KXOA 1LIDA 1XCAA 2Y3FA 4N7DA 1KFFA 2X55A 1X8NA 2AT8X 2Z4HA 2HNXA 4ORUA 3SOTA 4B55A 1O1VA 3CKGA 4HPAA 2HMBA 3F8AA 1EIOA 1EXSA 2W2BA 5FQ8E 3UEWA 4AZOA 5LJKA 4BVMA 3EBWA 4BX5A 3ZW0B 2IZBA 1OEEA 1YWBA 1YUPA 3LTWA 5HCEC 3B2JA 3C76X 1IFCA 4GDAA 2ANSA 3X00A 4I9RA 1TW4A 1VWNB 2X32A 3FENA 5FQ6E 3ZZVA 3PECA 5HZ5A 2AF5A 1SRHA 1MK5A 2IZKA 2C1SA 1BJ7A 2HLVA 2XKLA 2F09A 2AT0X 1NP4A 3UEUA 3WJGA 1BLRA 4CK4A 3VHMA 4JGLA 2RTCB 1VWJB 2RTEB 3GAQA 3T1DA 4DNEA 2OFMX 4Y59A 4ZHDA 2FS7A 1N43A 5B10O 2R73A 2WEXA 4DQ4A 4JO6A 2FHLA 5HZQA 4GZVA 2OFBA 3EC5A 5LJEA 2RTNB 4EQAC 1CRBA 1H91A 1FENA 1SXWA 2KTSA 1KGLA 3LV4A 3HOLA 1GT4A 3NR3A 4ZFXA 1EI5A 1RAVA 4L1NA 3OE3A 1SWQA 5IO5A 1ALBA 2YG2A 4BQUA 2RTAA 2RA6A 1EIIA 2BSZA 4FQBB 1D2UA 1SWSA 4QRLA 4TJZA 2OFAA 5IRUA 3QKGA 4ORYA 4XMFA 1DV9A 4Z28A 4ZGUA 1JJXA 1KT6A 1LKEA 4YKMA 5HTEA 3RKGA 2AL0X 5B2AO 1DFVA 3RY1A 5D47A 4COTA 1KT7A 4YKOA 2MHDA 3BX7A 2JU8A 2FLJA 5B27A 1NQMA 1NGLA 1Z24A 2ZAGA 4O3YA 1SWEA 1SWBA 2L9CA 2NNQA 4OS3A 2OL6O 3CKFA 4OMXA 3VGWA 1RXHA 2L67A 2M4LA 1SWPA 4MISA 3RBYA 2QOSC 1KL5A 3MM0A 3FA6A 3UEVA 3WYPA 2DJFA 3T2XA 1UYNX 1GGLA 2CZUA 2QO4A 3T6FA 5DPQA 1N4JA 4Z6JA 3N91A 1TXLA 2XSTA 4LKPA 3WZPA 3CR6A 3O19A 2BLGA 1SRFA 2OY1O 1KT5A 3PQUA 4EDEA 1KZWA 3FW5A 1QFTA 3HWGA 4NYQA 1Y52X 1BSQA 2JN3A 4YDAA 1B56A 2RTLA 1IJ8A 4FBVA 2WR6A 4ES7A 5CE4A 1KQXA 5IXGA 1K24A 3C77X 2O62A 2WSJA 1DZJA 4GRJA 1G85A 1LDQA 4A1HA 1FJ1E 2IFBA 3EW2A 3RDSA 5L3YA 1AELA 3P6HA 1B0OA 4ORRA 3T6LA 4ZCBA 2WEWA 2HYSA 1OEKA 3PK2A 1VWMB 1X89A 4NNTA 2G5LA 5IRWA 5EPQA 5HCCC 4YCEA 3VG4A 1DZMA 4UU2A 2BS6A 2L5PA 3HK1A 2ACOA 5AJBA 5F6BA 2LB6A 2HKDA 2IZCB 1CBSA 1BRQA 1TVQA 3T2WA 1CBQA 2GC9A 1S44A 1BSYA 1U0XA 3RSWA 1X8QA 1UZ2X 3VHHA 4D6BA 3ELXA 2FRSA 2PI3O
chains in the Genus database with same CATH topology
4GDZA 1VYGA 2KT4B 4MVIA 4WHIA 1XKIA 2F73A 3D97A 3CWKA 2HZQA 3P02A 3E3CA 5KIDA 4NNSA 1GT5A 2WQAE 3ZW0A 5K06A 1LFOA 4M6SA 1SY3A 4ALOA 3JSQA 1Y9LA 4HPDA 3BDRA 4U8UM 3CBCA 1SXUA 1SXYA 3ELZA 4N7CA 3TF6A 2CZTA 1JYJA 2FTBA 1ADLA 5LJDA 4A60A 3VG7A 2WWPA 4BOEA 2QMIA 5D8JA 1G5WA 3H3IA 4I95A 2QM9A 1ERXA 1HBPA 2AT5X 4O4XA 3BX8A 2OVAA 1U17A 1LICA 4AW8A 4Y0RA 3ZI8A 5HZ9A 2LA7A 1A18A 4TNNA 3FW4A 3ZQ3A 2FT9A 3B2HA 5EEDA 3S60A 3VU1A 2A2UA 5F6ZA 3FR5A 2Q2MA 3P6DA 3HTYA 3SAOA 1CJ5A 1LPJA 2X8TA 3HWFA 4ARHA 4XMHA 5AJCA 3PEDA 1E5PA 4GH7A 3NQ3A 4R0BA 3KZAA 3VG6A 1OBPA 5KICA 1HN2A 1I04A 3VE1A 2AT6X 4LKTA 3BY0A 1DZPA 5FENA 4IB7A 3ZW1B 2LKKA 2OVSA 2WUTA 1QY0A 1N0SA 1OPBA 3C78X 3S26A 2MM3A 1A3YA 2QO5A 3D96A 3CBSA 4MVLA 4XMEA 4ZHCA 4O4OA 1SY2A 3DTQA 2PY1A 3STNA 3WJCA 3BSZE 1O1UA 1T8VA 4NLJA 5LJBA 1AB0A 4I6SA 3UEXA 3FEPA 1BSOA 1QY2A 1QWDA 1TOUA 2Q2PA 5HTDA 4IMOA 4MIRA 2G79A 5D48A 1PMPA 4IB6A 1OBQA 1HQPA 3BRNA 3CMPA 3PPTA 4QGVA 2GTLN 2MWHA 1EALA 3WXQA 4XMCA 4NLIA 4I3DA 4ZR2A 4QAEA 1S2PA 2A3FX 4O3XB 1IKEA 4ZHFA 2Q39A 3D95A 4ODDA 1G7NA 2G7BA 1YP6A 3NADA 2LBVA 3VG5A 3NX1A 4LQZA 1LNMA 4IB9A 1EUOA 4EEJA 5AQ6A 4U3QA 5H9NA 1KT4A 1QFVA 2QO6A 2R56A 3FYFA 3NX2A 1IW2A 3MX7A 3BU1A 4L3RA 3DSZA 1RBPA 1UREA 3SOTA 3HOEA 3WOVA 3F9DA 4KT5A 3V8UA 4I9SA 2RD7C 2LFOA 4U9CA 4WBKA 4YBPA 1EW3A 3AKNA 4AZQA 4YGZA 4YFPA 1DC9A 4NW4A 1HMSA 4FGIB 4YFQA 1I05A 1SMPI 2BT9A 3F6ZB 3PH5A 1DF3A 5L8IA 1OEJA 3VE2A 2GTLO 2JU3A 4IAWA 1GT3A 4WFUA 1GKAB 3WJDA 3WVMA 3KFGA 4HFOA 1PBOA 5H8TA 3VG3A 2A0AA 2AT3X 2POAA 1RLBE 5FQ7E 4IBAA 3O2YA 2CBSA 1X71A 1QABE 1EPAA 3L4RA 4QGWA 4CV7A 1KZXA 4GK9A 4XMDA 2LBAA 4QYPA 2FS6A 2KW1A 4IABA 4KIIA 2GTFX 4ORSA 5D45A 1JV4A 4ON1A 2AKQA 3S5XA 1IFBA 2W2AA 3EBKA 3WJBA 2MO5A 1BEBA 3Q6LA 2OVDA 3U03A 4QZUA 1EPBA 1MUPA 1JJJA 3JS1A 3APXA 3NBXX 1ZNLA 1GT1A 2ACPX 2HZRA 3CQNA 3FR2A 3TGAA 1ERBA 3B2LA 1LF7A 4XMGA 4DQ3A 3MBTA 1IKJA 4TKHA 3PP6A 2FR2A 5LJGA 4GETA 4ID2A 4ML7B 3RWXA 3STMX 1DZKA 4RUNA 3FA8A 2JU7A 3JQOA 3NQ9A 2Q9SA 3FEKA 4YBUA 5AEOA 4D6AA 1E02A 1SY0A 2OVEA 1QQSA 2JOZA 4AYHA 2NNDA 4ORXA 1HBQA 2EU7X 1FEMA 3OD9A 4A8ZA 4GE1A 1SXXA 3APUA 5EZ2A 3S5VA 3MVFA 3ZW1A 3VG2A 1U18A 1FE3A 1I4UA 4ZJ0A 2E4JA 4GU8A 4RUUA 4ZHHA 5FAZA 4YDBA 2CBRA 2RN4A 5DG4A 3B2KA 1SY1A 4O3ZA 2RCQA 4AZNA 4GNWA 4ZGFA 5H9KA 4QGXA 1MDCA 1YWDA 4AZRA 1ZNDA 4TLJA 4OS8A 3OJYC 2DM5A 2NP1A 5CYBA 4NP1A 4FBRA 1O8VA 4ZHGA 3FR4A 3GE2A 4O4UA 2CM9A 2FR3A 4KCAA 5JR8A 3I0AA 5HZ6A 2Z4IA 2RQ0A 2ASNX 1A57A 3I17A 5HCDC 3ZWEA 5BVQA 2A2GA 4QNIA 1CBIA 1OPAA 4YCHA 2X8SA 3P24A 2CM4A 1AQBA 3BS2A 1L6MA 1QY1A 1T0VA 3FELA 4KC8A 1MX8A 5KHPA 5EEEA 1SA8A 2R74A 5LJKA 3P6EA 5LKEA 2BS5A 2FWVA 2AMMX 5BVSA 1ICMA 4ORWA 5B29A 2JW1A 1BWYA 3NQKA 4O9SA 1NP1A 3FA9A 4YGGA 5LJCA 1S7DA 4MVEA 1QG5A 1HMTA 1BM5A 2X45A 2AH7X 4TQ2A 4UU3A 3TGCA 3APVA 1Y9TA 3WJFA 1PM1X 3PH6A 1GKAA 3HWEA 1ML7A 4QQ1A 3P6GA 4Y0SA 1PEEA 3FMZA 1ACDA 4ALBA 4QZTA 4QYNA 5BVTA 3BLGA 3BU9A 3U9PC 2K62A 1KQWA 3P6CA 1ZNEA 3WBGA 2JMBA 4EFGA 4AZPA 3K3LA 5F7GA 4YGHA 1JIWI 5F58A 4U8UN 1OBUA 1HMRA 1E06A 1GX8A 2X8FA 1I06A 1LIBA 5HBSA 3STKA 1IIUA 3VPJE 4AZMA 4HPCA 4INNA 5HAEA 1BRPA 2A13A 1P6PA 1ZNGA 3FA7A 5C0NA 5BYPA 4Y0QA 4LZUA 1R0UA 4IMNA 1G74A 4NYRA 4WFVA 5EDCA 1CBRA 4YFRA 1VPRA 3P6FA 4LZVA 2W2FA 3HWDA 1YWAA 1ZNKA 4O49A 1AVGI 5FFHA 5HWZA 1KOIA 2NNEA 4TKBA 3TZSA 3B2IA 4K19A 2KD2A 1E00A 1LIFA 4GNYA 3WJEA 1MVGA 4GKCA 4Y0PA 2ALLX 4EXZA 1YP7A 1GXAA 1JZUA 4HWMA 1MX7A 4U8UO 1GM6A 2K23A 3EMMA 3KFIA 2ZAIA 5L8OA 1X8OA 4KH8A 5HZ8A 2MJIA 1T68X 3OBLA 2GTLM 1GX9A 3D4RA 3IA8A 1TOWA 4O4SA 1KT3A 4TKJA 4FBOA 5LKFA 2Q4NA 5HA1A 3ZW2A 2GJ5A 4OS0A 4HPBA 1VYFA 5D4AA 3PQSA 5EDBA 1ICNA 4ZH6A 2G78A 2RCTA 3CQRA 2L68A 3KFHA 3NPOA 4I3BA 2OZQA 4OMWA 5IO7A 4A1YA 4MVKA 3KQ0A 1JBHA 4KC7A 3IFBA 1LIEA 3TGBA 3FIQA 4I3CA 5L8NA 4ZH9A 3U0DA 5H9AA 1X8PA 4O3WA 5F1EA 1ZRYA 3RZYA 1YIVA 2KTDA 3O22A 1FELA 2YMSA 1FTPA 3APWA 3EYCA 1B4MA 1FDQA 3LHNA 4PSQA 1D3SA 2BHVA 3NP1A 1JYDA 2N93A 3FLLA 1A2DA 5H9LA 3KFFA 4YMYA 3EM0A 4IB8A 5IO6A 1ZNHA 4YH0A 4IAXA 4M7MA 1X8UA 2OFRX 5LJHA 1YWCA 5HA0A 2WQ9A 3G7XA 3ZUIA 4PJ2A 2P8GA 3ZUOA 3UAQA 1B8EA 1BBPA 4CSBA 3AKMA 2X46A 1EQDA 1KXOA 1LIDA 1XCAA 4N7DA 4ORUA 2AT8X 1X8NA 2Z4HA 2HNXA 1O1VA 4HPAA 2HMBA 3F8AA 1EIOA 1EXSA 2W2BA 5FQ8E 3UEWA 4AZOA 4BVMA 3EBWA 3ZW0B 1OEEA 1YWBA 1YUPA 5HCEC 3B2JA 3C76X 1IFCA 2ANSA 4I9RA 1TW4A 3FENA 5FQ6E 3ZZVA 3PECA 5HZ5A 2HLVA 1BJ7A 2XKLA 2F09A 2AT0X 1NP4A 3UEUA 3WJGA 1BLRA 4CK4A 4JGLA 3GAQA 3T1DA 2OFMX 4ZHDA 2FS7A 2R73A 2WEXA 4DQ4A 5HZQA 4GZVA 5LJEA 4EQAC 1CRBA 1H91A 1FENA 1SXWA 2KTSA 1KGLA 3LV4A 3HOLA 1GT4A 3NR3A 4ZFXA 1EI5A 4L1NA 3OE3A 5IO5A 1ALBA 2YG2A 4BQUA 2RA6A 1EIIA 4FQBB 1D2UA 4TJZA 4QRLA 3QKGA 4ORYA 4XMFA 1DV9A 4ZGUA 1JJXA 1KT6A 1LKEA 4YKMA 5HTEA 3RKGA 2AL0X 1DFVA 5D47A 4COTA 1KT7A 4YKOA 2MHDA 3BX7A 2JU8A 2FLJA 5B27A 1NGLA 1Z24A 2ZAGA 4O3YA 2L9CA 4OS3A 2NNQA 4OMXA 2L67A 2M4LA 4MISA 3RBYA 2QOSC 3FA6A 3UEVA 1GGLA 2CZUA 2QO4A 5DPQA 3N91A 1TXLA 2XSTA 4LKPA 3CR6A 3O19A 2BLGA 3PQUA 1KT5A 4EDEA 1KZWA 3FW5A 1QFTA 3HWGA 4NYQA 2JN3A 1BSQA 4YDAA 4ES7A 1B56A 4FBVA 5CE4A 2WR6A 1KQXA 3C77X 2O62A 2WSJA 1DZJA 4GRJA 1G85A 4A1HA 2IFBA 1AELA 3P6HA 1B0OA 4ORRA 4ZCBA 2WEWA 2HYSA 1OEKA 1X89A 4NNTA 5EPQA 5HCCC 4YCEA 3VG4A 1DZMA 4UU2A 2BS6A 2L5PA 3HK1A 2ACOA 5AJBA 5F6BA 2LB6A 1CBSA 1BRQA 1TVQA 1CBQA 2GC9A 1S44A 1BSYA 1U0XA 3RSWA 1X8QA 1UZ2X 4D6BA 3ELXA 2FRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYG A;  2KT4 B;  4MVI A;  1XKI A;  2F73 A;  3D97 A;  3CWK A;  2HZQ A;  5KID A;  4NNS A;  1GT5 A;  2WQA E;  5K06 A;  1LFO A;  4M6S A;  1SY3 A;  4ALO A;  3JSQ A;  4HPD A;  3BDR A;  3CBC A;  1SXU A;  1SXY A;  3ELZ A;  4N7C A;  3TF6 A;  2CZT A;  1JYJ A;  2FTB A;  1ADL A;  5LJD A;  4A60 A;  3VG7 A;  2WWP A;  4BOE A;  5D8J A;  1G5W A;  2QM9 A;  1ERX A;  1HBP A;  2AT5 X;  3BX8 A;  2OVA A;  1U17 A;  1LIC A;  4AW8 A;  4Y0R A;  5HZ9 A;  1A18 A;  4TNN A;  3FW4 A;  3ZQ3 A;  2FT9 A;  3B2H A;  5EED A;  2A2U A;  5F6Z A;  3FR5 A;  2Q2M A;  3P6D A;  3SAO A;  1CJ5 A;  1LPJ A;  3HWF A;  4ARH A;  4XMH A;  3PED A;  1E5P A;  4GH7 A;  3NQ3 A;  4R0B A;  3KZA A;  3VG6 A;  1OBP A;  5KIC A;  1HN2 A;  1I04 A;  2AT6 X;  4LKT A;  3BY0 A;  1DZP A;  5FEN A;  4IB7 A;  2LKK A;  2WUT A;  1QY0 A;  1N0S A;  1OPB A;  3C78 X;  3S26 A;  2MM3 A;  1A3Y A;  2QO5 A;  3D96 A;  3CBS A;  4MVL A;  4XME A;  4ZHC A;  1SY2 A;  3DTQ A;  2PY1 A;  3STN A;  3WJC A;  3BSZ E;  1O1U A;  1T8V A;  4NLJ A;  5LJB A;  1AB0 A;  3UEX A;  3FEP A;  1BSO A;  1QY2 A;  1QWD A;  2Q2P A;  1TOU A;  5HTD A;  4IMO A;  2G79 A;  5D48 A;  1PMP A;  4IB6 A;  1OBQ A;  1HQP A;  3BRN A;  3CMP A;  3PPT A;  4QGV A;  1EAL A;  3WXQ A;  4XMC A;  4NLI A;  4I3D A;  4ZR2 A;  4QAE A;  1S2P A;  2A3F X;  1IKE A;  4ZHF A;  2Q39 A;  3D95 A;  4ODD A;  1G7N A;  2G7B A;  1YP6 A;  3NAD A;  2LBV A;  3VG5 A;  3NX1 A;  1LNM A;  4IB9 A;  1EUO A;  4EEJ A;  5AQ6 A;  5H9N A;  1KT4 A;  1QFV A;  2QO6 A;  2R56 A;  3NX2 A;  1IW2 A;  3BU1 A;  3DSZ A;  1RBP A;  1URE A;  3F9D A;  4I9S A;  2RD7 C;  2LFO A;  4WBK A;  4YBP A;  1EW3 A;  3AKN A;  4AZQ A;  4YGZ A;  4YFP A;  1DC9 A;  1HMS A;  4YFQ A;  1I05 A;  3PH5 A;  1DF3 A;  5L8I A;  1OEJ A;  2JU3 A;  4IAW A;  1GT3 A;  4WFU A;  1GKA B;  3WJD A;  3WVM A;  3KFG A;  4HFO A;  1PBO A;  5H8T A;  3VG3 A;  2A0A A;  2AT3 X;  2POA A;  1RLB E;  4IBA A;  3O2Y A;  2CBS A;  1X71 A;  1QAB E;  1EPA A;  3L4R A;  4QGW A;  1KZX A;  4XMD A;  2LBA A;  4QYP A;  2FS6 A;  4KII A;  2GTF X;  4ORS A;  5D45 A;  1JV4 A;  2AKQ A;  1IFB A;  2W2A A;  3EBK A;  3WJB A;  2MO5 A;  1BEB A;  3Q6L A;  2OVD A;  3U03 A;  4QZU A;  1EPB A;  1MUP A;  1JJJ A;  3JS1 A;  3APX A;  1ZNL A;  1GT1 A;  2ACP X;  2HZR A;  3CQN A;  3FR2 A;  3TGA A;  1ERB A;  3B2L A;  1LF7 A;  4XMG A;  4DQ3 A;  3MBT A;  1IKJ A;  4TKH A;  3PP6 A;  2FR2 A;  5LJG A;  4GET A;  3STM X;  1DZK A;  4RUN A;  3FA8 A;  2JU7 A;  3NQ9 A;  2Q9S A;  3FEK A;  4YBU A;  4D6A A;  1E02 A;  1SY0 A;  2OVE A;  1QQS A;  2JOZ A;  4AYH A;  2NND A;  4ORX A;  1HBQ A;  2EU7 X;  1FEM A;  4A8Z A;  4GE1 A;  1SXX A;  3APU A;  5EZ2 A;  3MVF A;  3VG2 A;  1U18 A;  1FE3 A;  1I4U A;  4ZJ0 A;  2E4J A;  4RUU A;  4ZHH A;  5FAZ A;  4YDB A;  2CBR A;  5DG4 A;  3B2K A;  1SY1 A;  2RCQ A;  4AZN A;  4GNW A;  5H9K A;  4QGX A;  1MDC A;  1YWD A;  4AZR A;  1ZND A;  4TLJ A;  4OS8 A;  3OJY C;  2DM5 A;  2NP1 A;  4NP1 A;  1O8V A;  4ZHG A;  3FR4 A;  2CM9 A;  2FR3 A;  5JR8 A;  3I0A A;  5HZ6 A;  2RQ0 A;  2ASN X;  1A57 A;  3I17 A;  5HCD C;  5BVQ A;  2A2G A;  1CBI A;  1OPA A;  4YCH A;  2CM4 A;  1AQB A;  3BS2 A;  1L6M A;  1QY1 A;  1T0V A;  3FEL A;  5KHP A;  1MX8 A;  5LJK A;  5EEE A;  1SA8 A;  2R74 A;  5LKE A;  3P6E A;  2FWV A;  2AMM X;  5BVS A;  1ICM A;  4ORW A;  5B29 A;  1BWY A;  4O9S A;  1NP1 A;  3FA9 A;  4YGG A;  5LJC A;  1S7D A;  1QG5 A;  1HMT A;  1BM5 A;  2X45 A;  2AH7 X;  4TQ2 A;  4UU3 A;  3TGC A;  3APV A;  3WJF A;  1PM1 X;  3PH6 A;  1GKA A;  3HWE A;  1ML7 A;  3P6G A;  4Y0S A;  1PEE A;  3FMZ A;  1ACD A;  4ALB A;  4QZT A;  4QYN A;  5BVT A;  3BLG A;  3BU9 A;  3U9P C;  2K62 A;  1KQW A;  3P6C A;  1ZNE A;  3WBG A;  4EFG A;  4AZP A;  3K3L A;  5F7G A;  4YGH A;  5F58 A;  1OBU A;  1HMR A;  1E06 A;  1GX8 A;  1I06 A;  1LIB A;  5HBS A;  3STK A;  1IIU A;  4AZM A;  4HPC A;  5HAE A;  1BRP A;  2A13 A;  1P6P A;  1ZNG A;  3FA7 A;  5C0N A;  4Y0Q A;  4LZU A;  1R0U A;  4IMN A;  1G74 A;  4NYR A;  4WFV A;  5EDC A;  1CBR A;  4YFR A;  1VPR A;  3P6F A;  4LZV A;  2W2F A;  3HWD A;  1YWA A;  1ZNK A;  1AVG I;  5FFH A;  5HWZ A;  1KOI A;  2NNE A;  4TKB A;  3TZS A;  3B2I A;  4K19 A;  1E00 A;  1LIF A;  4GNY A;  3WJE A;  1MVG A;  4GKC A;  4Y0P A;  2ALL X;  4EXZ A;  1YP7 A;  1GXA A;  1JZU A;  1MX7 A;  1GM6 A;  2K23 A;  3EMM A;  3KFI A;  5L8O A;  1X8O A;  5HZ8 A;  2MJI A;  1T68 X;  1GX9 A;  3IA8 A;  1TOW A;  1KT3 A;  4TKJ A;  5LKF A;  2Q4N A;  5HA1 A;  2GJ5 A;  4OS0 A;  4HPB A;  1VYF A;  5D4A A;  5EDB A;  1ICN A;  4ZH6 A;  2RCT A;  2G78 A;  3CQR A;  2L68 A;  3KFH A;  3NPO A;  4I3B A;  2OZQ A;  4OMW A;  5IO7 A;  4A1Y A;  4MVK A;  3KQ0 A;  1JBH A;  3IFB A;  1LIE A;  3TGB A;  3FIQ A;  4I3C A;  5L8N A;  4ZH9 A;  3U0D A;  5H9A A;  1X8P A;  5F1E A;  1ZRY A;  3RZY A;  1YIV A;  2KTD A;  3O22 A;  1FEL A;  1FTP A;  3APW A;  3EYC A;  1B4M A;  1FDQ A;  4PSQ A;  1D3S A;  3NP1 A;  1JYD A;  2N93 A;  3FLL A;  1A2D A;  5H9L A;  3KFF A;  4YMY A;  3EM0 A;  4IB8 A;  5IO6 A;  1ZNH A;  4YH0 A;  4IAX A;  4M7M A;  1X8U A;  2OFR X;  5LJH A;  1YWC A;  5HA0 A;  2WQ9 A;  3G7X A;  3ZUI A;  3ZUO A;  2P8G A;  1B8E A;  1BBP A;  3AKM A;  2X46 A;  1EQD A;  1KXO A;  1LID A;  1XCA A;  4N7D A;  4ORU A;  2AT8 X;  1X8N A;  2HNX A;  1O1V A;  4HPA A;  2HMB A;  3F8A A;  1EIO A;  1EXS A;  2W2B A;  3UEW A;  4AZO A;  4BVM A;  3EBW A;  1OEE A;  1YWB A;  1YUP A;  5HCE C;  3B2J A;  3C76 X;  1IFC A;  2ANS A;  4I9R A;  1TW4 A;  3FEN A;  3PEC A;  5HZ5 A;  2HLV A;  1BJ7 A;  2XKL A;  2AT0 X;  1NP4 A;  3UEU A;  3WJG A;  1BLR A;  4CK4 A;  3GAQ A;  3T1D A;  2OFM X;  4ZHD A;  2FS7 A;  2R73 A;  2WEX A;  4DQ4 A;  5HZQ A;  5LJE A;  1CRB A;  1H91 A;  1FEN A;  1SXW A;  1KGL A;  1GT4 A;  3NR3 A;  4ZFX A;  5IO5 A;  1ALB A;  2YG2 A;  4BQU A;  2RA6 A;  1EII A;  1D2U A;  4TJZ A;  3QKG A;  4ORY A;  4XMF A;  1DV9 A;  4ZGU A;  1JJX A;  1KT6 A;  1LKE A;  4YKM A;  5HTE A;  2AL0 X;  1DFV A;  5D47 A;  1KT7 A;  4YKO A;  3BX7 A;  2JU8 A;  2FLJ A;  5B27 A;  1NGL A;  1Z24 A;  4OS3 A;  2L9C A;  2NNQ A;  4OMX A;  2L67 A;  2QOS C;  3FA6 A;  3UEV A;  1GGL A;  2CZU A;  2QO4 A;  5DPQ A;  1TXL A;  2XST A;  4LKP A;  3CR6 A;  3O19 A;  2BLG A;  1KT5 A;  4EDE A;  1KZW A;  3FW5 A;  1QFT A;  3HWG A;  4NYQ A;  2JN3 A;  1BSQ A;  4YDA A;  4ES7 A;  1B56 A;  5CE4 A;  2WR6 A;  1KQX A;  3C77 X;  2O62 A;  2WSJ A;  1DZJ A;  4GRJ A;  1G85 A;  4A1H A;  2IFB A;  1AEL A;  3P6H A;  1B0O A;  4ORR A;  4ZCB A;  2WEW A;  2HYS A;  1OEK A;  1X89 A;  4NNT A;  5EPQ A;  5HCC C;  4YCE A;  3VG4 A;  1DZM A;  4UU2 A;  5F6B A;  2L5P A;  3HK1 A;  2ACO A;  2LB6 A;  1CBS A;  1BRQ A;  1TVQ A;  1CBQ A;  2GC9 A;  1S44 A;  1BSY A;  1U0X A;  3RSW A;  1X8Q A;  1UZ2 X;  4D6B A;  3ELX A;  2FRS A; 
#chains in the Genus database with same CATH topology
 2RTQ B;  1UYO X;  4GDZ A;  1VYG A;  2KT4 B;  4MVI A;  4WHI A;  1XKI A;  1SWA A;  2F73 A;  3CWK A;  3D97 A;  2HZQ A;  2QOM A;  3P02 A;  3AEH A;  3E3C A;  5KID A;  4NNS A;  1HXL A;  2OY5 O;  5B11 O;  1GT5 A;  2WQA E;  3ZW0 A;  5K06 A;  1LFO A;  2X34 A;  4M6S A;  1SY3 A;  4ALO A;  3JSQ A;  1Y9L A;  4HPD A;  1LUQ A;  3BDR A;  4U8U M;  3CBC A;  1SXU A;  1SXY A;  3ELZ A;  4N7C A;  3RE6 A;  3TF6 A;  2CZT A;  1JYJ A;  2FTB A;  1ADL A;  5CHK A;  5LJD A;  4A60 A;  4BX7 A;  3VG7 A;  2WWP A;  4BOE A;  1WBI A;  2QMI A;  5D8J A;  1G5W A;  3H3I A;  4I95 A;  2QM9 A;  1ERX A;  2UYW A;  1HBP A;  2AT5 X;  2FKJ A;  4O4X A;  3BX8 A;  2OVA A;  1U17 A;  2OF8 A;  1LIC A;  1K3B A;  1JJU A;  4AW8 A;  1PTS A;  1SRJ A;  4Y0R A;  1JMZ A;  3WZO A;  3ZI8 A;  5HZ9 A;  4JHQ A;  2LA7 A;  1VWK B;  1A18 A;  4TNN A;  2VDF A;  3FW4 A;  3ZQ3 A;  2FT9 A;  1MEP A;  4GJS A;  3B2H A;  5EED A;  3S60 A;  3VU1 A;  2A2U A;  5F6Z A;  3FR5 A;  2Q2M A;  3P6D A;  4OEM A;  1STS B;  3HTY A;  4BX7 B;  3SAO A;  1CJ5 A;  3VHI A;  1LPJ A;  2X8T A;  3HWF A;  4ARH A;  4XMH A;  5AJC A;  3PED A;  1E5P A;  4GH7 A;  2CAM A;  2C4I A;  2RTG B;  3NQ3 A;  4R0B A;  3MG5 A;  5F2B A;  4CDC A;  3KZA A;  3VG6 A;  1OBP A;  5KIC A;  1HN2 A;  1I04 A;  1HY2 A;  2RTO B;  3VE1 A;  2AT6 X;  3KVN A;  4LKT A;  1RXJ A;  2IZL B;  3BY0 A;  1N7Y A;  1DZP A;  2MF6 A;  5FEN A;  4IB7 A;  3ZW1 B;  2LKK A;  2OVS A;  2WUT A;  1QY0 A;  1N0S A;  1OPB A;  3C78 X;  3HPE A;  3S26 A;  2MM3 A;  1A3Y A;  2QO5 A;  3D96 A;  3CBS A;  4MVL A;  4XME A;  1LCV A;  4BJ8 A;  4O4O A;  4ZHC A;  1SY2 A;  3DTQ A;  2PY1 A;  3STN A;  3WJC A;  3BSZ E;  1O1U A;  1T8V A;  1SWH A;  1VWB B;  4NLJ A;  1SLF B;  5LJB A;  1AB0 A;  4I6S A;  2A8G A;  3UEX A;  3FEP A;  1BSO A;  1QY2 A;  1QWD A;  1TOU A;  2Q2P A;  2I5Z O;  4IMO A;  4MIR A;  5HTD A;  2G79 A;  5D48 A;  1PMP A;  4IB6 A;  1OBQ A;  1HQP A;  1VWQ B;  2RTM A;  4DCB A;  3BRN A;  3CMP A;  3PPT A;  4QGV A;  2GTL N;  2MWH A;  1EAL A;  3WXQ A;  1GX3 A;  4XMC A;  4NLI A;  4I3D A;  4ZR2 A;  1VWH B;  4QAE A;  1VWR B;  1S2P A;  2WPU A;  2A3F X;  4O3X B;  1IKE A;  1AVE A;  4ZHF A;  1SWD A;  2Q39 A;  3D95 A;  4CDE A;  1VYO A;  4ODD A;  1G7N A;  2G7B A;  1YP6 A;  3NAD A;  2LBV A;  3VG5 A;  1SLD B;  4IRW A;  3NX1 A;  3RY2 A;  1VWA B;  4LQZ A;  1LNM A;  4IB9 A;  1EUO A;  4EEJ A;  5AQ6 A;  4U3Q A;  5H9N A;  1KT4 A;  1QFV A;  2QO6 A;  2R56 A;  4BX6 B;  1OSP O;  3FYF A;  3NX2 A;  1IW2 A;  3MX7 A;  1SLE B;  3BU1 A;  3DSZ A;  1RBP A;  1URE A;  4L3R A;  3HOE A;  4NV7 A;  3F9D A;  4KT5 A;  3V8U A;  4I9S A;  2RD7 C;  2LFO A;  4U9C A;  4WBK A;  4YBP A;  1EW3 A;  3AKN A;  4AZQ A;  4YGZ A;  4YFP A;  4NV8 A;  1DC9 A;  4I60 A;  4NW4 A;  1HMS A;  4FGI B;  4YFQ A;  1VWG B;  1I05 A;  1SMP I;  2BT9 A;  3F6Z B;  3PH5 A;  1SWO A;  1DF3 A;  5L8I A;  1OEJ A;  3VE2 A;  2GTL O;  4Z27 A;  2JU3 A;  4IAW A;  1GT3 A;  4WFU A;  1GKA B;  2OF9 A;  3WJD A;  3WVM A;  3KFG A;  4HFO A;  2RTF B;  1PBO A;  5H8T A;  2Y3E A;  3RDQ A;  2A0A A;  2AT3 X;  3VG3 A;  2POA A;  4GGZ A;  1RLB E;  5FQ7 E;  4IBA A;  3O2Y A;  2CBS A;  4GJV A;  1X71 A;  2RTH B;  1QAB E;  1EPA A;  3L4R A;  4QGW A;  1WUB A;  4CV7 A;  1KZX A;  3SLJ A;  4GK9 A;  2RTB B;  4XMD A;  2LBA A;  4QYP A;  4GD9 A;  2FS6 A;  2A5C A;  2IZJ A;  2KW1 A;  4IAB A;  4KII A;  1VWP B;  2GTF X;  4ORS A;  5D45 A;  1JV4 A;  4ON1 A;  2AKQ A;  3S5X A;  1IFB A;  2W2A A;  3EBK A;  3Q34 A;  2MO5 A;  3WJB A;  1BEB A;  1NDJ A;  3Q6L A;  2OVD A;  3U03 A;  4JNJ A;  4QZU A;  1EPB A;  1MUP A;  1VWF B;  1JQP A;  2RTD B;  5IRA A;  1JJJ A;  3JS1 A;  3APX A;  3NBX X;  1ZNL A;  1GT1 A;  2G8C O;  2ACP X;  2HZR A;  3CQN A;  3FR2 A;  1I78 A;  1ERB A;  2FKG A;  2IZD B;  3B2L A;  3RDO A;  3TGA A;  1LF7 A;  1W4T A;  2X4M A;  4XMG A;  4DQ3 A;  3MBT A;  1IKJ A;  4TKH A;  3PP6 A;  2FR2 A;  3WZQ A;  5LJG A;  3RDX A;  2RTJ A;  4GET A;  4ID2 A;  4ML7 B;  3RWX A;  3STM X;  1DZK A;  4RUN A;  3FA8 A;  2JU7 A;  1MM9 A;  4OKA A;  4Z2P A;  1VWO B;  3JQO A;  4CPF A;  3NQ9 A;  4CPH B;  2Q9S A;  1VWC B;  2OL8 O;  1LEL A;  3FEK A;  1SWU A;  4YBU A;  5AEO A;  1LDO A;  4D6A A;  1E02 A;  1JMX A;  1N9M A;  1SY0 A;  1QQS A;  2JOZ A;  2OVE A;  4AYH A;  2NND A;  2IZI A;  4ORX A;  1HBQ A;  2EU7 X;  3FDC A;  3SZH A;  1FEM A;  3OD9 A;  1E2T A;  4A8Z A;  4GE1 A;  1SXX A;  2GH7 A;  2JGS A;  3APU A;  5EZ2 A;  3S5V A;  3D9W A;  3MVF A;  3ZW1 A;  3VG2 A;  4CPE A;  1U18 A;  1FE3 A;  1I4U A;  4ZJ0 A;  2E4J A;  1SWR A;  1NQN A;  2X56 A;  4GU8 A;  4RUU A;  4ZHH A;  5FAZ A;  4YDB A;  2CBR A;  2OL7 A;  2RN4 A;  5DG4 A;  3B2K A;  1SY1 A;  4O3Z A;  2RCQ A;  4AZN A;  4GNW A;  4ZGF A;  5H9K A;  1SRE A;  4QGX A;  3WYQ A;  1MDC A;  1YWD A;  4AZR A;  1ZND A;  4TLJ A;  4OS8 A;  3OJY C;  4CDD A;  2DM5 A;  2NP1 A;  5CYB A;  4NP1 A;  1N9Y A;  4FBR A;  1O8V A;  3RDM A;  4ZHG A;  3SLT A;  3FR4 A;  3GE2 A;  4O4U A;  1DF8 A;  2CM9 A;  2FR3 A;  4KCA A;  2FHN X;  1SWC A;  5JR8 A;  4U46 A;  3I0A A;  5HZ6 A;  1SWK A;  2Z4I A;  3FID A;  2RQ0 A;  2Y32 A;  2ASN X;  1A57 A;  1RSU B;  3I17 A;  5HCD C;  3ZWE A;  5BVQ A;  2RTK A;  2A2G A;  1SRG A;  4QNI A;  2DJG A;  1CBI A;  1OPA A;  4YCH A;  2X8S A;  3P24 A;  2CM4 A;  1AQB A;  1LCW A;  1L6M A;  1QY1 A;  1T0V A;  3BS2 A;  3FEL A;  1MX8 A;  4KC8 A;  5EEE A;  1SA8 A;  2R74 A;  4BX6 A;  3P6E A;  5KHP A;  5LKE A;  1NC9 A;  2BS5 A;  2AMM X;  2FWV A;  5BVS A;  1ICM A;  1Y53 X;  4ORW A;  2IZE B;  5B29 A;  1LCZ A;  1W5R A;  2JW1 A;  3EW1 A;  1BWY A;  3NQK A;  4O9S A;  1NP1 A;  3FA9 A;  4YGG A;  3WOV A;  1STR B;  5LJC A;  1S7D A;  4GUZ A;  4MVE A;  4CPI A;  1QG5 A;  4BX5 B;  1HMT A;  1KL3 A;  2X45 A;  2AH7 X;  4TQ2 A;  1SWL A;  1BM5 A;  1STP A;  4UU3 A;  3TGC A;  3APV A;  4YVB A;  1Y9T A;  3SZJ A;  3WJF A;  3WZN A;  1PM1 X;  3PH6 A;  1GKA A;  4Z2V A;  1I9H A;  3HWE A;  1ML7 A;  2IZA A;  4QQ1 A;  4BGF A;  3P6G A;  4Y0S A;  5B3M O;  1PEE A;  3FMZ A;  1ACD A;  4ALB A;  5B5F A;  2VFB A;  4QZT A;  1PBY A;  4QYN A;  2OY8 A;  4BCS A;  5BVT A;  1VWL B;  3BLG A;  1SLG B;  2F01 A;  3BU9 A;  5K68 A;  3U9P C;  2K62 A;  1KQW A;  5B5G A;  3P6C A;  1ZNE A;  3WBG A;  2JMB A;  4EFG A;  4AZP A;  3K3L A;  4MEE A;  5F7G A;  1RST B;  1HXZ A;  4YGH A;  1JIW I;  2I5V O;  3PDF A;  1OBU A;  1HMR A;  4U8U N;  5F58 A;  1E06 A;  4BBO A;  1GX8 A;  2BC3 A;  2X8F A;  1I06 A;  1SWT A;  1LIB A;  2IZF B;  1SWG A;  5HBS A;  3STK A;  1IIU A;  3VPJ E;  4AZM A;  4HPC A;  4INN A;  5HAE A;  1BRP A;  2A13 A;  1P6P A;  1ZNG A;  2QCB A;  3FA7 A;  4Z2O A;  5BYP A;  4GGT A;  4Y0Q A;  1SWJ A;  5C0N A;  4LZU A;  1R0U A;  4IMN A;  1G74 A;  4NYR A;  4WFV A;  5EDC A;  1CBR A;  4YFR A;  1VPR A;  3P6F A;  1AVD A;  4LZV A;  2OYB O;  4CDF A;  2RTR B;  2W2F A;  3HWD A;  1YWA A;  1ZNK A;  4O49 A;  4CPH A;  1AVG I;  5FFH A;  5HWZ A;  1KOI A;  1VWE B;  2FGS A;  2NNE A;  5CSE A;  1VWD B;  3B2I A;  4TKB A;  4K19 A;  3TZS A;  2KD2 A;  1E00 A;  1LIF A;  4GNY A;  2A5B A;  1MVG A;  4GKC A;  3WJE A;  4Y0P A;  2ALL X;  2ZSC A;  2OY7 A;  1YP7 A;  4EXZ A;  2RTP B;  1GXA A;  1RXK A;  1W6F A;  1Y55 X;  4HWM A;  1JZU A;  1MX7 A;  4U8U O;  1GM6 A;  1SWF A;  3RE5 A;  2K23 A;  2C1Q A;  3EMM A;  3KFI A;  2ZAI A;  5L8O A;  1X8O A;  4KH8 A;  4C5P A;  5HZ8 A;  2MJI A;  1T68 X;  3OBL A;  2GTL M;  1GX9 A;  3D4R A;  3IA8 A;  4Y5D A;  1TOW A;  5JD2 A;  4O4S A;  1KT3 A;  2RTI B;  4TKJ A;  3SLO A;  4FBO A;  5LKF A;  2Q4N A;  3RDU A;  5HA1 A;  3ZW2 A;  2GJ5 A;  4OS0 A;  4HPB A;  1VYF A;  5D4A A;  3PQS A;  5EDB A;  1ICN A;  4ZH6 A;  2G78 A;  2RCT A;  2VFC A;  3CQR A;  2L68 A;  3KFH A;  3NPO A;  4I3B A;  2OZQ A;  4OMW A;  5IO7 A;  4A1Y A;  2IZG B;  3KQ0 A;  4MVK A;  4KC7 A;  2UZ2 A;  1JBH A;  2IZH B;  3IFB A;  1LIE A;  3SZI A;  3TGB A;  3FIQ A;  4I3C A;  5L8N A;  4ZH9 A;  3U0D A;  5H9A A;  1X8P A;  4O3W A;  5F1E A;  1ZRY A;  4OEL A;  3RZY A;  4EKV A;  1YIV A;  2KTD A;  3O22 A;  1FEL A;  2YMS A;  1FTP A;  3APW A;  3EYC A;  1B4M A;  1FDQ A;  3LHN A;  4PSQ A;  1D3S A;  2BHV A;  3NP1 A;  1JYD A;  2N93 A;  1KL4 A;  3QQ2 A;  3FLL A;  1A2D A;  3AUM O;  5H9L A;  3KFF A;  1NBX A;  4YMY A;  3EM0 A;  4IB8 A;  5IO6 A;  5K67 A;  1ZNH A;  4YH0 A;  4IAX A;  4M7M A;  1X8U A;  2OFR X;  1Y0G A;  5LJH A;  1YWC A;  5HA0 A;  1SRI A;  1SWN A;  2WQ9 A;  4GGR A;  3G7X A;  1VWI B;  2AVI A;  3ZUI A;  4PJ2 A;  2P8G A;  3ZUO A;  3UAQ A;  1B8E A;  1BBP A;  4CSB A;  3AKM A;  1HQQ A;  2X46 A;  1EQD A;  1MOY A;  1KXO A;  1LID A;  1XCA A;  2Y3F A;  4N7D A;  1KFF A;  2X55 A;  1X8N A;  2AT8 X;  2Z4H A;  2HNX A;  4ORU A;  3SOT A;  4B55 A;  1O1V A;  3CKG A;  4HPA A;  2HMB A;  3F8A A;  1EIO A;  1EXS A;  2W2B A;  5FQ8 E;  3UEW A;  4AZO A;  5LJK A;  4BVM A;  3EBW A;  4BX5 A;  3ZW0 B;  2IZB A;  1OEE A;  1YWB A;  1YUP A;  3LTW A;  5HCE C;  3B2J A;  3C76 X;  1IFC A;  4GDA A;  2ANS A;  3X00 A;  4I9R A;  1TW4 A;  1VWN B;  2X32 A;  3FEN A;  5FQ6 E;  3ZZV A;  3PEC A;  5HZ5 A;  2AF5 A;  1SRH A;  1MK5 A;  2IZK A;  2C1S A;  1BJ7 A;  2HLV A;  2XKL A;  2F09 A;  2AT0 X;  1NP4 A;  3UEU A;  3WJG A;  1BLR A;  4CK4 A;  3VHM A;  4JGL A;  2RTC B;  1VWJ B;  2RTE B;  3GAQ A;  3T1D A;  4DNE A;  2OFM X;  4Y59 A;  4ZHD A;  2FS7 A;  1N43 A;  5B10 O;  2R73 A;  2WEX A;  4DQ4 A;  4JO6 A;  2FHL A;  5HZQ A;  4GZV A;  2OFB A;  3EC5 A;  5LJE A;  2RTN B;  4EQA C;  1CRB A;  1H91 A;  1FEN A;  1SXW A;  2KTS A;  1KGL A;  3LV4 A;  3HOL A;  1GT4 A;  3NR3 A;  4ZFX A;  1EI5 A;  1RAV A;  4L1N A;  3OE3 A;  1SWQ A;  5IO5 A;  1ALB A;  2YG2 A;  4BQU A;  2RTA A;  2RA6 A;  1EII A;  2BSZ A;  4FQB B;  1D2U A;  1SWS A;  4QRL A;  4TJZ A;  2OFA A;  5IRU A;  3QKG A;  4ORY A;  4XMF A;  1DV9 A;  4Z28 A;  4ZGU A;  1JJX A;  1KT6 A;  1LKE A;  4YKM A;  5HTE A;  3RKG A;  2AL0 X;  5B2A O;  1DFV A;  3RY1 A;  5D47 A;  4COT A;  1KT7 A;  4YKO A;  2MHD A;  3BX7 A;  2JU8 A;  2FLJ A;  5B27 A;  1NQM A;  1NGL A;  1Z24 A;  2ZAG A;  4O3Y A;  1SWE A;  1SWB A;  2L9C A;  2NNQ A;  4OS3 A;  2OL6 O;  3CKF A;  4OMX A;  3VGW A;  1RXH A;  2L67 A;  2M4L A;  1SWP A;  4MIS A;  3RBY A;  2QOS C;  1KL5 A;  3MM0 A;  3FA6 A;  3UEV A;  3WYP A;  2DJF A;  3T2X A;  1UYN X;  1GGL A;  2CZU A;  2QO4 A;  3T6F A;  5DPQ A;  1N4J A;  4Z6J A;  3N91 A;  1TXL A;  2XST A;  4LKP A;  3WZP A;  3CR6 A;  3O19 A;  2BLG A;  1SRF A;  2OY1 O;  1KT5 A;  3PQU A;  4EDE A;  1KZW A;  3FW5 A;  1QFT A;  3HWG A;  4NYQ A;  1Y52 X;  1BSQ A;  2JN3 A;  4YDA A;  1B56 A;  2RTL A;  1IJ8 A;  4FBV A;  2WR6 A;  4ES7 A;  5CE4 A;  1KQX A;  5IXG A;  1K24 A;  3C77 X;  2O62 A;  2WSJ A;  1DZJ A;  4GRJ A;  1G85 A;  1LDQ A;  4A1H A;  1FJ1 E;  2IFB A;  3EW2 A;  3RDS A;  5L3Y A;  1AEL A;  3P6H A;  1B0O A;  4ORR A;  3T6L A;  4ZCB A;  2WEW A;  2HYS A;  1OEK A;  3PK2 A;  1VWM B;  1X89 A;  4NNT A;  2G5L A;  5IRW A;  5EPQ A;  5HCC C;  4YCE A;  3VG4 A;  1DZM A;  4UU2 A;  2BS6 A;  2L5P A;  3HK1 A;  2ACO A;  5AJB A;  5F6B A;  2LB6 A;  2HKD A;  2IZC B;  1CBS A;  1BRQ A;  1TVQ A;  3T2W A;  1CBQ A;  2GC9 A;  1S44 A;  1BSY A;  1U0X A;  3RSW A;  1X8Q A;  1UZ2 X;  3VHH A;  4D6B A;  3ELX A;  2FRS A;  2PI3 O; 
#chains in the Genus database with same CATH homology
 4GDZ A;  1VYG A;  2KT4 B;  4MVI A;  4WHI A;  1XKI A;  2F73 A;  3D97 A;  3CWK A;  2HZQ A;  3P02 A;  3E3C A;  5KID A;  4NNS A;  1GT5 A;  2WQA E;  3ZW0 A;  5K06 A;  1LFO A;  4M6S A;  1SY3 A;  4ALO A;  3JSQ A;  1Y9L A;  4HPD A;  3BDR A;  4U8U M;  3CBC A;  1SXU A;  1SXY A;  3ELZ A;  4N7C A;  3TF6 A;  2CZT A;  1JYJ A;  2FTB A;  1ADL A;  5LJD A;  4A60 A;  3VG7 A;  2WWP A;  4BOE A;  2QMI A;  5D8J A;  1G5W A;  3H3I A;  4I95 A;  2QM9 A;  1ERX A;  1HBP A;  2AT5 X;  4O4X A;  3BX8 A;  2OVA A;  1U17 A;  1LIC A;  4AW8 A;  4Y0R A;  3ZI8 A;  5HZ9 A;  2LA7 A;  1A18 A;  4TNN A;  3FW4 A;  3ZQ3 A;  2FT9 A;  3B2H A;  5EED A;  3S60 A;  3VU1 A;  2A2U A;  5F6Z A;  3FR5 A;  2Q2M A;  3P6D A;  3HTY A;  3SAO A;  1CJ5 A;  1LPJ A;  2X8T A;  3HWF A;  4ARH A;  4XMH A;  5AJC A;  3PED A;  1E5P A;  4GH7 A;  3NQ3 A;  4R0B A;  3KZA A;  3VG6 A;  1OBP A;  5KIC A;  1HN2 A;  1I04 A;  3VE1 A;  2AT6 X;  4LKT A;  3BY0 A;  1DZP A;  5FEN A;  4IB7 A;  3ZW1 B;  2LKK A;  2OVS A;  2WUT A;  1QY0 A;  1N0S A;  1OPB A;  3C78 X;  3S26 A;  2MM3 A;  1A3Y A;  2QO5 A;  3D96 A;  3CBS A;  4MVL A;  4XME A;  4ZHC A;  4O4O A;  1SY2 A;  3DTQ A;  2PY1 A;  3STN A;  3WJC A;  3BSZ E;  1O1U A;  1T8V A;  4NLJ A;  5LJB A;  1AB0 A;  4I6S A;  3UEX A;  3FEP A;  1BSO A;  1QY2 A;  1QWD A;  1TOU A;  2Q2P A;  5HTD A;  4IMO A;  4MIR A;  2G79 A;  5D48 A;  1PMP A;  4IB6 A;  1OBQ A;  1HQP A;  3BRN A;  3CMP A;  3PPT A;  4QGV A;  2GTL N;  2MWH A;  1EAL A;  3WXQ A;  4XMC A;  4NLI A;  4I3D A;  4ZR2 A;  4QAE A;  1S2P A;  2A3F X;  4O3X B;  1IKE A;  4ZHF A;  2Q39 A;  3D95 A;  4ODD A;  1G7N A;  2G7B A;  1YP6 A;  3NAD A;  2LBV A;  3VG5 A;  3NX1 A;  4LQZ A;  1LNM A;  4IB9 A;  1EUO A;  4EEJ A;  5AQ6 A;  4U3Q A;  5H9N A;  1KT4 A;  1QFV A;  2QO6 A;  2R56 A;  3FYF A;  3NX2 A;  1IW2 A;  3MX7 A;  3BU1 A;  4L3R A;  3DSZ A;  1RBP A;  1URE A;  3SOT A;  3HOE A;  3WOV A;  3F9D A;  4KT5 A;  3V8U A;  4I9S A;  2RD7 C;  2LFO A;  4U9C A;  4WBK A;  4YBP A;  1EW3 A;  3AKN A;  4AZQ A;  4YGZ A;  4YFP A;  1DC9 A;  4NW4 A;  1HMS A;  4FGI B;  4YFQ A;  1I05 A;  1SMP I;  2BT9 A;  3F6Z B;  3PH5 A;  1DF3 A;  5L8I A;  1OEJ A;  3VE2 A;  2GTL O;  2JU3 A;  4IAW A;  1GT3 A;  4WFU A;  1GKA B;  3WJD A;  3WVM A;  3KFG A;  4HFO A;  1PBO A;  5H8T A;  3VG3 A;  2A0A A;  2AT3 X;  2POA A;  1RLB E;  5FQ7 E;  4IBA A;  3O2Y A;  2CBS A;  1X71 A;  1QAB E;  1EPA A;  3L4R A;  4QGW A;  4CV7 A;  1KZX A;  4GK9 A;  4XMD A;  2LBA A;  4QYP A;  2FS6 A;  2KW1 A;  4IAB A;  4KII A;  2GTF X;  4ORS A;  5D45 A;  1JV4 A;  4ON1 A;  2AKQ A;  3S5X A;  1IFB A;  2W2A A;  3EBK A;  3WJB A;  2MO5 A;  1BEB A;  3Q6L A;  2OVD A;  3U03 A;  4QZU A;  1EPB A;  1MUP A;  1JJJ A;  3JS1 A;  3APX A;  3NBX X;  1ZNL A;  1GT1 A;  2ACP X;  2HZR A;  3CQN A;  3FR2 A;  3TGA A;  1ERB A;  3B2L A;  1LF7 A;  4XMG A;  4DQ3 A;  3MBT A;  1IKJ A;  4TKH A;  3PP6 A;  2FR2 A;  5LJG A;  4GET A;  4ID2 A;  4ML7 B;  3RWX A;  3STM X;  1DZK A;  4RUN A;  3FA8 A;  2JU7 A;  3JQO A;  3NQ9 A;  2Q9S A;  3FEK A;  4YBU A;  5AEO A;  4D6A A;  1E02 A;  1SY0 A;  2OVE A;  1QQS A;  2JOZ A;  4AYH A;  2NND A;  4ORX A;  1HBQ A;  2EU7 X;  1FEM A;  3OD9 A;  4A8Z A;  4GE1 A;  1SXX A;  3APU A;  5EZ2 A;  3S5V A;  3MVF A;  3ZW1 A;  3VG2 A;  1U18 A;  1FE3 A;  1I4U A;  4ZJ0 A;  2E4J A;  4GU8 A;  4RUU A;  4ZHH A;  5FAZ A;  4YDB A;  2CBR A;  2RN4 A;  5DG4 A;  3B2K A;  1SY1 A;  4O3Z A;  2RCQ A;  4AZN A;  4GNW A;  4ZGF A;  5H9K A;  4QGX A;  1MDC A;  1YWD A;  4AZR A;  1ZND A;  4TLJ A;  4OS8 A;  3OJY C;  2DM5 A;  2NP1 A;  5CYB A;  4NP1 A;  4FBR A;  1O8V A;  4ZHG A;  3FR4 A;  3GE2 A;  4O4U A;  2CM9 A;  2FR3 A;  4KCA A;  5JR8 A;  3I0A A;  5HZ6 A;  2Z4I A;  2RQ0 A;  2ASN X;  1A57 A;  3I17 A;  5HCD C;  3ZWE A;  5BVQ A;  2A2G A;  4QNI A;  1CBI A;  1OPA A;  4YCH A;  2X8S A;  3P24 A;  2CM4 A;  1AQB A;  3BS2 A;  1L6M A;  1QY1 A;  1T0V A;  3FEL A;  4KC8 A;  1MX8 A;  5KHP A;  5EEE A;  1SA8 A;  2R74 A;  5LJK A;  3P6E A;  5LKE A;  2BS5 A;  2FWV A;  2AMM X;  5BVS A;  1ICM A;  4ORW A;  5B29 A;  2JW1 A;  1BWY A;  3NQK A;  4O9S A;  1NP1 A;  3FA9 A;  4YGG A;  5LJC A;  1S7D A;  4MVE A;  1QG5 A;  1HMT A;  1BM5 A;  2X45 A;  2AH7 X;  4TQ2 A;  4UU3 A;  3TGC A;  3APV A;  1Y9T A;  3WJF A;  1PM1 X;  3PH6 A;  1GKA A;  3HWE A;  1ML7 A;  4QQ1 A;  3P6G A;  4Y0S A;  1PEE A;  3FMZ A;  1ACD A;  4ALB A;  4QZT A;  4QYN A;  5BVT A;  3BLG A;  3BU9 A;  3U9P C;  2K62 A;  1KQW A;  3P6C A;  1ZNE A;  3WBG A;  2JMB A;  4EFG A;  4AZP A;  3K3L A;  5F7G A;  4YGH A;  1JIW I;  5F58 A;  4U8U N;  1OBU A;  1HMR A;  1E06 A;  1GX8 A;  2X8F A;  1I06 A;  1LIB A;  5HBS A;  3STK A;  1IIU A;  3VPJ E;  4AZM A;  4HPC A;  4INN A;  5HAE A;  1BRP A;  2A13 A;  1P6P A;  1ZNG A;  3FA7 A;  5C0N A;  5BYP A;  4Y0Q A;  4LZU A;  1R0U A;  4IMN A;  1G74 A;  4NYR A;  4WFV A;  5EDC A;  1CBR A;  4YFR A;  1VPR A;  3P6F A;  4LZV A;  2W2F A;  3HWD A;  1YWA A;  1ZNK A;  4O49 A;  1AVG I;  5FFH A;  5HWZ A;  1KOI A;  2NNE A;  4TKB A;  3TZS A;  3B2I A;  4K19 A;  2KD2 A;  1E00 A;  1LIF A;  4GNY A;  3WJE A;  1MVG A;  4GKC A;  4Y0P A;  2ALL X;  4EXZ A;  1YP7 A;  1GXA A;  1JZU A;  4HWM A;  1MX7 A;  4U8U O;  1GM6 A;  2K23 A;  3EMM A;  3KFI A;  2ZAI A;  5L8O A;  1X8O A;  4KH8 A;  5HZ8 A;  2MJI A;  1T68 X;  3OBL A;  2GTL M;  1GX9 A;  3D4R A;  3IA8 A;  1TOW A;  4O4S A;  1KT3 A;  4TKJ A;  4FBO A;  5LKF A;  2Q4N A;  5HA1 A;  3ZW2 A;  2GJ5 A;  4OS0 A;  4HPB A;  1VYF A;  5D4A A;  3PQS A;  5EDB A;  1ICN A;  4ZH6 A;  2G78 A;  2RCT A;  3CQR A;  2L68 A;  3KFH A;  3NPO A;  4I3B A;  2OZQ A;  4OMW A;  5IO7 A;  4A1Y A;  4MVK A;  3KQ0 A;  1JBH A;  4KC7 A;  3IFB A;  1LIE A;  3TGB A;  3FIQ A;  4I3C A;  5L8N A;  4ZH9 A;  3U0D A;  5H9A A;  1X8P A;  4O3W A;  5F1E A;  1ZRY A;  3RZY A;  1YIV A;  2KTD A;  3O22 A;  1FEL A;  2YMS A;  1FTP A;  3APW A;  3EYC A;  1B4M A;  1FDQ A;  3LHN A;  4PSQ A;  1D3S A;  2BHV A;  3NP1 A;  1JYD A;  2N93 A;  3FLL A;  1A2D A;  5H9L A;  3KFF A;  4YMY A;  3EM0 A;  4IB8 A;  5IO6 A;  1ZNH A;  4YH0 A;  4IAX A;  4M7M A;  1X8U A;  2OFR X;  5LJH A;  1YWC A;  5HA0 A;  2WQ9 A;  3G7X A;  3ZUI A;  4PJ2 A;  2P8G A;  3ZUO A;  3UAQ A;  1B8E A;  1BBP A;  4CSB A;  3AKM A;  2X46 A;  1EQD A;  1KXO A;  1LID A;  1XCA A;  4N7D A;  4ORU A;  2AT8 X;  1X8N A;  2Z4H A;  2HNX A;  1O1V A;  4HPA A;  2HMB A;  3F8A A;  1EIO A;  1EXS A;  2W2B A;  5FQ8 E;  3UEW A;  4AZO A;  4BVM A;  3EBW A;  3ZW0 B;  1OEE A;  1YWB A;  1YUP A;  5HCE C;  3B2J A;  3C76 X;  1IFC A;  2ANS A;  4I9R A;  1TW4 A;  3FEN A;  5FQ6 E;  3ZZV A;  3PEC A;  5HZ5 A;  2HLV A;  1BJ7 A;  2XKL A;  2F09 A;  2AT0 X;  1NP4 A;  3UEU A;  3WJG A;  1BLR A;  4CK4 A;  4JGL A;  3GAQ A;  3T1D A;  2OFM X;  4ZHD A;  2FS7 A;  2R73 A;  2WEX A;  4DQ4 A;  5HZQ A;  4GZV A;  5LJE A;  4EQA C;  1CRB A;  1H91 A;  1FEN A;  1SXW A;  2KTS A;  1KGL A;  3LV4 A;  3HOL A;  1GT4 A;  3NR3 A;  4ZFX A;  1EI5 A;  4L1N A;  3OE3 A;  5IO5 A;  1ALB A;  2YG2 A;  4BQU A;  2RA6 A;  1EII A;  4FQB B;  1D2U A;  4TJZ A;  4QRL A;  3QKG A;  4ORY A;  4XMF A;  1DV9 A;  4ZGU A;  1JJX A;  1KT6 A;  1LKE A;  4YKM A;  5HTE A;  3RKG A;  2AL0 X;  1DFV A;  5D47 A;  4COT A;  1KT7 A;  4YKO A;  2MHD A;  3BX7 A;  2JU8 A;  2FLJ A;  5B27 A;  1NGL A;  1Z24 A;  2ZAG A;  4O3Y A;  2L9C A;  4OS3 A;  2NNQ A;  4OMX A;  2L67 A;  2M4L A;  4MIS A;  3RBY A;  2QOS C;  3FA6 A;  3UEV A;  1GGL A;  2CZU A;  2QO4 A;  5DPQ A;  3N91 A;  1TXL A;  2XST A;  4LKP A;  3CR6 A;  3O19 A;  2BLG A;  3PQU A;  1KT5 A;  4EDE A;  1KZW A;  3FW5 A;  1QFT A;  3HWG A;  4NYQ A;  2JN3 A;  1BSQ A;  4YDA A;  4ES7 A;  1B56 A;  4FBV A;  5CE4 A;  2WR6 A;  1KQX A;  3C77 X;  2O62 A;  2WSJ A;  1DZJ A;  4GRJ A;  1G85 A;  4A1H A;  2IFB A;  1AEL A;  3P6H A;  1B0O A;  4ORR A;  4ZCB A;  2WEW A;  2HYS A;  1OEK A;  1X89 A;  4NNT A;  5EPQ A;  5HCC C;  4YCE A;  3VG4 A;  1DZM A;  4UU2 A;  2BS6 A;  2L5P A;  3HK1 A;  2ACO A;  5AJB A;  5F6B A;  2LB6 A;  1CBS A;  1BRQ A;  1TVQ A;  1CBQ A;  2GC9 A;  1S44 A;  1BSY A;  1U0X A;  3RSW A;  1X8Q A;  1UZ2 X;  4D6B A;  3ELX A;  2FRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...