4GE3A

Schizosaccharomyces pombe dj-1 t114v mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
190
Chain Sequence
MVKVCLFVADGTDEIEFSAPWGIFKRAEIPIDSVYVGENKDRLVKMSRDVEMYANRSYKEIPSADDFAKQYDIAIIPGGGLGAKTLSTTPFVQQVVKEFYKKPNKWIGMIAGVLTAKTSGLPNKQITGHPSVRGQLEEGGYKYLDQPVVLEENLITSQGPGTAMLFGLKLLEQVASKDKYNAVYKSLSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of peptide dipoles and hydrogen bonds on reactive cysteine pK(a) values in fission yeast DJ-1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Unknown function
molecule keywords Uncharacterized protein C22E12.03c
total genus 73
structure length 190
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ge3A00
4I2NA 4B31A 2XF2A 4HCJA 2LXNA 3RHTA 3EWNA 4OQ4A 1VHQA 1GG9A 4L95C 4R7GA 1T3TA 4UOQA 3N7TA 1L9XA 3UK7A 4ZDKA 1O1YA 1Q7RA 1IZZA 3WFZA 4GE0A 3BHNA 1QF7A 3ER6A 4I4NA 1IPHA 3TTYA 4PXYA 3PQ7A 1KWKA 4ENWA 1PV2A 4QYTA 4ZDIA 1PE0A 1SOAA 1C3OB 1PDVA 4MTCA 5SYAA 4GE3A 3TTXA 2A9VA 1CF9A 2RK6A 1OI4A 4AUEA 1I1QB 3PQ3A 3UGJA 3L3BA 4ADSG 2VXOA 2VRNA 4ZDJA 4OFWA 1GPMA 4LGYA 1N57A 1IZYA 4K2HA 3PQ2A 4XLLA 3R76A 3ZJ5A 1C30B 1GPWB 4UZSA 1KXJA 1OX4A 4LRUA 4AJ9A 4RKYA 4AUNA 1U9CA 3L4EA 4ENRA 2AB0A 4BFLA 2ISSD 3ZJ4A 3FIJA 4ENQA 4RKWA 3SF8B 3VU3A 2FEXA 3BWEA 5SY9A 4L8YA 3P9QA 4ZGGA 4MNTA 3SOZA 4I46A 4P36A 4AULA 1I7SB 1GGJA 1P5FA 2R1VA 1T0BA 3R75A 3MIIA 3FSEA 4OGGA 3TTWA 4UOZA 1KEEB 2ZUUA 2H2WA 3GRAA 3OT1A 4Y1FA 4B7AA 1OX6A 1OX4B 4OGFA 3UMMA 1I7QB 2V4UA 1UCFA 2R1TA 4L8WB 3EJ6A 4Y0NA 5JZOA 1QWSA 2GK3A 4Y1EA 2W7TA 1VCMA 2GHRA 3TTTA 1JDBC 3CZ9A 1OY1A 1A9XB 3CZAA 2RK4A 1CE8B 4P5PA 1GGFA 2VDJA 3PQ5A 4P2GA 4OJYA 1VCOA 5IP5A 3TTSA 3L18A 4D1YA 2ZUVA 1FYEA 2ZUSA 1ONSA 4QYXA 5SY4A 2WJZB 1SY7A 1QVZA 3B38A 2RK3A 2VKTA 4L7QA 3TQIA 4WXYB 1BXRB 1P80A 1VCNA 3EZGA 1KWGA 3OT1B 4N0MA 2D7JA 3R74A 3F5DA 3CYFA 2NV2B 1P81A 2YWDA 3P9RA 3NOQA 3EFEA 1S1MA 2R1VB 1K9VF 1Q2UA 3M3PA 2YWBA 2AD5A 1KA9H 4L78A 4UNIA 1M6VB 4L8FA 2R1UA 1GGKA 3MGKA 3CY6A 3P9PA 5DFAA 1QVWA 1J42A 1QVVA 1P7YA 2NV0A 2R1TB 2YWCA 3NONA 4P35A 5E9AA 3UOWA 4AUMA 4BTEA 1CS0B 2OR3A 3NOVA 4Y1RB 3TTVA 4ENPA 5K4AA 5SY6A 4MGHA 4N12A 1GGEA 4OIFA 4B5KA 4ENUA 2VPIA 4JQSA 2ABWA 3NVAA 4B2YA 4BIMA 3KKLA 1PDWA 4B40A 4ENTA 1FY2A 3CNEA 1G2IA 3D54D 4GUDA 4Y1RA 2YWJA 3TTUA 3NORA 3SF8A 4E08A 1P7ZA 4Y1GA 3NOOA 3B36A 4E5VA 1GGHA 5BV2P 4P34A 4WINA 4S0ZA 4ENVA 5LIRA 3ZR4B 2ZUWA 3UJNA 3PQ6A 1JVNA 2ZUTA 5JZMA 1OX5A 3F71A 3L7NA 4UCFA 3EN0A 3P9SA 1T36B 2IUFA 3PQ4A 3PQ8A 1R9GA 1WL8A 3B3AA 1QDLB 4ENSA
chains in the Genus database with same CATH superfamily
2D1FA 3UANA 1JAYA 1M2NA 3FF1A 5ALNA 1TADA 2QAGA 2QVCA 3DDOA 4OQ4A 5HILA 1T35A 4BWYA 4YV2A 1N2CE 4Q47A 4F0JA 3AM5A 1KFEB 1XQYA 3RAEC 1AQLA 5BSFA 2B4RO 1KQ3A 3C3WA 4MW6A 2IQ5A 1HE4A 1C3OB 1J8VA 3M2TA 2ORVA 4XPIA 3CVVA 1PHRA 1C0KA 2SECE 1WDWB 4CG1A 1RC8A 2IBTA 4LCJA 3TAXA 3GDGA 4GLOA 5B7QA 4QBFA 1MDFA 4BMZA 2JASA 3I9V6 3ADOA 2FSIA 1XL0A 3N6VA 4R1SA 4W5HA 5BOVA 2XVAA 1HA3A 4RSHA 3S2UA 3SFVA 1PJ4A 4KYUA 2QX6A 2W42A 1WMEA 1YKFA 3JD1A 3HB0A 1JHXA 3QJGA 5G3YA 4X1KA 4P7GA 1YI1A 3RUFA 2HZBA 4GKAA 4LKOA 2QW8A 3KDSE 1WOMA 3A3PA 4FJ2A 5CEFA 1U1IA 4PG4A 1HBJA 4ZGGA 2ZYVX 1RXCA 3D6HA 1UP4A 3H0KA 1UXKA 2ZB8A 2FFQA 1OIXA 2QYHA 4GGOA 2VF8A 3RHZA 1LS1A 4ZOAA 2QT1A 1JR2A 3R6LA 4N39A 5J4VA 1HOXA 3GNLA 5JRDS 1JR3E 3D81A 3EWIA 1DAEA 2Q9CA 4KZKA 5D1NA 1GL7A 1ZD9A 3KKMA 3L0DA 2OORA 3ONVA 4I1YA 3QKTA 3OZTA 2J4CA 4OXQA 3RAJA 1YR6A 1ZCAA 1TU3A 2R8YA 3BH7A 3RUDA 4D02A 2K7ZA 4IF4A 3C5WP 4G8CA 5DU2A 4QBGB 1ESZA 2MT9A 2W4QA 3GNTA 2QSUA 4P9NA 3ZZ0A 2BJWA 4YXFA 3AVXA 4H31A 1SXJC 4EQ6A 3O8LA 2JJ2D 1NBOA 1KKMA 1QIMA 2ODTX 3QPAA 1OKKD 3K1ZA 3ANMA 4FQ8A 2WHYA 4RSGA 3U4MA 3D3WA 3N58A 4R3NA 1WMFA 4MRMB 5TEVA 1Q6ZA 3ECAA 1JT9A 3HCCA 2I8CA 3DWFA 1JIVA 2A9JA 2GYWA 1GEEA 3VR6D 2XUOA 4R71A 3IPLA 3EFOB 2VOEA 3BA1A 5CB4F 4RK4A 4X92A 4RTJA 2C7BA 4TM7A 1NAIA 3U3RA 1Y9EA 1X87A 1E3JA 4P6VF 3GLFA 2PSJA 4N7JA 2HRZA 3NP9A 2IITA 4IJ5A 4LWZA 4BY9E 4BO6A 1E9VA 5A7FA 5FWXB 5CGQB 4F5WA 1X39A 1MKYA 5AQ1A 3TRJA 2GEDA 4JT8A 1DZ3A 1TM7E 2JCYA 5BYBA 1C7ZA 2FZKA 3B9QA 3DFFA 1YQ9A 3M7IA 3RK0A 2AGVA 1ORTA 3SOPA 4N82A 2V7WA 5I9BA 2EKDA 3L6DA 3W1VA 3SVLA 3GX1A 1T13A 3V8RA 1BJKA 4JGBA 3WLMA 3M5PA 2EFEB 4L4ZA 4N8SA 1RVDA 1SEPA 2Y27A 2Y71A 3H65A 1H9BA 3Q2KA 2AOXA 3Q3VA 3TLGB 1G18A 2GEVA 1GARA 3DMHA 4IMJB 2JRCA 1PNTA 3E0QA 1LBTA 1M7GA 1NDHA 5CNMA 4H3VA 4FJ1A 1WCV1 2B30A 3DOFA 4Q9IA 2B1GA 2PZJA 2D13A 3S3TA 1IATA 2XYQA 1XSEA 2GKSA 4DRZA 5CVTA 2V9PA 2OILA 4I3GA 5EWMA 2NSHA 4NABA 1RKBA 1S2IA 3KU4A 4M8LA 3ANXA 2GM9A 1JSCA 4ZDIA 5I7RA 1XJCA 2NZ2A 5IFKA 4BNLA 1ESEA 3UV6A 4CR7A 4J3JA 4GX0A 2YJ6A 1DNPA 3U40A 3IV7A 1GITA 4MUKA 2FP4A 4IDEA 3VOTA 4ZC1A 2C8VA 3BKXA 2B61A 1KGSA 1SHKA 5TDHA 2ENWA 4KN8A 4XCXA 2QKYA 2OYRA 4B34A 5HKKD 3ZUGA 3EW9A 2JLYA 5BSWA 1WDTA 4YUYA 3MRSA 4BKMA 1JJAA 2JHGA 3D4PA 3SYTA 3ZNPA 3FKQA 4KHZA 3E1GA 3QNUA 1TRKA 4ZQBA 3S1AA 2EJUA 4FZVA 1DOAA 3ZDDA 5IW8A 1EB9A 4TTSA 3N07A 3TIFA 3VMMA 4I3FA 1ZR2A 3NMUF 3IILA 4B84A 4Z4FA 2JFWA 3F9IA 2MSNA 3SG0A 4UNRA 3DE6X 4AMUA 1K7YA 3LJKA 4ZEWA 2JLSA 1PT8A 4OGFA 4PNEA 1OZAA 4EM6A 3HCBA 1TGVA 4OYYA 2BEJA 3ELYA 3CGGA 4Y0NA 1GPKA 2Y93A 5AKKA 4RPGA 5LOVB 1X9GA 5FJJA 1YZ3A 1QHIA 3GC6A 5KYUB 3FKSA 2FZLA 1X8KA 3JWIA 4BE9A 2HR1A 4DEVA 1U4SA 1E89A 2MU1A 2X76A 3JRWA 3WRYA 2CNBA 2P62A 4B6QA 2H4HA 4G0NA 4IYJA 3U0BA 1NUAA 1Z73A 4I08A 3L7CA 2GJ4A 4UBIA 4RHYA 3ZY5A 1OWMA 3BIXA 1OYVA 3Q8WA 1BE6A 2TMKA 4BN4A 3RVLA 3HNRA 1COWD 2G9RA 4CI0B 5CT5A 2YWDA 1I2ZA 2BSQA 3B6ZA 2XNCA 1TCAA 5G0TA 3GLTA 1JLRA 4GSYA 3F8SA 4LK2A 4DYDA 1KOFA 4F3CA 1PNQA 4UCWA 1T5DX 4XIYA 1A72A 3G2NA 5E9AA 2I6UA 1S1CA 2JAXA 2XOKD 2FFAA 5BN3B 1Z7WA 3PG5A 2CLOB 1A7JA 1EFAA 1P45A 1JYEA 1JL3A 3AJ8A 3P4UA 4Z53A 4HNHA 3F9CA 1A2KC 2CLIB 2LV8A 2IODA 2FDCA 1A77A 1T2NA 3CJQA 2HA4A 3WJAA 3I9FA 1GTZA 3R6TA 4CKEA 2G17A 3I2IA 1E8NA 3QVMA 2IHUA 1V8DA 2QP4A 5GONA 4M1OA 1A27A 1M3SA 2G0NA 5KOHB 4F3NA 3Q5GA 4G9BA 5JZSA 5BSUA 3T7EA 4M38A 1TL7C 1WKCA 1YIDA 2OHXA 2Y4OA 1DKMA 5DGHA 1YTUA 1C50A 1NRIA 3JR3A 1PT9A 2QE7D 1XU4A 3D0OA 3T5CA 3DE5X 2P1ZA 1SVNA 5I48A 4M9CA 4UE3S 5JCPA 4L02A 4NRDA 1DDIA 4YR9A 5HUQA 3RHTA 4TKLA 1NUQA 4NDZA 1K8YB 5HP4A 1JKIA 2QVXX 1ICIA 2WUDA 2QTCA 2YS6A 4LDRA 3S1AB 2PKXA 1CDOA 3TLKA 4GPBA 2PL1A 1XEXB 4AL4A 4PZAA 5AHOA 4W1SA 5HWSA 5KNBH 3QX3A 2VAWA 2KE5A 4CLEA 1R00A 2ZDGA 1I1QB 3REGA 5LU8A 4JWTA 1OWOA 2JLRA 2YY7A 5KTYA 3I0ZA 2N47A 1SIWA 5TV2A 1G8MA 2HYDA 3D0KA 3WE7A 4FGUA 3PQFA 2F90A 5BP7A 1RI4A 3HA5A 4KYIB 1Z2AA 3G0HA 4V03A 3AI3A 4AJKA 4RKWA 7GPBA 5CDFE 3HZHA 4MA5A 5EWJA 3AL2A 4YRAA 3WNBA 4HL6A 5AUNB 2DVMA 2FPKA 1F48A 3VHRA 4U5QA 1KEKA 4DCPA 5K6AC 4IWYA 5AXCA 5KAPA 4D9BA 2GZSA 4ZVNA 5LWHA 2E48A 3QKWA 5CR9A 4Z3DA 5DYGA 1P5RA 2YBDA 5DHSA 3WA7A 3SZRA 1MJHA 2O0KA 1H8HA 2NQ2C 3MYRA 3OM8A 4IRMA 4C14A 2IU3A 1RJEA 2EZ8A 2QV0A 2YKGA 5IHXA 5TPWB 4BB9A 1Q1QA 1LDBA 4ETNA 1M8KA 2ILVA 3AUXA 3GUVA 3GU3A 3IPCA 5AVXA 2V7PA 4HXEB 3G0IA 2Y1EA 2HMAA 4NBSA 4DUYB 3AL0C 3BWYA 3Q6IA 5IAAA 1XMOB 3BIOA 3CRZA 4HX9A 5EJGA 2PUGA 1K8ZB 2RAFA 4ESEA 3MWEB 5LYYA 4TN5A 3AKDA 5AM0A 3UHFA 3MGBA 1D2RA 1IZ8A 1XK6A 3OOYA 3V8NA 2RGBA 4GI2A 5DYYA 1FXWA 4DDMA 4F4IA 2XUKA 2A0XA 1X1AA 1THMA 3CJTA 1GTSA 4DQLA 3GCDA 5COBA 1UK7A 2QRMA 2OC9A 4JB8A 1BQ3A 2COEA 3HJTA 1Y98A 4TQAA 4F7DA 5I51A 2DWUA 3BJEA 3VUFA 4AX8A 5GINE 4CKBA 1TLFA 1KDYA 4Z49A 3MWFA 2RGNA 1ZIOA 3D7SA 1XELA 1P61B 3UWPA 1JZQA 5CXQA 4G37A 1YB2A 1RW4A 4ND2A 4GLBA 2NTNA 3JQGA 4LYHA 2L18A 4LMRA 4OKNA 2JD2A 4TN1A 3IE1A 2HYIC 4MQEA 4BB5A 2C54A 1VB5A 4Z86A 4UU8A 3HJRA 1SHUX 4UVIA 5JSHA 1CJVC 4K6FA 3FWZA 1GG8A 4BNHA 1OZ0A 2W8ZA 4NBRA 5G0VA 1T2EA 3BQ9A 3LOPA 1ZIDA 1ZM4A 1CD5A 2XNHA 2XTMA 3OM9A 2PEZA 2VTVA 3QXXA 3KD3A 5AM5A 4BVAA 3VA7A 4MHTA 2CB9A 2ZFUA 4QEDA 5DXJA 4COKA 5CDUA 2WT9A 1ULAA 4M7OA 4CLRB 2P2ZA 2RGWA 4C9BA 4D6XA 1FZTA 1EGVB 1D0IA 4WDQA 3RDPA 2BJHA 2J3LA 2PU7A 2R4QA 4YASA 1K4YA 4YI5A 1B23P 3DTYA 4S2EA 4UCFA 2IV2X 3U44B 4ZEMA 3MCZA 4QC2A 5JD4A 4QJIA 4JI1B 1XZEA 1O77A 3DYBA 3VC1A 3UMCA 2WM3A 1PQPA 3OEWA 5FKJA 1RBMA 2HX1A 3RSQA 3Q3IA 4KQ6A 3LT4A 4NP6A 4PGGA 3RIGA 2JIZD 2A92A 3EXEB 4JU8A 1ST3A 5EZYB 1G7SA 1X7HA 3Q3GE 4JUAA 2ZJ6A 3AWIA 3Q0TA 4PXYA 2WAYA 2F1KA 4YMVA 2C5FA 5CTJA 2XNSA 1U3VA 3ADKA 1RWVA 5EIHA 3WRXC 5CD1A 2GJSA 4KR7A 3MOGA 5CJJA 2H92A 4D3XA 1C30B 3HKDA 3NETA 4XLTA 2NAFA 2QAGB 3O3MB 4R1UA 1ZH0A 2EJTA 2GBGA 3COVA 5DSTA 4AUNA 4E6EA 1UJNA 3T1TA 2V1XA 5A1JA 5AM1A 4DEYA 2Z6AA 2GETA 2HMUA 1Y81A 2EC5A 1KI9A 4NOLA 5T4BA 3FGPA 2BKAA 4LBWA 5FR2A 2YVLA 4YQEA 3RRNA 3DKKA 3STXA 3T7JA 5DM60 2RGCA 5SV2A 2ZWAA 2EYUA 3DDNA 3F2IA 3EDMA 1QP8A 2EQ5A 2C0PA 1E1NA 4JAVC 4Q34A 2WMYA 4V0RA 1MHTA 5MHTA 3HK2A 1EWQA 2OFOA 2KS6A 2IYYA 4J2OA 4WA8A 4G0UA 2FVYA 2GFIA 3IP3A 1X14A 3OOEA 4TMFA 2FJPA 2KB0A 4JLUA 4RE5A 3M0EA 2OZPA 2WM9B 3TR0A 4OX9B 3DUWA 4NZZA 1VLMA 3OIDA 4E4YA 2WJVA 1KQFA 2L19A 1JQKA 3AO0B 4NULA 3AUUA 1L3CA 2F3PA 2ZRNA 3KFXA 3PLRA 1OA1A 2VHXA 1X0XA 1FYVA 3TI7A 1XEXA 1IY8A 1GZHB 4IXTA 3WOHA 1S3SA 5TT0A 1TQ4A 2ZUVA 3IAFA 3T5PA 1QLWA 1SQGA 3BF7A 1EX6A 3EDOA 2BGTA 1COWA 4K2AA 4ZV4A 2C8LA 3KLMX 1LLCA 1Q1NA 2IYNA 2Z1NA 3UKJA 2H1SA 1YDGA 1LFDB 2M1ZA 1LLQA 2WTEA 1J8FA 1OZGA 1ZIPA 2EX0A 3MT7A 4DLTA 5FBZA 3MT9A 1TVEA 2P2SA 1BGVA 1UWVA 1F2VA 2PUHA 3IFSA 2CFSA 3LH5A 3LKZA 2Z5LA 4HDKA 3FPGA 4EAQA 3WICA 5C8DA 1QRRA 1MCZA 1SHLA 3AR9A 3DT6A 3T34A 4GPTA 5B6IA 4J4HA 1SZPA 4HXFB 1FUEA 3TEFA 4B3XA 4KQWA 2XT9A 2OFFA 3CSSA 3L05A 2EGGA 1V5EA 3CSDA 1CS0B 1JKXA 3KDAA 1V1RA 3USES 1S6YA 4BO2A 3RRFA 1NNLA 1Z5UA 4YP1A 2J3JA 4F5YA 3NBQA 1R4ZA 4C3UA 5IXJA 3B3QA 4I9UA 3BL5A 1A97A 1JR3D 1P4JA 3EGIA 2NO4A 3GJZA 3IGFA 1NIPA 3MILA 2EVWX 1LRJA 1C1XB 2W58A 4UBLA 2QN2A 2XUQA 3GY0A 2VH5R 1F2TA 2XUDA 4MI9A 3VTKA 5KZMB 3BE6A 1JFSA 1BDJA 3T0GA 4OUDA 2GYYA 3DM5A 3VR4A 4NNOA 1E4EB 1PFGA 2KPOA 1NXVA 5FA6A 3OLZA 4E12A 1MX3A 4MLZA 1P3Y1 5JNLA 3QMVA 5DLQC 1EESA 2QJRA 1JH8A 1Z26A 1OILA 1JIQA 2FZ4A 4CTKA 4DDVA 1YVDA 3E7XA 1OLXB 3TM4A 1CBUA 4EF4A 1P62B 3GUYA 5JAIA 4HEA1 4EBFA 3JYHA 1IHOA 1UDWA 4NH4A 1NW4A 4H3SA 3ZCRA 3IBCA 2WJJA 2ATCA 2ZZMA 5IMBA 2HCFA 3OU6A 4AULA 1QTRA 4ZDKA 3U44A 1FTWA 4EMSA 1GVNB 3RSHA 1DO2A 2Q5EA 2YOGA 1PWEA 4HTFB 2VWGA 2BTOA 1IWOA 4FC6A 3E05A 3UGKA 1ZHFA 3GVXA 1UM8A 5M34A 2UUCB 3ILSA 1MB2A 5KKCA 2BW0A 2ECPA 1A95A 2GWRA 4E5PA 4IQ8A 1E2BA 3L9XA 2E4XA 3RI3A 4Q3LA 2OLJA 3HMQA 4UEKA 4CDMA 1ULBA 2FLVA 3WDKA 3CIOA 3VO2A 5ALQA 1UJ4A 2XHZA 3C7TA 1D4ZA 5IH3A 1GUDA 4XRRA 1Y5MA 5F51A 1DHRA 1EVZA 2LZ0A 3JYOA 3LUPA 4F9GA 5FLXA 1ZOOA 4PLWA 4EPXA 4QG7A 4CTNA 3EYAA 3MUFA 5CFNA 1PK8A 1EGHA 2NXJA 2NWQA 1WXWA 5K3FB 4QU9A 1CP2A 4UHKA 2ZT5A 2C9MA 1FJHA 2IP2A 1J5EB 4Y18A 5GY7A 3QLEA 5EPUA 3KX2A 4N6NA 3AXTA 1DQYA 1FVOA 1I5EA 1T0UA 5EC8A 5HS6A 1A8UA 2VCEA 5AOVA 4ZODA 1XLTC 3ZYZA 4AP9A 3CX7A 4TWRA 2QPOA 3C3BA 3D5QA 5T4EA 4EQZA 1WNFA 5LCXA 5ALSA 4NX2A 4YRJA 4X7RA 3W1EA 3RSCA 2W6NA 2QNBA 3PNMA 4KYVA 5EZQA 5K3FA 3B78A 3DGFC 4CQJA 5JHHB 2V7BA 3HXLA 3CE6A 3TSYA 3NAGA 4KOAA 1CYDA 4WNAB 4MULA 2QS9A 1ANKA 4HX5A 5DHUA 4Y6GB 4NU5A 4GKJB 4G4SO 4YTEA 3DAOA 3L18A 3OTWA 3S40A 3TTSA 3JQRA 1U5CA 3ZGOA 1GNLA 4U7PB 3QUAA 4MI3A 3N0TA 5KNDA 4TQUS 1RRCA 2ACEA 3D6NB 4RVDA 4Q4CA 1SOVA 3OCUA 3CKKA 1BMTA 2GHTA 3ZEAA 4UTPA 2G1AA 2ZRPA 2VJQA 3SLKA 4GIBA 4FR2A 4GI1A 5FPTA 1MNAA 2JFPA 3ABZA 4IJMA 4J2HA 1LDYA 4NE9A 1AMNA 1B26A 1GL3A 3ZKWA 2NUAA 4IDDA 3H4TA 2Q29A 3GPIA 3FOFC 4GZ3A 2VHUA 1JLSA 2X0JA 1VYVA 2XYVA 4AI6A 3M4XA 4GQAA 3RIXA 1I2DA 2CK3A 2B2CA 1A9SA 4RF2A 1BJRE 1L4BA 1W8DA 2GZMA 4Z6KA 4L0DA 4KREA 2FOXA 5IH7A 4XW2A 2H4WA 2REBA 3M6XA 3OQOA 2XYHA 2PEYA 3O2NA 3C15C 3AHGA 5DP2A 4X41A 2Q7XA 2ZR7A 2PIAA 3C8UA 1CIPA 1OLUA 4WY2A 4CV2A 1JDSA 1T8YA 3W5UA 2ZCVA 1VL2A 2ZCJA 1R6BX 2P6MA 3ORQA 3DT8A 2PZKA 1VIAA 1R8JA 3NAQA 3OZBA 3O9VA 1WULS 2C58A 4XQ0A 2DRIA 1T0HB 5ESRA 4B87A 3ICQB 4FHDA 5HW0A 4Y6OA 3EVBA 3ENKA 4NYJQ 1E4VA 2QNRA 1CK4A 2HIGA 3LL7A 1L5GB 4AW9A 5CLHA 2ZI3A 4EMUA 4YJ2B 2OGTA 2AC4A 3N9IA 1E59A 2XTAA 4GEKA 2G6TA 1I7SB 2FP4B 5K0BA 5K9ZA 3AKZA 2C83A 221PA 3GP3A 4NY1A 1CSEE 4P54A 1A0OA 3GGGA 1CHDA 4KXFB 3W5IA 2WIJA 3TE7A 3G9ZA 2I8LA 2C04A 2GAIA 3FOBA 1T3HA 4WKGA 1U8EA 1SOMA 4K9KA 2C97A 2EBUA 3QVVA 2OPHA 1X1RA 1IUKA 2A59A 5BSGA 5GJBA 3ZJ5A 2O3QA 4JVMA 4HH0A 2IYRA 3B2QA 2WUWE 4LTDA 4LYJA 1VHJA 2DFLA 3DSRA 2AN4A 1B74A 3BTVA 1ONBA 1E3WB 3G17A 3K8OE 3LLVA 5D2CA 1NY5A 3QFFA 2GPTA 1LZKA 2VJDA 4MVWA 1SPXA 4PRYA 4FYMA 2CCJA 3L8GA 1KAQA 2EG5A 2VT6A 4FTWA 5CLIA 5M5BA 4JT9A 3FTFA 4JQCA 1JG6A 2PSDA 1O8CA 5JHGB 2DH5A 4RJIA 1PG0A 4R6WA 4TYMA 5EKUA 3T5GA 1HYGA 3GJ5A 2GNPA 5IARA 4HDSB 3A06A 1XVTA 4FFNA 4KGXA 1MW9X 1ECFA 2OV8A 3U3XA 3ZOZA 3KEFA 2WB2A 4TKUA 1P9NA 1PEKE 2QX8A 1QC5A 4MUYA 2C9CA 1UXIA 4UAVA 1VL1A 4RM3A 2FHSA 4ETMA 2FKNA 1BA3A 2VZLA 4BP3A 1VBMA 4NFHA 1MAHA 3FVTA 3NWBA 2YVAA 2HDOA 1AN0A 2FRDA 3ACCA 2DHDA 4TMXA 4D0RA 5SY4A 1G2PA 1T4BA 1CUDA 2JFQA 1KY3A 3F3YA 3JPWA 2V7GA 3H5AA 1XZMA 4WRRA 3PC8A 4OSPA 2AFIA 2PYDA 2OHFA 4YRLA 3V34A 1FDUA 1WWKA 4N0MA 1WVGA 1MLDA 3P19A 3DFIA 4UVEA 1YDHA 3FVQA 3S68A 5CBPB 2NV2B 1KC3A 2XJ9A 1A9XA 3IKTA 3JZIA 1H9AA 2HZ7A 2G5TA 2QENA 2Z6QA 1F14A 4ZV9A 3KKZA 5ALUA 3H1PA 3AUFA 3MGKA 1NLZA 3D4NA 3UB4A 3KZXA 3DDHA 2E0IA 3WJ1A 3K0EA 4I4CA 4CM9D 1EVQA 1P9LA 1RJDA 3WAKA 3M70A 3JVEA 2P1RA 1OV4A 3KPWA 1QS0A 1Z6AA 3IIEA 4KPUA 4UTXA 1NJ8A 5J40A 4D97A 4LQCA 4WVLA 1GTVA 1KQNA 3UMVA 4NS4A 3MRTA 4RK5A 2QN6A 4DLAA 2YW9A 4YJHB 1XCLA 1Q19A 4NCIA 1EYZA 2X9LA 5DTIA 5K0GA 2ZAIA 3VPSA 4EHHA 1B8UA 3K0SA 2AEFA 1P7ZA 3ZGXA 5A7GA 3I32A 4ZCQA 4E5VA 2BMFA 3AVYA 4MPDA 3VR6A 4GSKA 2ZYUX 3PFWO 4D9IA 2A9KA 3FOWA 2F8TA 1NI4A 2ZUTA 4O2BB 5HTOA 4OHYA 3KYDA 3KZVA 4WW0A 3GH1A 4FDLA 1BEZA 3TUJC 1EH5A 5HBRA 3VR5A 4R51A 4BFZA 3WDLA 1SBQA 4U7WA 2C2HA 3RIMA 3RYCB 3FIUA 4XUCA 1T5OA 2PGJA 1GG9A 1RS0A 1RYNA 3W77A 2IU6A 2LWIA 2YV3A 3GRCA 2FY8A 1WSWA 2H57A 2XUPA 3FFWA 4DNXA 5AESA 2IHNA 2W6ZA 1J33A 3HFRA 3FSRA 3DMDA 3PQ7A 3EVNA 1H66A 3F6SA 3TQFA 4JJ6A 2HCBA 3EDRA 5HJ7A 4C1NA 5BR7A 4EDHA 5JAPA 4D9KA 5CU7A 4IV8A 4ZOLB 2QAGC 4EB0A 5JS7A 3TL6A 2R6CA 4JASB 3VC7A 1CJKC 1Z18A 1M1YB 2J8ZA 1FQWA 2OCBA 3B9RA 1GQOA 2Z0MA 1WMBA 1WPGA 4BNKA 4ZGBA 5CCXA 1YBAA 5A4IS 3W4KA 3RVDA 4J9UE 3AUSA 3PLAE 3EGCA 1L7OA 2ZBEA 2OV4A 1CQIA 3NFYA 5A4AA 4MYRA 3HBNA 1GILA 1YZVA 3ZK8A 2NZXA 4ZARA 4EBBA 3F4KA 5BOSB 1CDEA 1QH8A 3DW1X 2BC9A 5I7OA 2FVXA 2HA5A 3RAFC 3MUNA 5ED0A 2WU3A 4OGGA 1X7WA 3SKXA 5J1TB 1FP4A 3P2KA 1SCKA 4QU0A 3HY4A 3NRJA 2F62A 2KX7A 1W5EA 1E6MA 2PFKA 2HSGA 3B6IA 3W8NA 5BV7A 4LCBA 4AJ2A 6AT1A 2FZGA 1ISIA 1U1GA 3G8AA 2JKYA 4PYRA 1EUYA 1J20A 2GM3A 3T9BA 2PUCA 2J1LA 2OAQ1 3I5MA 4R9SA 2A8YA 2E6UX 3CV3A 5H3LA 2OXTA 4XYLA 4EVRA 3MWKA 5H1YA 4PSKA 2HWXA 4QUGA 1DAIA 3HBMA 1WB6A 4XRGA 4R1LA 1MB9A 5JNSA 4ZI5A 2KJQA 3NS7A 3C5EA 2JAPA 3PQEA 3EUAA 3VJMA 4MQ6A 3AY7A 1TT7A 5C52B 4ZPXA 1SBNE 3IB3A 1DWOA 4OMUA 4Y0VA 4X85A 3Q41A 1XDGA 1N0WA 2NT3A 4HZGA 2Q0XA 4A0RA 1J0XO 3M9XA 4JBYA 1UKEA 5K3OA 2VJNA 3VVCA 3BX1A 1NW6A 4KBGA 3SJZA 3C6QA 2JLWA 3QNWA 1IN4A 1PWXA 1EZZA 3H5NA 3H99A 4GVLA 4JR0A 3HFJA 4R9VA 1W59A 3D3KA 2GKOA 3BBPA 3DTVB 4BQPA 4HB2A 4BRZA 4NENB 5ENZA 1NT2A 2QHXA 1JR4A 1FNDA 4I1VA 3SDBA 3ZE8A 4FWBA 4CMCA 1RFLA 1J07A 4DC1A 5EZ5A 2GDJA 2AKEA 3ZZUA 4KR6A 4WXPA 3T4EA 2WF8A 4ZP1A 5F2KA 1VE9A 1HR0B 4IDPA 5B6JA 2EF1A 1Y8RB 1ZCJA 2V6JA 3QEOA 4HMPA 4Z7NB 1K86A 1FY2A 1WXEA 3BB4A 4GI7A 3PEEA 4ZT6A 4MLDA 1P0QA 4AJJA 3AB3A 2WWVD 1ZI8A 1RMYA 1IG0A 4M9SA 3I6MA 3DLTA 2BFEB 2DQKA 4DNFA 2ZT6A 4GVPA 1QQTA 2BUCA 3C14C 4EY5A 4P5EA 4QZVA 1S3IA 2GARA 3RHFA 3PC2A 1E9SA 2ZUWA 3DAFA 3GB9A 3MWDB 4B3GA 4HFJA 4ROTA 4DLBA 1L5RA 5L3SB 1RAIA 2VP9A 3PFBA 1T6YA 5GIPE 3N0XA 5F21A 5HZKA 3L4JA 1VIMA 4ENSA 4B31A 2O0JA 4HCJA 3WADA 1FLNA 1Q6YA 2P75A 1T3ZA 3K15A 4L2IA 5CGZA 4ZQCB 3KYDB 2GNOA 2OAP1 1EAYA 2IYXA 3VKUA 2ZAOA 3P52A 3BWBA 4Z9YA 4DEXA 1VYTA 4CODB 1RLIA 4GM1A 1EHYA 1F5NA 2XQJA 4MS4B 5H82A 1P2FA 3KSMA 2OO5C 2X8LA 2DWOA 3AR5A 3HNOA 4Q3CA 4QODA 1JQBA 3CEHA 3VHXB 4UM9B 4ZEOA 4Q48A 4CFYA 1Y9JA 5DNAA 3CONA 4TUYA 4Q3BA 1KVQA 1AKUA 3N0VA 3PTZA 4NIMA 1J7KA 5AK5A 1IK6A 5G3ZA 2XVYA 4FSDA 5IBPA 3L7IA 4DGQA 5IM5A 1R0YA 3CKYA 2O7RA 2GERA 4P0TA 2QTWB 2AFHA 4MV5A 4MYCA 4OK5A 4BGIA 4WN9A 1O0CA 5DLPA 5IT9A 1W581 5CLQA 3GFVA 2OAGA 1EI9A 3HXQA 3W8RA 1QIKA 3I64A 3KZNA 3M6MD 3OM1A 3Q98A 1A2BA 3FZEA 3W4IA 4K0KB 1R18A 2HJRA 2PLWA 3STUA 4GUAA 4MS3B 3SLRA 4MWEA 2HPHA 5HKLA 5C1DA 1ES9A 1Y3DE 2PV7A 2O1EA 3M9WA 1TKRA 3M6UA 4N03A 5FTLA 3UIEA 4NEGA 4EAAA 5JECA 3NHSA 5CH5A 5F76A 2C0CA 4BLTA 1D0VA 3BGOS 1RAHA 5HFJA 4C03A 1N7HA 2VHWA 1QAOA 4DQVA 1NVVQ 3VUEA 3TNYA 2O54A 2HQ1A 5EGNA 1UAAA 3KCNA 4K1XA 1MD9A 4WKPA 2BI8A 3PC6A 4DMFA 1JHUA 1LK0A 4Q1EA 4DR6B 3D3QA 4LNUA 4EYGA 1F60A 1XT6A 2VDJA 2BFWA 2OZVA 3L7BA 1XJQA 2Q1WA 1K3UB 5ALPA 1Z83A 4KO2S 4QDXA 5IP5A 1QDEA 5T4FA 3RYFB 3ROTA 1JWLA 2YQ5A 1QK4A 5EPOA 2NXEA 1W2WB 4AJ4A 2BGGA 2BHTA 5C46F 4Q4HA 4PLCA 4LA4A 2BN4A 4DBZA 4NC9A 2GN6A 2TRSB 4MDHA 3PDIA 5T6BA 3MAGA 4Y2GA 3P97A 4ZYLA 3IV9A 3QEMA 5C8YB 5CHEA 4BLUA 3NC0C 3ULKA 2OBNA 4C7VA 3C43A 3DEJA 1I2CA 4KPGA 5JWOA 2Z4TA 4KDEA 4B46A 1OREA 2WTUA 5EWMB 1KZ9A 5AXBA 1EXVA 3LHFA 5KMGB 3AUAA 1Q7EA 1YXMA 4NLLA 5EUCA 2PZEA 5LQDA 3KB1A 2GLUA 2F9LA 4HX2A 3RSLA 3TL3A 1ZHOA 1QTNA 2WZDA 2FSSA 5GJWC 1N4AA 3WRYC 4ZTBA 1ZCBA 5KWJA 3ZDCA 5C5CA 1XCMA 3GEGA 4DV2B 4FYVA 4PX3A 3MT0A 3FOAA 1NXXA 2HREA 4UEWA 4CMAA 2CV1A 3UHAA 2C94A 2IY7A 4MYDA 4ZIRA 3BG5A 3QMMA 1T3SA 1NBME 2IUYA 3A1SA 4K88A 4ARAA 2EHJA 5BQ3A 3TYXA 1GN9A 2ZSAA 4G0XA 3ZHUA 3RSSA 4CNQA 3V00A 3LFUA 2J32A 5CDTA 4WINA 6YASA 3K3PA 2Q6IA 4I1IA 5TXGA 1NQVA 5KYGA 2XZDA 1DEHA 1FLVA 4WKNA 4DB2A 1GV1A 4I2NA 1C3XA 3PPYA 1D5CA 5LPNA 1WZCA 2FWMX 1U3WA 5JADA 3T95A 3L7KA 5DTEA 5JS8A 3GZ4A 4KL8S 1BX0A 3X44A 4HR7A 3ZLVA 4NEHB 1KOLA 3GDOA 1H2HA 3ITNA 3TAHA 1HFJA 1UOOA 2F7SA 3RU9A 3UC5A 3VU1A 4EUNA 1P2TA 4L2IB 5EXDA 5DBFA 3TKLA 5C53B 2RHOA 3D3EA 2IYLD 3GRPA 2IEAA 4JBXA 5CT4A 2JVIA 1JEQA 5DBHX 1JEYA 3KOZA 2JC3A 1ZXXA 5EA2A 3N2LA 1K63A 3O91A 5K0LA 1QH1B 3CX4A 3PQ2A 4GFDA 1SC6A 3KR1A 4N5LA 4QOSA 4LZOA 3RRJA 3G2QA 3MK31 4AS3A 5JMPA 3AV0B 2JARA 3QTLA 1XVVA 2XNJA 3KTAA 4KJZA 4LNUB 2JDID 3E4CA 3OHPA 3FCCA 3O82A 1E3EA 2AI1A 2X41A 3ONDA 1OWLA 3HDTA 2PMDA 1E9BA 2C9OA 2BHNA 2YWXA 3ROEA 1X8XA 2NYAA 4Z5XA 4QOEA 5CNKA 1KMCA 3KQPA 5LP6C 3SM9A 1WSAA 5JCJA 3UQZA 5IF9A 5TRTA 1Z29A 1LRKA 1MGPA 1YJBA 1SXJB 3OCZA 5IEJA 3TN7A 2QTVA 4R05A 1WDMA 3QF7A 1EWYA 2XX3A 2GEBA 1HQYE 1Q0RA 1E7YA 1GR1A 3ZWVA 1ULSA 1ZBQA 2RAPA 3BMNA 2R5FA 3JASA 3T7RA 1P7VA 5ISMA 3R40A 4CM1A 1L5HA 2NU8A 2Z2YA 5KTSA 1UXJA 4YBRA 1JBEA 1YHZA 2ORWA 4I8DA 4DKJA 4OYRA 1LNSA 4RIEA 4HUTA 4H1TA 4JK3A 5A4FS 1USKA 2IOQA 4O0LA 2I4TA 3JQ9A 4KMOA 2ZIXA 4RJLA 2M1XA 3ZCSA 3EXHA 5CFZA 3VZPA 2CJYA 1WXHA 3OQIA 5CCEA 4YCMA 4AJ1A 2R4TA 2PNFA 3TBFA 1O6CA 3C1UA 2FPLA 3JQAD 1L1FA 1NLYA 1M6HA 3BGIA 1EUDA 4W7IA 3QSYA 2O2XA 1KC1A 1PT6A 3ED5A 2QD1A 4ZJPA 2PZMA 1SA0A 3VHQA 4C88A 4OMCA 4RTSA 2Q3HA 4HC4A 2XCRB 1T8WA 3VPHA 4KRYA 2REXB 3WIOA 1KJZA 3WOVA 4UOEA 2QT0A 1KDZA 2VBFA 4ZD6A 3OF2A 3P26A 5EHXA 2WOJA 3KKNA 4QTZA 2DP4E 3JQ6A 4C78A 2G07A 5E4YA 4AO7A 2DECA 3AEYA 5E3IA 1HLFA 1P44A 3HHEA 4HP8A 4ZCIA 1Z2PX 4PZCA 1SM4A 1BKSB 2D2FA 1I3NA 3G23A 4GXQA 5ALVA 2PK3A 3HKCB 2DGDA 2WFZA 4IH9A 1N1DA 1KZHA 2X5KO 3DZCA 1H4TA 3IT3A 4NSNA 5HK9A 2O8DB 5ALTA 3KU1A 4CCAA 1MC1A 5E2BA 1R5JA 4NE7A 1B4DA 1U0LA 2VLBA 3C1AA 4MX8A 4EG3A 2WUVA 4U2FA 1H0KA 4J4BA 3CPEA 3IKMB 1P6UA 1D6SA 2HQBA 4IIHA 4LC9A 3FUWA 4EKYA 1TVKA 4E5UA 1NBEA 4RF4A 5C1BA 4G97A 1NNSA 3ZY3A 3GFTA 3H8JA 3O7WA 4RCZA 3RRBA 4G6ZA 2EBHX 4BV9A 4LVOA 2Z08A 3VC3A 3OOJA 5AVVA 2DWQA 1MRSA 3MTBA 5G41A 3VKFA 5JAHA 3PC7A 5ESDA 3ZS9A 1NY6A 1BVHA 1C1DA 3AL3A 3HVIA 1TJYA 1ABBA 2ETVA 4CLHA 1N5JA 3CN7A 1Y48E 3O3NB 4RMGA 2CV0A 3LF1A 2R6HA 5DYTA 3EJWA 5HCIA 2UZ0A 2RHTA 4E13A 4HNAA 3LPDA 3ER6A 1TVKB 4GI3A 2UXBB 5B36A 3BAFA 1AUQA 3QLUA 2H1IA 5KU1A 1MHPA 2FPSA 1C0PA 4GYJA 4BOYA 1L4GA 4JT2A 4TWAA 2BVNA 3G9TA 3HKBA 3Q8XB 2HTEA 2A9VA 3EQ8A 1YGPA 1Z5WA 1W4CA 1QG2A 4F1JA 1M72A 2ICAA 4AO6A 5GIOE 1RKQA 1FU8A 4XIGS 3TQQA 2G1KA 1YFZA 4JEIA 1CJUC 1O9BA 3AIIA 3KZ1E 1QGZA 1QYXA 1S4MA 3IV6A 4QM7A 3JY6A 4MYHA 4D8YA 4CIWA 2PTHA 1MW8X 1V25A 3WLOA 1LK5A 1WZUA 3OEHA 4DT1A 1ML3A 5J43A 1SU6A 3KB2A 1C7EA 2FYTA 2VUIB 2EFCB 2WFLA 3CT4A 5ERXA 1M6EX 5CLLA 4XPZA 2I2DA 4OXNA 4DJAA 4DLYA 5KHLB 2O2IA 1N9GB 4KN6A 1YQGA 5EPEA 3EBPA 3DZFA 5LLTA 3B53X 2HNBA 3K4QA 1WMDA 4S1WA 3W79A 3EZFA 4BBAA 3FAKA 4W1QA 3GP5A 3KYBA 2CWDA 1ID1A 1QQ6A 1QYVA 4CG0A 4IWXA 3FPLA 2C2MA 1XQ9A 1JHPA 1P60A 2F64A 3JARB 3AQ4A 5BY2A 1V8PA 1G20B 3C3DA 1UBNA 2FB9A 3E2IA 4RKRA 2H4ZA 3O38A 2B8EA 1A9XB 1RE1A 2C1ZA 2Q5IA 2V8BA 2R97A 3HWWA 3IOEA 2N0SA 1DCMA 4CV3A 2VC2B 4G8BA 2AK2A 2EKQA 3LGSA 5DRYA 1ZD8A 4OAOA 4AXBA 2ZRJA 4EB6A 4KOEC 1ZJZA 4JIGA 1V6CA 1TAUA 3RM3A 5HS4A 2PUAA 4Y2HA 2ZQYA 3IX7A 2GSDA 3AF3A 2VAVA 1GTMA 1QH9A 2H00A 4HDRA 4ARCA 1JHRA 3ZDQA 1V3TA 1I4DD 1LKZA 3DULA 1VDMA 1D7AA 3B8EA 3RJZA 4Y2SA 4GWGA 4CUJA 1GSIA 2A3NA 3R3WA 4TL6A 1HLDA 5JPCA 3KQMA 4R8LA 2VEOA 3BZBA 4TMWA 2WNIA 4LDZA 5CAEB 1B6RA 1DCTA 1LPMA 3HJFA 2Y0PA 3FMVA 1JTVA 4YPOA 4XGNA 5IU6A 3OUUA 2A58A 4KRGA 5DKFA 4G1MB 3SQMA 4A6XA 5KVVA 5LP6B 4EJ0A 2X1LA 3ADDA 1RI3A 3QLTA 3M3HA 1V4BA 1MO5A 3HEBA 1ZHHA 2VWHA 4OJKA 1X9IA 2RCYA 1LS6A 2VYQA 4PGMA 2ZRDA 2F48A 1R66A 2IHKA 3R1IA 4EUSA 2ZI6A 2BMEA 2FPXA 4GYYA 4JS0A 4NBLA 1EQ2A 1DIBA 1K6JA 1USWA 2Z5FA 2WIDA 3IUMA 3PIRA 5E3JA 5C5EA 3UHJA 3TLXA 1UT8A 4CM6A 3LY5A 3U7IA 3EQ2A 2YYZA 2DPHA 4FSHA 1EK0A 1N0VC 4M60A 1NYTA 2XQGA 4YJHA 2OWDA 4NHEA 5HZHA 5IASA 1EPUA 1FS5A 3I2HA 2UYCA 1DO0A 1V71A 1Q3KA 3TZCA 4KXLA 3NQ41 3C2QA 3KVNA 1DDGA 2JK0A 2OCIA 2Q4OA 4JLDA 1OFUX 4XUEA 3W2TA 4UE2A 1NASA 4BPRA 4ZMBA 1XEAA 4FGKA 3BCRA 3PVSA 2KW5A 3VSEA 4MWOA 4LHEA 3VSAA 1F9AA 2P35A 4LSMA 5GV7A 3EXG1 4UPEA 5LU9A 1GNPA 1NOKA 4FBMA 1ZW1A 4K6GA 3U81A 1DXQA 1YFKA 1U4NA 3MJTA 4QYTA 2CBGA 3A1DA 3SXJA 3ELBA 3GMTA 4FR5A 3REQB 1MFPA 4MW4A 4YNBA 4L50A 5F12A 1A98A 1OZFA 2CMGA 1E0JA 3UUGA 4QBIA 2P9YA 2F4NA 2B6HA 2P4SA 1NVVR 1J23A 1WW2A 1FMLA 3QX8A 1C9JA 4CM4A 2IPXA 3F67A 4J0EA 1K5GA 5EYPB 2WWGA 5B53A 4GLFA 1JIJA 2ZDHA 4EITA 3QW2A 4S1NA 3E3AA 1HDIA 4RORA 2HK7A 3V80A 1U9JA 4E2ZA 1JA0A 1LA2A 1ORIA 1W96A 2LD4A 1NXQA 2PMBA 1WZEA 3IBFA 3IERA 4ABYA 3R5XA 5EIXA 3QYJA 3WKBA 4KE9A 1KFJB 5IJ9B 3JQ8A 3AJAA 1Y1RA 4YMHA 3CZRA 5E1BA 2OCDA 1TO6A 2H2DA 1H2YA 1GTJ1 4C05A 1XQ6A 3QG1A 2DY0A 4O2BF 1KMHB 2TMYA 4RJKA 5ER6A 4D45A 1H0HA 2C5LA 1PHPA 1OH7A 3PDJA 1IVSA 1RMTA 5K05A 3KO8A 1VLHA 1FK8A 1L5WA 2GF0A 2ZJ4A 1J1IA 1I10A 1PW7A 3DVRX 1DC8A 5AJHA 3PGA1 5AOBA 2PZBA 4RY9A 1KO1A 3OY2A 2O5VA 4OP2A 4LY0A 4EMTA 2VXCA 4RETA 3T0FA 2IY8A 4KAAA 3UBTA 3N2YA 1GAQA 2PL3A 5FQNA 1YL5A 4PX2A 3JQPA 2JNWA 4RFLA 5J4LA 3IUBA 4UU7A 1KDOA 2ZRCA 4IX1A 4JXJA 4ZOLF 3N87A 4RMHA 5FOSA 1VG8A 4DILA 3UJBA 2E7ZA 4ZT7A 5HM8A 3TVTA 4KGZA 5AOCA 3S8YA 1B8OA 4I0WB 4BQSA 1VL5A 4GWLA 3C3JA 1FTNA 4CDNA 1NKVA 3AM1A 3A36A 2GMWA 1YRQA 5CDYA 2A30A 3CNQS 2IL1A 3BGVA 3K0HA 3OX3A 5D3MA 5EEHA 1QGAA 2PKCA 3NTXA 3K9NA 1N5DA 4F21A 3B5JA 2F3QA 1A9QA 1SELA 5CG2A 4UHEA 7MHTA 1Z06A 5EWLB 3OPQA 2VDKB 4EUHA 3NANA 2R5WA 4NBWA 3H16A 1XRPA 4LY3A 5BQOA 4D43A 3H0CA 3HYLA 4JUIA 5IWAB 1XAGA 2VWQA 3AGQA 3F78A 3WTBA 2N46A 1BVUA 4RPIA 2X6RA 4DL9A 3OCYA 2WIKA 4HQ6A 5DTMA 2HO5A 4INAA 3LHDA 5IBRA 4ZKDA 2OOKA 3CBGA 3E5RA 3PNLA 5TMDA 4WBNB 3PFIA 3Q5EA 2Y66A 3O8CA 3B13B 1KAEA 5FXMA 3GAMA 1R3DA 3R9XB 2G82A 1QORA 2IU0A 4CZ2A 5TY0A 5E9QA 1OTXA 3FWHA 4HMOA 4NCXA 1Z8NA 2HN9A 1NL3A 1EE2A 2TECE 1I80A 1LDEA 4JYZA 1X1CA 2MR6A 4JX9A 4ZU1X 3H87A 3LD9A 4UOQA 1FJ2A 2VUHB 4UATA 3DL2A 4HFMA 1IZZA 1R0RE 2OYCA 3NOXA 5KOIA 4M99A 4BNYA 3IESA 4V0ME 2NVOA 4PFJA 2Z95A 1PDVA 2DPXA 2ZVDA 4GNKA 4M1ZA 3EGXA 3WLRA 1KYXA 1GDHA 1UC4B 2FEWB 3NEPX 4KXWA 4NWIA 2K2QB 5F64A 4AUEA 3HI4A 4ADSG 2HHCA 4RTRA 3DLPX 3D1LA 4ZDJA 5CM9C 1OXBB 2ZAYA 4XCVA 3SJBA 3LRPA 4R0NA 2Y2UA 2VPZA 5E4TA 3X1DA 2IEBA 1U2GC 1JSXA 2VNSA 4LRUA 2QSJA 3RWBA 2BBWA 1U9CA 2X1HA 1XPRA 1QV6A 2P4HX 1G6Q1 3IMKA 3LUAA 3VYSB 1TOAA 1WXXA 1MT0A 2IHBA 2ACKA 1EK6A 4KH0A 4L73A 5ALWA 1M0EA 3RR2A 3ZJYA 5IYZB 2DPLA 3ASUA 2QW1A 5D84A 4J0FA 4RK0A 1NN3A 3V4PB 3M81A 2ZRMA 3SM3A 2JI6A 2IZ1A 3SC6A 4RL6A 2G4LA 1T9CA 2HEIA 4HPXB 3OSZA 4G09A 1V39A 5FUBA 4XSVA 5A3VA 2HADA 1KH3A 4TQ9A 2ERYA 4JJAA 2QIOA 3IEPA 3WLJA 1IQ0A 2X4LA 1YQTA 1QLJA 3WGNA 2IUUA 2ZAMA 4A4DA 4RD2A 5G1PA 1W94A 3O94A 5HRUA 1RHQA 2G67A 2I9PA 2GK6A 5EIWA 5T3YA 1W36C 2PUFA 1JU9A 4W5TA 1OVMA 3EQZA 4G41A 4GL2A 2VPWA 4LZWA 1U8TA 4MI6A 4U63A 4DDTA 1A4UA 3EA5A 2FW9A 3TOCA 2BFAA 1PGJA 4HSGA 1T25A 4IQ4A 4KI0A 3WGKA 2KYRA 2CXNA 5EMHA 4RULA 3PEWA 2HLNA 4E1BA 3K1AB 3GBVA 3F6EX 2W00A 1Z0DA 2R1TB 2FI1A 5ABPA 4DMMA 1ZMBA 3WZMA 5B2EA 4LNHA 3KQHA 2FUEA 4ONEA 5U4XA 3K0CA 2RFLA 1UEXC 1WABA 2XDWA 1OH6A 1MGOA 4LJ7A 3EE6A 1YE8A 2BP7B 4PZUA 5CXSA 3R3XA 1WRBA 3F74A 3OQVA 3NDIA 1RADA 2NVUA 3BZUA 3D3WB 1EZ4A 3GRKA 3LRXA 4Z7OB 5D85A 3WLLA 3K70B 2XLCA 3D6AA 3T5BA 1HQDA 4NZPA 4DYVA 1IJEA 4GECA 1IMOA 3A26A 3ETEA 3L9WA 2V58A 2OP1A 5AJZA 3X1WA 1D09A 2P6OA 4NECA 2JRLA 2GNAA 2H16A 1KI3A 3GZNA 1GNVA 1UQTA 1WB5A 4WNCA 5DTRA 3M4NA 4TWZA 4NAUA 4EUFA 3I1IA 3S2SA 1GXSA 2ZXFA 4YMLA 4FGWA 2Q3DA 4CU5A 3QEBZ 5TS3A 1IOVA 1QCDA 4LXHA 1SU8A 5ESWA 2OHOA 3DTNA 4B3HA 3ICWA 1L4HA 4R2WA 3ZLBA 4RTKA 5AI6A 3UK7A 1YJ8A 2PVCA 2V7QA 3NATA 4FHFA 3PTAA 4MQFA 2XGOA 2VI5A 1SG0A 2HSZA 3E5NA 5DGTA 4KQFA 1JPNA 3ZHCA 2GA8A 2Q1XA 1MG0A 2FSUA 821PA 2PYIA 4U5XA 3SJUA 4DZTA 4PG8A 3BRSA 3LKVA 2FFJA 5IS2A 4B74A 2OV1A 4IGEA 4D99A 3P7MA 2GM5A 1Z2EA 5HMMA 4A5SA 1PL8A 4D8VA 3ZGYA 1C8KA 1KMMA 1ND6A 3KKQA 2YXBA 3JTEA 4KR2A 3ZWDA 4TTJA 5AW3A 1QB8A 1XD9A 3TZBA 2JJ2A 4PWZA 1ZOLA 1Y8AA 2DKOA 2MSWA 4LXGA 1MNQA 1QGED 2ZOSA 3FDZB 5KQSA 4W9MC 1QIDA 4PE5B 5DNEA 5AJWA 4NARA 1BRTA 3GJYA 1UC8A 1Z5NA 4YUAA 2VDWB 3N2ZB 3K20A 2E21A 4KFUA 5DX1A 3TSWA 4D3ZA 3IVMA 5LYJA 5LB4A 1P0PA 1OI2A 1YZYA 1Y4AE 3G49A 5IVPA 4P0QB 3CFYA 3AHEA 1JHYA 2H9YA 2QL7A 3GDHA 4HD8A 4S1TA 3UK1A 4L6AA 4E5KA 2CNOA 3QE0A 5GAJA 2AHRA 1OJLA 1ZD1A 5LBTA 2RHWA 1OYWA 2NU6B 3FSGD 3S1LA 2PANA 1XRQA 2P77A 3JWJA 1H2RS 3M3DA 1PSDA 2TSYB 2P6NA 3EC7A 5CB0A 4X65B 1IQUA 4IQ0A 4ITUA 2OV2A 4TTQA 1Z39A 1UL1X 2Z2KA 1X7XA 3TMAA 1RQ2A 3MERA 3NEYA 3ZZ1A 2MSDB 5DWDA 3HSKA 3G5MA 5BVGA 8ABPA 1EX9A 3DZJA 4U2DA 1JWAB 3N8NA 4GC9A 3C24A 1T9DA 4COOA 2UYGA 2B25A 4RLHA 3UMYA 4NYJR 1ZGZA 2Z1MA 1KA9H 3FHLA 1AU9A 4K26A 3OKCA 5K3AA 4LZZA 3PSHA 2AFRA 4KX3A 5BNWA 3ONEA 4HNGA 2QTHA 3E5HA 3KWMA 3KV1A 1THZA 1N5MA 4O2RA 3N8KA 2JEYA 3FF4A 3NR2A 3OTIA 2AOUB 1R9MA 2AVNA 2B21A 4X3CA 1JKMA 2WMOB 4MAMA 4XB6B 3G7UA 4YP0A 5BT8A 3LNCA 4XQ9A 3HZRA 4GZ5A 5IBQA 3T7IA 1Z3CA 1H6CA 5AHWA 5F52A 3ZE0B 2HRQA 1LX7A 1Q77A 2GBLC 5AVKA 3WGLA 1KYVA 5L6LB 4RF3A 3ZY2A 5C35A 5EMNA 3VR6H 3CU5A 1S2NA 1WPQA 1XLVA 4X71A 5F78A 4DLPA 1HFKA 2EP5A 3BXXA 1TM5E 3HUEA 2G72A 3K9HA 1I2AA 1K92A 3N28A 4CWAA 2Y1GA 4OQYA 4I5FA 3NBXX 4QWWA 4JH0A 3TSZA 2D3WA 3HB1A 3L8MA 5E6RA 1QO0D 3LA6A 3WI7A 1EP1B 1RI1A 4LV8B 2XZTA 2O9JA 2YHUA 3UQYS 1Z3IX 1MC8A 4JYMA 4BVGA 1TZBA 1MOPA 2YDYA 5MFZA 3TXXA 4CLDA 3EPJA 1ZINA 2Q0SA 4DLVA 4F4UA 3KLBA 1AO3A 2RCNA 3CLSD 5KVAA 2ZP1A 4J3NA 2I2WA 1QK3A 4F97A 1ZR4A 1AO0A 3R20A 4EOGA 1WW8A 3H5RA 1HGXA 1FMFA 1JQEA 1WU7A 4NCNA 4BP8A 3RBAA 4Y9TA 1E2KA 1Z56C 4GICA 2BZSA 3RS0A 5HVNA 5FPKA 1HNNA 4OFWA 1E6EA 4CW7A 4PWYA 1DEXA 1JAXA 1L9KA 3GIWA 1TTPB 3Q8LA 1GUBA 3D0QA 2QLJA 2G4CA 2ZI7A 5E1OA 3UKDA 2HK6A 2P2YA 3P2MA 2AW3A 4M54A 5TSDA 1WUYA 3STWA 4N48A 4MKGA 1GCAA 1R8SA 1AKWA 2MSKA 2GTIA 1OI7A 3DBRA 5A5EA 3LUFA 1UKZA 4A2QA 1PZXA 2OO5A 2Z30A 1SRQA 2EYQA 2XXJA 4C5BA 4YPVA 3OQJA 1WAMA 1UFOA 3OLCX 1JDZA 4KN9S 4U9UA 4HDNB 2P9ZA 2XAAA 5ADWA 5AI0A 1C2TA 4I4TB 2C7RA 3RC3A 4KR0A 1YWGO 4A03A 4FPXA 3NZEA 2Q99A 2VAXA 1ACMA 1K0FA 1KO7A 1Z6GA 4X0EA 5FEUA 4J1SA 4OXYA 1NW9B 1WZIA 3DV0B 3K16A 4UASA 2FSHA 4B9AA 5HUJA 4B8WA 4L5BA 1NURA 1PZHA 4B09A 3IKVA 3G89A 1ZVMA 2VUSA 3II6X 4LDQA 1OPXA 4AY6A 1CUHA 3AEXA 4RH1A 1XZIA 4JROA 3ZVRA 4DA0A 1RRVA 4B4UA 4JUDX 4RY2A 3RUEA 2QN1A 2BEVA 4O8ZA 1ODTC 2UZIR 3G02A 3ME5A 1L7EA 3E9NA 4ND1A 4PGFA 1QH1A 2PLAA 3MT8A 2JI8A 3F4LA 1N2IA 3MQFA 3CISA 1XZCA 2XUGA 4M0KA 5BN1A 4CMHA 2HRRA 3EXFA 3VMFA 2JBHA 5G0WA 3VYVA 4NFLA 1N2CA 5EVJA 4D96A 2E6KA 3E18A 5FAKA 1SBHA 2D74A 2HMSA 3GAZA 4IIBA 4BVEA 1XZPA 2HUPA 2VA9A 3I30X 3TNJA 3TR5A 5ELLA 4TXNA 4BU1A 5IKXA 3CC8A 4DCOA 2B99A 2JHFA 3ZD8A 3IOYA 4HEJA 2P0EA 2PA0A 2R1ZA 1NNI1 3IQDB 4KJXA 4GR9A 2Q1SA 2DLDA 2GM4A 1WSDA 4CM7A 1H2AS 3PKIA 1AKYA 1Z68A 5HK8A 1KI1A 4A0SA 1U65A 1E0SA 5FV7A 1NA5A 4W9NC 5KCZA 1X7GA 5KPDA 3MAJA 2VJLA 3UNXA 1NR7A 5F7JA 4YRIA 5BUQA 2ZQZA 3FMPB 2CZGA 4MWCA 3E7WA 4WN9B 4DUGD 4L07A 5JJCA 1I6KA 3NHPA 4LHWA 4WASA 4ZEXA 2QX7A 5BW8A 1SD1A 3F1KA 2QEQA 1W47A 1I3MA 4MUAA 1GL6A 1JVBA 4WIAA 4ZQEA 1EMDA 3U9SA 5LNK6 4PSDA 2ZKLA 1Y6RA 1TFUA 3NDPA 3G5UA 2JLQA 3RTAA 4XWAA 3R6WA 3E3NA 2YY6A 3PQ4A 2ET6A 1AXRA 1AZWA 4IG9A 1SUIA 2X2OA 3CVJA 3D8HA 4QQ8A 2Q7OE 5EJ7A 4PHGA 3LRTA 1ZQ1A 4I6JA 4EEXA 1UP6A 2BGMA 4H7IA 2W6MA 1TJPB 2J0VA 2J3DA 2QRNA 1LBIA 4IIGA 3WSWA 1KP3A 4K6KA 4C01A 2Q49A 2PLFA 2P0AA 1EVYA 2Z57A 3PDCA 4H1WA 4V0NA 1U2EA 4V24A 2B82A 1Y3FE 3TG2A 4CVNA 1Y7PA 1IOZA 1DIAA 1G55A 1O3YA 3LCUA 1IZYA 2HD4A 4ID3A 4IUYA 4K2HA 1VIVA 2O1WA 2MJLA 2HA7A 2O48X 2RGUA 2YHIB 4PFQA 5EJEA 2MMCA 1EU1A 3H3XA 4ENRA 3ELDA 1JDNA 1JHVA 3QI2A 1LD3A 4JBWA 4TSFA 3UHPA 4EO7A 2HH9A 3MHTA 2A67A 2C2BA 2WD8A 3F8WA 1T5TA 3GLHE 3RRZA 6REQB 3EAGA 1ARZA 5LUBA 1WTAA 4XIIA 4JB2A 3DFKA 3GVHA 2JPDA 3PIDA 2HJSA 2VP5A 3X2FA 5CA0A 5A5GA 2BDUA 3SHOA 2XQKA 4B6OA 1TF7A 4FMPA 3HB5X 5NULA 1ORRA 2J30A 4OGKA 2CGEA 2FPPA 5COAA 4GOND 2AD1A 2ZROA 3E9CA 4K1LA 2BFDA 2R4UA 2XVXA 4DJFC 1X42A 3FSGA 2WUGA 5I7UA 1T8SA 5J2TF 4MWBA 1JVSA 4HAYA 2AS0A 3T38A 3V8VA 1JDBC 4K8OA 1ZNXA 1E2LA 1Q1AA 1S7CA 2IUSA 3BMXA 4MOWA 4INOA 1XCBA 2ZITA 3KZCA 3A6HA 3KR0A 2NUTB 4KQ9A 3CEJA 1D2CA 4OP1A 4M88A 3CMMA 2DUWA 2ZE8A 1KMHA 1D8TA 2PT5A 3AONB 3KUXA 3W3AD 4EPWA 1PUIA 2D62A 3CNBA 3P32A 4ETIA 3RIEA 2W6PA 4JT4A 2A1UA 2PUVA 3GLQA 1ZP6A 3QXJA 3TD6A 1ZO8A 5KNBA 1PQ4A 2FTKE 4HUQA 2VWPA 2FEPA 2HQSA 3G6WA 1VE6A 5HFAA 3BQNB 4F6RB 3HP4A 3GLRA 4IKEA 4F8JA 2G0AA 2F43B 2NO6A 2V0CA 2J08A 2ZLBA 5LA6A 4CEHB 1R12A 3ZBTA 3H2GA 1L0BA 4TRRA 4LRXA 3WGZA 4Y2JA 1K66A 2ADFA 2YJ4A 3A1FA 3B2EA 3EARA 2GPSA 3NUQA 4X93A 1G17A 3HXTA 3DG9A 4LZNA 4PSAA 4TV8F 4WGGA 2I4MA 1MUUA 4L7VA 5DGCA 3R3JA 3VDNB 2QL9A 4PRZA 5H9WA 3CHYA 3LX6A 2X13A 4K28A 5FT9A 1JHMA 2RJOA 4IHQA 4KWTA 2BTQA 3W1WA 3F6CA 4ZAGA 1OAAA 1Y1LA 2ZSKA 3RYHB 3G0BA 4BO8A 3H4IA 3L4BA 4Y2UA 5A1TA 4Z2AA 1NW8A 3BPSA 3WBJA 5DCWA 5DI3A 3IQZA 5BV2P 2CXPA 3WKCA 4UQPA 4KQKA 1WXDA 3D1JA 1ZA1A 2PR7A 3M1YA 1F7VA 2F4VB 3HO6A 2NO9A 2Q0QA 3A04A 3IP1A 2OHJA 3LPLA 5CFPA 3W6OA 1R9GA 2NYVA 2W2QA 4EPVA 5CB8A 1CUSA 4FHZA 1IUPA 2D8MA 2FOIA 5EKDA 2YZ7A 2ZWIA 3V46A 4OBXA 2ZJZA 2D7DA 3DE1X 3ZBUA 1M0WA 2FSGA 1YJQA 3NHUA 1XMIA 1HY3A 3EFBA 4N6GA 2AC7A 4U0JA 3TW8B 3ZCVA 5BVHA 1E77A 2AYYA 5AJTA 3MCUA 5IAOA 2H7VA 4P3YA 1YB6A 4A10A 2X1VA 4C3VA 3V4ZA 1KRXA 3JPYA 4Q9DA 1N75A 1PEAA 4X63A 3ZQ4A 1F51E 3THXA 1QH0A 1YS4A 2ODEA 2NXWA 1CJTC 2V96A 2X2PA 4IHJB 4PYLA 4QXOA 3TO5A 1DJMA 1UF9A 2WHEA 1JJBA 1XXHE 3E9YA 3O1IC 2QU7A 3ILXA 1J6UA 1GTL1 3GHYA 4FDMA 5ALLA 3T3MB 2JHAA 1FLDA 1NUUA 2W0MA 1GL9B 2R8PA 4JA0A 5KTTA 2ID4A 3F73A 3FFBA 4QFCA 3WYDA 5ALKA 4PN7A 4YV0A 1UFQA 5MFPA 2DSTA 2AZTA 1VKOA 5D3KA 1QHYA 3OJLA 2V3CC 3CEMA 3BSFA 4IHJF 3UENA 3BRCA 3X1YA 1YZNA 1A7KA 4B6GA 4UULA 2I6GA 3E3OA 4HVAA 2I65A 3QQ5A 3NGLA 4HUJA 2K5UA 3PZBA 3G2KA 3I1YA 4CTMA 2VYCA 4FYXA 3CZQA 2ZETA 5D6NA 3ZK9A 2WNHA 3F7NA 2FZVA 3GUCA 1XRNA 3A9SA 4RY0A 4YP6A 3SHTA 1BHSA 1FYXA 3L1JA 4D3SA 3H9GA 2REQA 4N41A 4UAJA 2QG4A 1YRAA 4YHHB 1AK9A 4BQRA 1N3IA 2AN5A 4KQCA 1KTVA 3CH7A 3WKEA 1BKDR 1KS2A 3FNFA 1EFUA 2ZUSA 2J4FA 1ONSA 4KTVE 3CLKA 1FDTA 2PT7A 1JWBB 1P72A 4ZU3A 3DONA 5CIWA 1E5VA 1QV9A 5KYXB 4EKNB 3DMPA 4R8VA 4XAQA 2EDCA 3F5DA 1EUZA 4GZ6A 1EDDA 4KEAA 4PN3A 4W63A 2EOAA 1SWVA 3I2FA 1GPNA 4U7DA 3NVDA 1P7WA 1RXWA 5DWQA 1I6LA 3GUUA 4DUGA 1XWWA 1A5SB 3COJA 5IDYA 2OBFA 4B3BA 1Y5RA 3L7AA 2PMKA 4HNAB 5J5CA 3F97A 5JJIA 3K5HA 4HNRA 3GEMA 4D9GA 4EQ6B 2YWCA 3WWCA 4MR7A 3EMVA 5KNCD 5B7NA 3W5CA 4MV0A 2VQ3A 3DEAA 1YCDA 4ZZ2A 4E2FA 3V2IA 3THWB 3WMGA 1I94B 4MMZB 2JKZA 4G81A 1K6MA 4X97A 3RS9A 2YJNA 1XKTA 4MS1B 1OXTA 1DBVO 1GGVA 1YRLA 1XAJA 3DZBA 3QFTA 4XB1A 1E3WA 5IZCC 1XMJA 4CTOA 1FXWF 1LK7A 1TVCA 4ZO7A 4FE7A 2VZ0A 3IP6A 3RF6A 7MDHA 1NW3A 4OBEA 4DIFA 3O8DA 4HNSA 1Z6XA 1BN6A 1D0SA 5AI5A 3STYA 1XNGA 3OBIA 2ZKIA 3QJ5A 1P0FA 2GHQA 2CJPA 1ORVA 4YLEA 4N8DA 1FFDA 2YV1A 4A0GA 4D81A 2X0KA 4UDNA 1T2CA 4WESB 5AVOA 4GOJA 1FDVA 3KIPA 4B6FA 4BNDA 3PWZA 4OP3A 5DH9A 3JALB 3HUDA 3NIGB 4U3JB 2J6HA 4WK0B 2OHGA 1ODKA 3ILYA 1FVFA 4H2DA 3PX2A 4YUVA 3TW8A 3HYCA 3DAPA 1KYTA 4DIUA 2A9OA 3G5LA 3ZD6A 3A6LA 2NSDA 2AV6A 3SSNA 1Z0JA 1PV2A 4CF7A 1ZJYA 2BEWA 1WBJB 3MJCA 1M1UA 1XZAA 4X8MA 2C7PA 1GZUA 1ZUNA 3PQ3A 4H9GA 5G0UA 4FYWA 5KUTA 3LAWA 4ZO4A 3FGNA 2YXPX 5FBHA 2KBEA 5EHNA 5F5LA 1RYMA 2Z83A 1NUPA 1A4XA 3JALA 2AFIE 3MTQA 5K1ZA 5KYWB 4EVQA 2WA1A 2A78A 5KTNA 1I51A 4XVCA 3TWOA 3BN3A 1SC9A 4OLJA 3G8BA 1WP9A 2H18A 5H4GA 2FGJA 5EFZA 3U09A 1CG6A 1U3CA 4TT3A 2PGOA 2IQIA 3WQBA 2Z9BA 3RT7A 2XA9A 2QF7A 2VSYA 3KQOA 1SQSA 3OFJA 1R5OA 3L41A 1YC2A 1WDLA 1ZLXA 2OENG 5HKOA 5KNDD 1E3TA 3HKEB 1U7DA 1F4VA 3IDQA 2VJYA 4AKEA 1JFTA 2WJHA 2R6FA 4JFRA 3SXPA 4C0AC 4B3SB 2ZEJA 1RWXA 3G6KA 5EINA 5JDCA 1K7CA 3F9RA 3PJFA 1X7XB 2J9ZB 9LDTA 5DXFA 2OORC 1K6EA 3U56A 2ERCA 3A1TA 2WD9A 2GK4A 2NZVG 1B6SA 5EXPA 4DWWA 5JSZB 2ILTA 2XADA 4U00A 1SEVA 2CL5A 5EJAA 3W0LB 1OY1A 2XMQA 4M21A 1MT3A 2CJWA 3O4GA 4MR7B 4JJ7A 4Z7QB 4KDRA 2EKLA 4CKCA 4MV4A 3M1AA 2Q5LA 1BGXT 4QYXA 5FPPA 4BN5A 1BCRB 1I2BA 3MS7A 4BDSA 1NSTA 3U49A 5JD3A 3KUDA 4BVJA 5JPDA 3QU4A 1H6BA 3AHDA 4FX5A 3IEIA 3AW8A 5JBNA 4AD8A 1XCOA 2Y6UA 3QWIA 2QXTA 3UATA 1ZOPA 2G80A 5HPYB 3O0DA 1O0SA 4BZZA 3GARA 3F3SA 5KYWA 5FBVB 1KTIA 5B6PA 1E92A 1OBFO 2C4TA 4CL3A 3B1XA 3FPSA 2JJ1A 3PGMA 3AEZA 3VVLA 1GGKA 4P86A 3VR4H 1FB5A 1SKUA 2OL4A 4N5DA 1WUIS 3FRJA 3SYNA 3FFTA 4MUEA 1VIDA 2ZTVA 2OCPA 4I50B 3MWGA 2XE8A 1PO7A 1GZ7A 2PA3A 1VBNA 2Q3CA 3KE8A 1SUBA 4KLNA 1AUVA 2IXTA 1T1SA 1FU4A 4W99A 5EE0A 3A2KA 3R4CA 3QPVA 2JIQA 2CXTA 3PHLA 4BUJA 4UBMA 2GQ0A 4L8GA 1NX9A 3JQCA 2P27A 3M2PA 3USZA 4DMKA 4EENA 1NRXA 4PGHA 3A9WA 4YRRA 3QXCA 4GMHA 5P8WA 3ITEA 5K4HA 3C39A 2GXAA 5F9HA 1RJGA 3I9LA 1DAOA 3NAZA 3DBOB 5F7ZA 1XPUA 2HA3A 4I50F 3GLFB 3QYAA 1G8AA 1GRQA 2XAUA 3MMPA 5EHQA 2AXQA 4B7ZA 4HGYA 4DCJA 2PX4A 4DIDA 1GUAA 4P7KA 1MB0A 3BMNB 2H1OA 1T2FA 1P74A 2ZJFA 3DZHA 3OO0A 5KWSA 2F55A 1XRJA 13PKA 2W2LA 1OASA 2B20A 3ISJA 4JY7A 4C2AA 1TQDA 1UBMS 2P78A 3DMGA 2JFFA 1FUIA 2Z58A 1MENA 2VSQA 1PR5A 2FEOA 3EWNA 4KIWA 4BRSA 2IOYA 4MZXA 3EVDA 5HTKA 2ODWA 5IAGA 2ATEA 4Q6WA 4RVHA 4U9IS 2I5PO 2BFBA 3UWOA 1VA4A 3IUYA 4KRFA 1Q0SA 1Z37A 3S2GA 2IYTA 2RG1A 1Z08A 4FNAA 4FCVA 4DIBA 1A9TA 1TX4B 4MIEA 4Z9XA 4BU0A 4D92A 3ESCA 4DCGA 1DL5A 1L5QA 1RWOA 4OK6A 4XARA 4C4OA 3PHHA 5H81A 2CVFA 4K7JA 4MO9A 1LV7A 1XDUA 5CW1A 1XVUA 1EGMB 1J00A 1G64A 2CLLB 3ILVA 3LM8A 3P9ZA 4EHLA 4YUZA 2O8EA 3ILHA 1J8YF 1J99A 1N9ZA 1US8A 3BXZA 3QI7A 1GRCA 2VYVA 4Q3NA 1T9GR 1QP0A 1RLMA 2HPVA 4V0MA 2XZLA 1LW6E 1ODLA 1ZSYA 2BMWA 3SF8B 3U4GA 2LIVA 1JJVA 2J3EA 2FQXA 4I2VA 4O6VA 4PZEA 5EJ8A 5A0TA 2FG6C 1D2EA 2JAQA 4R4JA 4FIDA 1CRQA 1H05A 1RLJA 2FWPA 2YUIA 4J90A 3ZW8A 5IJ0A 3EEIA 4KBYA 2DFPA 3BK2A 1KH1A 3ITKA 1Z25A 3P9NA 4M1SA 5JDIC 5JT1A 1KZ7B 4XYEA 2KLBA 3LPAA 1S2DA 3J80A 4BBJA 4UZFA 2I7CA 3QKRA 3C6KA 5THQA 1QR2A 5K0SA 1J2RA 1FL9A 3ZJTA 4WZAB 4BLOA 1ZH6A 5ANRB 4RPCA 1TF2A 2RHMA 4L1KA 1ZGGA 3B7GA 1TO1E 4JOBA 3R77A 3U4IA 1I4EB 2QQFA 2VAPA 5EJMA 4BJ5A 4BMVA 4UEJA 2W48A 3KXIA 3ETDA 4MCAA 3UBMA 3ADBA 3O93A 1G42A 2BDTA 3HACA 3CZ4A 3PK0A 2YN0A 4ZAYA 3ZBPA 1PEYA 5E3HA 1S02A 1QX4A 4Q7LA 4IOLA 4YRDA 2D7JA 3EXIB 3LCJA 4U4AA 1Z63A 4PQEA 3T7DA 4HB0A 2R6JA 2CEAA 5KKNB 1VSTA 2WF9A 1G6OA 1SXPA 1M8JA 2E85A 2OFXA 1SHTX 3K05A 5BN4B 3AHFA 2QRPA 1KQOA 1J42A 2RI1A 4L76A 4PLZA 1SUCA 4DLXA 2DAPA 1NXSA 1VCHA 5BQ5A 2DWPA 1GCOA 2O3JA 1YULA 4DSNA 2W93A 1SCUA 4EGCB 1V0JA 1XCJA 5AW1A 4JQSA 4C2UA 1FFHA 3ZE9A 2JG3A 4M86A 1JHZA 1EXMA 5KDLA 3V2HA 4G0YA 5AW9A 5JS2A 1VI6A 1Z4MA 2FW7A 5FBKA 4DC0A 3M8KA 3AR2A 1XR3A 3VH1A 5JASA 3HGTA 2YY5A 2OFPA 2WINI 2ZU6A 3E70C 1C3VA 4MS3A 3W7VA 5ETJA 1ZJWA 2XWBF 3SIPA 1ENYA 2AA3A 1Z34A 3KKKA 4FBLA 3SBEA 3FHJA 2NLOA 2GCNA 4UCQA 2HDWA 2O20A 2Q6TA 2CMKA 2O2ZA 3D1VA 1NV8A 3MJEA 3SVZA 1YQDA 4TTVA 4GOKA 4CETA 1RRMA 3A4LA 3KJQA 3N8HA 3CJRA 3PJDA 3AX6A 4OXRA 3R9KA 1TZMA 4CQMD 1TECE 2C95A 3WYNA 1VECA 3G2HA 5I7VA 1OE0A 1S7GA 4MPJA 3ODPA 2FA9A 3K1YA 4GT1A 2ONJA 2FKAA 2RG7A 2RJNA 4FQ5A 2IV3A 4EF5A 1HSZA 5FWYA 5CPFA 2SCUB 3UUWA 2O8CA 5ICMA 1G5FA 3UWSA 2DQSA 3P9IA 3QEJA 5TGDA 3DQPA 3W2FA 1ZJ6A 3X2EA 5IRCD 3TEMA 1NP3A 2IYUA 2Q9UA 1AGNA 3W78A 5JXJA 4OQQA 3RANA 2YHSA 4B3RB 2BHLA 1QSGA 2GO7A 2IHJA 3T3PB 3QFSA 4G67A 5EGSA 3WK6A 4QLBA 3A3OA 1G4HA 3CG0A 2C2GA 4H35A 4F91B 4G5FA 3E7DA 2JHCA 3TL2A 2VPTA 2X0IA 2YIMA 2RI6A 3C1OA 1B1CA 1N7IA 3MBKA 4IBOA 4N5MA 4R7TA 5DEIA 5KAMA 4DPKA 1FS4A 1ND5A 2YINC 3KXKA 5ALDA 4BC1A 3GEEA 5JMOA 1X80B 4HN4B 3RYTC 4ESVA 5CA0F 4K9DA 3F6BX 3TZKA 4QXAA 4J07A 3D7RA 4FGZA 3RW9A 3IB6A 4G56A 4HZUB 3NNDA 4K6OA 2B5VA 3T35A 5DK4A 1RWQA 2JFOA 1YASA 5IBCA 1ZM7A 2P3LA 1GPH1 5FB3A 4Q82A 4C7JA 3RBVA 4NAVA 3Q0IA 3LPMA 1CEQA 3NJ4A 1CF2O 4IUCS 3QRWA 2P5YA 4DTIA 1MC4A 1CQXA 3TW0A 1T3GA 3TGPA 3UGQA 2O2CA 2R87A 4L5AA 5IC6A 2XY4A 4HHEA 5K0ZA 3W2EA 2B0CA 4X1KB 2UVPB 4M1YA 1WETA 3E7FA 2RGGA 1BFUA 3T7CA 5AICA 2MDTA 5L3QA 1C7IA 1N9KA 2CD9A 3WC4A 2AOWA 3ESAA 4CR6A 4CIAA 3VR3D 1Y1KE 3S2FA 1H1LB 3G2JA 2VKTA 1J24A 3PQCA 3RWMB 2BGUA 3W06A 4S05A 2YV5A 3LWZA 4R1NA 1PJBA 4Z54A 1JDBB 4DNPA 4KVGA 1ZUD1 3B3JA 1OFHA 3CXRA 1GA4A 2EKBA 1I6MA 1Q2UA 2ASVA 3DKIA 5AH0A 1NJ6A 1FEZA 5TMPA 3DQQA 4J03A 2ZE5A 2D1QA 1PK7A 2XGJA 5A9SB 2QBYB 5JFGA 2NZYA 4C6HA 1KK2A 3K94A 4R16A 2YUTA 5EE9A 5DBEX 4KODA 5DE3A 4AKSA 2PX0A 3BHMA 2GWHA 2XTJA 3R3VA 2G9ZA 4XM0A 1CRPA 5ILQA 4BAUA 2C88A 3DVQX 1XP8A 2C3PA 2PSHA 4IXMA 3GRYA 4WNIA 2CE2X 3A7EA 1LY1A 1XRLA 3KVOA 1IC6A 2B7BA 5ICCA 4PINA 1GRVA 3N2GB 5L7TA 3AI2A 3CPJB 4LRYA 4YAOA 1X1BA 1RYDA 2L69A 3NORA 3PXUA 4FIZA 4YJDA 3HABA 3V6LA 4Q03A 1EINA 4DT1B 5H3CA 4ML3A 2HF7A 3LXRA 1Z17A 5J2TB 4G9GA 3FPFA 4RC9A 5BVHB 2WSSA 4Q66C 3AF5A 3PFNA 4N40A 2A4KA 2V65A 2EW8A 1WUTA 2X8AA 3E35A 3IA7A 1XVAA 4ENVA 3CVYA 5K3BA 3UXEA 3CEPB 2XBUA 3ZX4A 5CG1A 3FTDA 3OPYA 4P2BA 3CLRC 5CVDA 3GD7A 1IN7A 4U2EA 2QUAA 3G1UA 3L6EA 2DOKA 4P3OA 1D03A 1EFKA 5DYWA 1RACA 1SKYE 3FJYA 1Z38A 3CW9A 4HDOB 1L5KA 3G0DA 1G21E 3S99A 3U7EB 3IIMA 4CV0A 1QB7A 1W1IA 4PYQA 1ODFA 2XV1A 1MPXA 4BNMA 4HB3A 2FK7A 2Q5CA 1PN3A 1YVUA 4IVRA 4YP9A 1UMBB 1OF1A 1WX1A 2DKNA 2ORYA 2QRHA 1IH8A 2NU6A 3Q40A 1KPHA 4QGBA 4RGVA 3GA5A 3NASA 4BNWA 4DREA 3RAPR 2RARA 3KXPA 1RLTA 3G2PA 3B1KA 1P4RA 1V3VA 1Z2NX 4IDBA 3HDVA 5LM3A 4LW8A 2VR1A 3H13A 1ATZA 2NNWB 3EG9B 1ML4A 2D1SA 4CQMB 4KFSA 2NO0A 1CUXA 1AKQA 2ANBA 2B7LA 2VOJA 1QGUA 2SNIE 3U3ZA 4EL0A 1Z0KA 4BNGA 3H42B 2FF7A 1L4FA 5LDGA 1SKMA 4QHTA 2QXYA 3K6KA 4Y6SA 1N2XA 2HWYA 1Q14A 4YMUA 1JMKC 1SD5A 3FSEA 2OD2A 4UPVA 3HKCA 4J0HA 4Z0TA 3UJ9A 5C81A 4F4CA 4XLLA 1WE2A 3ZBQA 2G09A 3U5ZB 3QVKA 4JC5A 5EP4A 3ONFA 2HRCA 1Y4UA 1FNBA 1SG6A 2LR0A 3ZC3A 4YLYA 3OZXA 4JLJA 1QWSA 1W36B 2FN4A 1ODCA 2B8WA 2OBLA 3CH4B 2QA5A 1L4UA 3LUBA 3ZHYA 1O7JA 3AG5A 1NMSA 2H07A 2HM7A 5AFSA 2CDAA 1V5FA 4FEYA 5L51A 2W6OA 2RD2A 2VK1A 3QBVA 1LLDA 3K5IA 1KEWA 3K9LA 4Q0MA 4RVSA 1XYYA 5IM4A 2CYBA 5JQGB 1C4XA 4IIYA 3H6GA 4OBWA 1Y4SA 3AR7A 4C7KA 1HNWB 1Z4QA 3RIHA 2IXEA 4B81A 4HV4A 2DB3A 2EBFX 4CQLB 4QO8A 5JYCA 1IY0A 1CJSA 1RWKA 2K6GA 3LLUA 1HDCA 1PJLA 4QOGA 3W3ZB 2XZOA 1NVWQ 1A8QA 1AGYA 1ESCA 3WWDA 2YYAA 4D3DA 3U4HA 4E5YA 2XBMA 1JHAA 3KG2A 1W2HA 3DPIA 1KH2A 1NQXA 1C8BA 2V8OA 5JXIA 4NI5A 3GL9A 1VZ3A 1L7PA 2HGSA 3C1TA 4ARUA 3OTOB 4OLHA 2C9BA 2ZIVB 3A4IA 4Y67A 3CRMA 4HQLA 3MBOA 1HDOA 3I9NA 1V7ZA 3U3JA 2DFVA 2GYVA 2PRKA 3N39C 3NVAA 4IIJB 3ESQA 5D00A 5FPHA 5GPBA 3UM9A 3ZHZA 4QECA 3R23A 4QJ4A 4XVHA 1FYFA 1P3DA 1XHLA 1F6BA 2WM2A 4DW8A 1JG4A 4XX1A 2AYZA 4AWAA 1DPGA 1AY0A 4OI2A 3EGXB 4C2BA 4AMZA 2H54A 4ZI3A 2X86A 1ECBA 1EFPB 2BGIA 2O8EB 3BL6A 1P1HA 1YB1A 2A0WA 2PMEA 2AEJA 1P9RA 3RVSA 3W2HA 1GT6A 3C6XA 3ZY4A 2H65A 3FDFA 2FQ1A 2O3TA 5JATA 1MO3A 3GDWA 1ZN9A 2BR3A 3AKYA 3GMDA 3HB9A 4PX5A 1NSFA 1TMOA 3VGJA 1EFLA 3KK0A 1KWGA 4FFMA 5CDFA 1USVA 4RHFA 2JZCA 1HZZA 1MC5A 3OX2A 1KJYA 5C3UA 5IEBA 3M6VA 2L2QA 2BAGA 2GVZC 4H3KB 1WTCA 4TUYF 2DJIA 1QE5A 4CR8A 1N2JA 4AP5A 2OQVA 1M54A 2RH8A 3P71T 4JCOA 1EAMA 4GBGA 2F8SA 5K0CA 1D9ZA 1IBLB 2C8JA 4B6RA 5EUQB 3HY3A 2C2ZA 1NPYA 1CZKA 1TVMA 1Q83A 4YDSA 1B00A 4W7HA 2VDOB 3WKAA 1L7DA 3ERCA 4DAEA 1H3NA 3ABOB 3C7KA 1R6UA 3D5TA 4FZJA 2WICA 2G83A 4ZVKA 5LMUB 4AKIA 1QHGA 3R76A 4MB6A 1JJFA 1QV7A 1NF8A 3OKFA 3ESBA 1IBKB 4I5IA 1NZJA 1R4MA 4H3HB 1TIKA 1U1EA 3BHJA 3JATB 5JSKA 3P5BA 3A1NA 4DLZA 1EEXB 2V03A 4XWOA 3L7DA 4PF1A 3V97A 1TT5B 4D0GA 2WPDA 1KAMA 4X3OA 2R79A 4LTNA 3IELA 4OLFA 4B32A 1N77A 3HVHA 3AVVA 2AZDA 5IK2D 3U4AA 4IUBS 2VCYA 1NUSA