4GE3A

Schizosaccharomyces pombe dj-1 t114v mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
190
Chain Sequence
b'MVKVCLFVADGTDEIEFSAPWGIFKRAEIPIDSVYVGENKDRLVKMSRDVEMYANRSYKEIPSADDFAKQYDIAIIPGGGLGAKTLSTTPFVQQVVKEFYKKPNKWIGMIAGVLTAKTSGLPNKQITGHPSVRGQLEEGGYKYLDQPVVLEENLITSQGPGTAMLFGLKLLEQVASKDKYNAVYKSLSMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein C22E12.03c
molecule tags Unknown function
source organism Schizosaccharomyces pombe
publication title Influence of peptide dipoles and hydrogen bonds on reactive cysteine pK(a) values in fission yeast DJ-1.
pubmed doi rcsb
total genus 73
structure length 190
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ge3A00
3NOVA 4AUNA 1WL8A 4I4NA 4B5KA 3BHNA 2VDJA 3FSEA 3TTUA 4WXYB 4LRUA 1QDLB 4RKWA 4BFLA 3TTTA 4L95C 1GGEA 1GG9A 1QVVA 4UCFA 4ZDIA 4L8YA 3SF8A 2R1TA 4OGGA 3L4EA 3CZAA 1A9XB 3CYFA 4RKYA 4L78A 4P34A 2W7TA 1IPHA 3KKLA 2IUFA 3MIIA 3PQ8A 3B36A 4ENQA 2H2WA 1VCOA 3F5DA 5SY6A 1QF7A 1FY2A 1N57A 2GHRA 5SY9A 2ABWA 4GE0A 4OIFA 4WINA 1R9GA 4ENPA 4B40A 1QVWA 3PQ7A 2WJZB 3L7NA 1ONSA 3N7TA 4GE3A 3PQ6A 4HCJA 3CNEA 3EN0A 4MTCA 1GGFA 1GGJA 4BIMA 4ENSA 3NORA 1KEEB 1P80A 3R75A 1OX4B 3WFZA 1PV2A 1OI4A 4ENRA 4UOZA 4N0MA 3L18A 2ZUWA 2VXOA 4XLLA 1C30B 1CF9A 3TTVA 2R1UA 3ZJ4A 2YWJA 3CY6A 4B2YA 1GGKA 4L8FA 3SOZA 2YWDA 1I7QB 3EFEA 3NOOA 1CS0B 4L7QA 4UZSA 5SYAA 3R76A 4B7AA 3PQ4A 1I1QB 4ZDKA 2ISSD 1O1YA 1KWKA 3F71A 3P9SA 3PQ3A 2YWCA 1Q2UA 2R1VA 1T3TA 1QWSA 1JDBC 1T0BA 1VHQA 4Y1EA 4AULA 1OX5A 4ENTA 2ZUTA 4I46A 2OR3A 1S1MA 2RK3A 4E5VA 4AJ9A 5IP5A 3ZJ5A 1C3OB 5JZMA 1G2IA 4AUEA 2R1TB 2FEXA 1SOAA 3EJ6A 3PQ2A 3B3AA 4OFWA 2VPIA 3GRAA 3NOQA 3ZR4B 3TTXA 1K9VF 4AUMA 1IZZA 3L3BA 4PXYA 1PDWA 1T36B 1SY7A 3D54D 2D7JA 1CE8B 1GPMA 2GK3A 2R1VB 2XF2A 3FIJA 3P9RA 4OJYA 4P35A 1Q7RA 4ZDJA 4QYTA 4UNIA 4ADSG 3UJNA 1I7SB 3TTWA 5SY4A 3EZGA 1KA9H 4R7GA 1QVZA 4I2NA 3EWNA 4QYXA 1VCMA 3P9PA 2YWBA 3RHTA 5DFAA 1OY1A 3UMMA 4L8WB 4ZGGA 3TTSA 1IZYA 1P7YA 4S0ZA 4BTEA 5LIRA 3NVAA 1P81A 4P2GA 2ZUSA 3SF8B 1GPWB 5BV2P 1KXJA 1KWGA 3CZ9A 3OT1A 5E9AA 2ZUVA 4UOQA 3R74A 3UOWA 4B31A 1FYEA 1U9CA 3B38A 4N12A 4P36A 3MGKA 4P5PA 2NV2B 4Y0NA 1VCNA 4Y1GA 4D1YA 4ENVA 2RK6A 3PQ5A 2VRNA 1L9XA 1OX4A 1OX6A 2V4UA 1PDVA 3M3PA 4Y1RB 4OGFA 3UGJA 1M6VB 4JQSA 2ZUUA 4E08A 1JVNA 2VKTA 2A9VA 2RK4A 1GGHA 4MGHA 4ENWA 4Y1RA 2AD5A 2AB0A 4OQ4A 3TQIA 1UCFA 4Y1FA 3UK7A 3ER6A 2NV0A 1P5FA 1PE0A 2LXNA 1P7ZA 3NONA 3BWEA 3OT1B 4LGYA 5K4AA 3TTYA 5JZOA 4ENUA 1J42A 4MNTA 4K2HA 3VU3A 4GUDA 1BXRB 3P9QA
chains in the Genus database with same CATH superfamily
3P0IA 2B6NA 1PG0A 1WF6A 2XVAA 3DTNA 3RFFA 2I9KA 2OP0A 1C4KA 4AG6A 2FKNA 4PF1A 3K0HA 3PSHA 3I1JA 2R1TA 3SYMA 4WFIA 2A9PA 4HNTA 1K5GA 2WU8A 1ZD5A 1RI3A 2YHIB 1KVQA 4RKYA 1BEEA 3I1IA 1H3NA 3RABA 2YWXA 2XDYA 4YQYA 1AK9A 3TFWA 4NAUA 2AJLI 2YNMC 3O8DA 4S1VA 1CYDA 1PWYE 2R11A 3RRYA 1N2CA 2WUGA 1JTFA 1GR1A 1R88A 3KHSA 5A3SA 1U8ZA 3ROMA 3WDLA 3OZVA 1VA4A 3ANMA 5C80A 1IG3A 1T1GA 1K9SA 3K9QO 3Q1KA 3GJQA 2GYVA 4H16A 4LYEA 3X2SA 2Q5OA 3ZE6A 5KDLA 4FDAA 5CDFE 4UBKA 4Q9JA 3VDMA 1XZMA 4EPRA 4K87A 3MAGA 2VDQB 5DPMA 2R8XA 3CY6A 3H42B 4P3XA 2G83A 3VMFA 1ZAYA 1AHNA 1Q7EA 5CM9C 4LQ4A 4ODIA 4PNPA 4AIRA 4WGFA 1ENZA 4NFSA 4X65B 4C6SA 4Y2VA 2ATXA 3GUZA 3QNWA 2R1VA 2QPAA 3R3JA 5M2QA 2H7XA 2XUGA 3C85A 5EIBD 5TQ2A 1WBDA 5EQDA 5IAOA 3IHLA 4JJEA 4LJKA 1CNFA 3SEQA 1G21E 5K3AA 1TOAA 1N9GA 5I9BA 2FP4A 3O9VA 1SCDA 2O8DB 2ZS7A 2IOHA 2BHNA 3V4LA 1RXCA 3H8VA 5DYWA 3ZXYA 5LQDA 2DUMA 3AF1A 1YONA 3FKSA 4MS1A 2X0DA 3D54D 2MDTA 1NJSA 2PR7A 3R9XB 4AY2A 2IS2A 1S3IA 4MLCA 4L15A 1Y42X 3VPXA 4MIKA 2ZPUA 1Q5PA 4K6HA 4I4TB 3NFYA 3CMMA 3RC8A 1XZAA 3H1FA 1RXWA 1TUIA 2DJ5A 1VLJA 3BTSA 2H4ZA 4GPAA 2HV9A 1A50B 3AUKA 1SU8A 4OATA 5BUSA 4C6HA 2JK0A 2Q45A 2VHTA 1EUDB 5BQFA 3KOOA 1DDOA 1YS9A 2JD0A 3UXYA 5CFZA 1LF5A 3M4YA 4FDTA 4BNXA 3PNYA 3V7UA 3NWJA 4MP3A 2E18A 4HXYA 1NQUA 5E3HA 2OSVA 5G0TA 1PBNA 4H15A 4TRRA 1ZM2A 2GN4A 4TSKA 4I66A 2A0FA 1K2VN 2GBCA 2C1XA 2OILA 1JXAA 1SRQA 4ENWA 1AUQA 3RT1A 3EGDA 3D8RA 1G17A 4QPNA 3OKCA 4XH9B 5EP3A 2PTGA 4L85A 3RS4A 4FNGA 3RAEC 3AETB 2ZVDA 4PCAA 3DMTC 3O7MA 4J2TA 2YHSA 5IBQA 1BEZA 4BAZA 4EMSA 3C5VA 1N6IA 2J3KA 2FWAA 2O7RA 2BGRA 3IMCA 2JLAA 1JQ5A 1JG1A 4TQAA 3CT4A 1Z0ZA 3CX7A 4HAZA 1M2OA 3GJYA 2YS6A 3KFVA 1ZN8A 4HNRA 1C7RA 1U8UA 2ZB3A 2ZBFA 4Z5XA 4EATA 2RE8A 3QKSA 4HYQA 3ZUPA 5ELLA 1UFOA 3CNQS 1UT8A 3GBPA 1RKUA 3N8KA 2GF2A 5PNTA 3D5QA 1CFJA 1SKYE 4PTYA 5FKJA 4ZZ2A 4RL6A 4AT1A 5IZCC 4KW7A 1Z4KA 2HLHA 2OZLB 4B40A 3INGA 2DQZA 1UPBA 4U00A 1PX2A 1FB5A 1PVOA 4S3MA 3GFFA 2F1JA 4Z9AA 7YASA 2PUBA 4R1MA 3VU9B 2YRXA 4YRIA 4QFMA 4LJ6A 1O5TA 1RJGA 4B85A 5AK0A 3D2BA 3L7CA 3KKOA 1XDUA 2Q5EA 2CFIA 2HA5A 3LGSA 4F3KA 4CIVA 3WB9A 5LUAA 1Z34A 3TLMA 1P1FA 1BD3A 5DWDA 5HCNA 3ZW7A 1MU0A 1EK5A 1JE1A 3QBDA 1YZTA 5DOVA 3ZY6A 2VEDA 1R0XA 1I1QB 1ZCZA 3VYTB 3DUFA 3PA8A 5AHRA 4A27A 5EWMB 1T8RA 2RKBA 3EZ6A 1MA3A 3LVQE 3I09A 3IULA 3CZPA 3Q7IA 2PGJA 4L3OA 1TM5E 4LJAA 3L4SO 4MKZA 4Q3LA 3KQPA 1G7RA 1DJPA 1SUEA 2DH6A 2GHTA 1NVVR 3NWBA 3DZBA 4LX8A 5ELXA 1EESA 1E4YA 1ZSNA 3QMWA 3F6YA 4OYYA 4HWTA 2PLAA 1XDGA 2QVBA 3IS3A 3MQFA 5CVEA 1LB1B 3MYRA 1E6LA 2GKSA 1LDMA 2FWIA 4LI3X 3U60B 3TG2A 4M6WB 4PC3A 1USVA 5BWBA 2PJRA 2NZXA 2CBGA 2IKSA 3W3AA 4YJFA 3TEMA 2P1ZA 3EZLA 1PTJC 1XVLA 1Z6GA 4UUAA 4BRUA 3ZQ4A 2VA9A 3F7OA 2IYZA 3JD2A 2C9YA 2IL1A 3IT3A 2JHCA 3TTWA 3WGGA 4QXAA 5KQPA 2CDBA 2FJ0A 4GOND 2IT1A 3BN3A 3B82A 1OFTA 4WZ6A 2KQUA 4RAQA 4UTZA 4R1QA 4RS3A 3PEFA 4ZGGA 1NUHA 2V5AA 2P9JA 2CFCA 4ZOLA 5EQFA 1R3UA 4Y2QA 4EX7A 3DQPA 2I6SA 4XQ0A 5AW4A 1PJ2A 3KLNA 3ERCA 3LWZA 2AI3A 2NZVG 2FJPA 3AEUA 3P0EA 1W4CA 4Q16A 1JFFB 3W04A 2PUCA 1Z4NA 5C37A 2PUJA 4C3UA 5CP8A 4HG2A 1EVYA 3IAUA 3VVCA 1EBFA 3RRBA 2V4UA 2WJVA 3PIRA 3OTWA 4OGFA 1SBHA 2X0JA 5AT1A 1KE2A 4UDNA 3LCUA 3M6WA 4YP7A 3D43A 3GNTA 2MWMA 3L43A 3WP0A 4ZI7F 4Z4HA 3FE2A 5K99A 1HMYA 1TT7A 1NG1A 3DV0B 1X1CA 2O1WA 3F46A 1N2IA 1HY3A 2FG5A 4HAWA 4MIYA 2GAAA 2L18A 2CNKA 4G5RA 3AH8A 1IY1A 1U2EA 1MA0A 2REOA 1CPYA 3EBPA 1DXYA 1GL7A 2RI1A 2XSZA 1TC1A 3BAZA 4YPVA 5CB8A 5K8LA 1HUQA 1QGYA 2WLTA 4O2AB 4LJ8A 1UIMA 4GPEA 4LHWA 2QE7D 1B23P 1ND5A 4MVWA 4P7KA 2NVOA 2Q99A 5E4FA 3AI7A 2IPAB 1RRPA 2PS3A 3G89A 2XE7A 4FOSA 4L95C 1EWKA 1J0BA 3PXGA 5IVPA 3SHVA 2ZETA 3EDOA 4RZQA 3DTVB 1B14A 3H13A 3HFRA 4EM6A 5SZJA 4UE3S 4F38A 5HKKA 3S8EA 1O54A 3KV1A 3SY8A 1P0MA 2WU4A 4FR2A 3AO0B 3NAQA 1EZ4A 4UMDA 3ZJTA 2OV3A 5JH7B 4DIFA 4O63O 4OTZA 2VRCA 1UBRS 3FSGD 2P69A 4HGNA 3VTFA 3ZY3A 3RUCA 1P0PA 2IP4A 1OI7A 3B6MA 3ESZA 5JO0A 4HWKA 1SBYA 4P5DA 1C9NA 2Y1EA 2CXUA 4TUYB 2TECE 2D13A 2FZVA 3ZDBA 2BEVA 3JQAD 4OHYA 3JQ7B 2IU0A 2YRWA 4ER7A 1ITZA 2J7PA 2BI4A 3ZK7A 1JWBB 1H65A 1NDUA 3DLIA 5T64A 3DP7A 1L7PA 3VR3D 4X0EA 4YMSA 2O2GA 1VQ1A 3NV9A 1KVRA 1H85A 4YRFA 3LP5A 2VWPA 1K7XB 1SOMA 2ZR7A 3A6LA 3C3JA 4FWIB 4LS3A 4XGKA 4DEXA 3PBKA 4FMBB 3LY9A 1T1EA 4N03A 2G6TA 4QDXA 1EXMA 1FLDA 4BJ1A 2LTAA 5BV1A 4BNLA 4LDRA 1KI2A 4AN4A 5H68A 4BWFB 2H31A 4E13A 1FNNA 2OGUA 4B46A 2WJ6A 3GJ0A 2BF4A 2LCFA 4ML3A 1JS1X 3DVLA 4A2CA 2DCUA 2QZ4A 4D80A 4PRLA 3ROZA 1V16A 2JJYA 4KX3A 4Y9RA 1W36C 4M7WA 2C1ZA 1RBQA 2IPXA 5EFOA 3GN2A 3ECAA 2CLEB 1KY2A 3H9EO 3SS9X 4GIBA 1RR6A 2ZRBA 4R41A 2XBUA 3M6UA 2YQ5A 3NIGB 1WRBA 3I0NA 2WJJA 4I3FA 2V59A 1KDPA 4ADSG 1U7TA 3WB0A 5JSQA 5L7YA 5D2CA 1G291 1XKTA 2WPDA 3VPGA 4D9KA 1IXKA 4MGIR 4M0MA 4PYRA 5I7AA 3P2YA 2G6BA 5E6SB 4JC8A 2IIPA 5TPZA 4DB4A 2X5XA 4UUPA 5HIJA 2WWTA 1CRPA 1LPMA 5E9QA 3UVEA 3I2FA 4DSZA 1AS0A 4M7RA 3GG2A 3UXHA 2DBZA 3K4QA 1A7KA 1RYMA 1C4OA 3I8SA 4BNHA 5AKZA 1YK1A 3ZIDA 3F3SA 4PLZA 1K0UA 5IDQA 4QGFA 1RKVA 4Y2PA 3OMLA 4YAOA 5C8YF 2IODA 2WIJA 3JQQA 4HRVA 1OB5A 4TTRA 2QG6A 3IERA 3ZHZA 3RS9A 5JRZA 5K3FA 1WABA 2QRVA 3IJPA 3SS8A 4ARIA 1J0XO 2WFLB 2ZSDA 3K72B 3OX3A 4X24A 1ZNZA 4NICA 2XWBF 1OAKA 3CIFA 4DVGA 2NYRA 3GDFA 4FFWA 2Q6TA 1YJ5A 4UNRA 1ABBA 1X3SA 3IEKA 2PFKA 1VKOA 4JBGA 4YDSA 5C7LO 3MSXA 5HUQA 1NBMA 3A9TA 2ON6A 3I2JA 3KAJA 3N8NA 1L4FA 4KWTA 3UMBA 3BGIA 1H1LA 3G2MA 1VHJA 2RG7A 2C2OA 3MIZA 3PC7A 2PGAA 4FW9A 3SHQA 4E5UA 4KYTA 4A3SA 3B6KA 4OQZA 4ZVVA 4A6DA 2F90A 1OZGA 2ZT5A 1XNJA 1S4QA 1ZUWA 3PU6A 5FI1B 1JEOA 4ZP1A 5KHAA 3ROTA 1DWQA 3JQBC 2PE5A 2DB3A 2QPTA 1MOZA 2PGXA 4OMUA 2Q2VA 3UHJA 2G9UA 3KL4A 4FJ1A 4OK5A 4F3YA 1HLFA 3A06A 2Z4TA 2FZGA 3LQKA 4L9SA 5C5CA 3HJFA 2IPLA 1NW7A 2HRZA 2G1UA 1CQWA 3GGJA 2B7BA 2NTEA 1KEEA 1EG2A 3UA3A 2ZFUA 4F1JA 4EGSA 3VNVA 2J9XB 5DNUA 3CLVA 1VIVA 2C57A 5L3QB 1DJOA 1GRNA 1VYTA 2QTVB 1SCAA 3UJ3X 3TTVA 3USZA 5JNRA 4QQFA 3C98A 1C7FA 1SB9A 1I7QB 4J4BA 2C0CA 2IQ5A 5F2NA 3N74A 2PKXA 4S35A 1X0XA 3ZZNA 2GEVA 3H16A 1KSGA 1YB5A 3WRXA 3T34A 4F71A 2ZM5A 2HBRA 4PGMA 4C0HA 3AIKA 3D1LA 1VJ1A 5K8UA 2ADMA 5FR1A 1B3RA 1H69A 2YL2A 3MMNA 3GCDA 2I3ZA 1CQJB 1CUSA 2A59A 1D5CA 2CJYA 1JG6A 1EVLA 1E5TA 2VAVA 1R8XA 1AZTA 1J22A 2X5JO 3GF4A 5H70A 3U1VA 3DULA 1Y1QA 5FWYB 4GR9A 5LP6C 4A9AA 4DLZA 2C7OA 2R97A 4RV5A 3S5UA 2D59A 2CFRA 2O2YA 1JLLB 1H4TA 3ZD8A 2F1IA 3MMSA 3W5BA 1JMYA 4F1KA 5JNWA 4O1IA 1T9BA 5G4KA 1L5HA 2QG4A 2ZI4A 4Z99A 5T8KC 4EKGA 1AO0A 4GRDA 4GQAA 2ATIA 2JK1A 1D1QA 3NMUF 2AA3A 1TECE 2R6R1 3ZIAD 5C32A 2G06A 2JHGA 1IHPA 3PV0A 4BV9A 2FN9A 2ZVQX 3PNLA 4UAJA 3UWPA 1WMSA 3AHJA 4PPGA 1JDSA 3LQFA 4IQFA 2GN2A 4PZDA 1C7ZA 3PKZA 1U0RA 4HQOA 1UJ4A 1Q57A 2BYTA 2BMJA 4L0CA 2K5UA 3JYPA 3IDAA 4OU5A 5ERYA 1FS6A 4O2AF 4Q1AA 2NADA 2H1RA 4I55B 3B2QA 1DARA 2QYHA 3EVDA 1S2NA 4ZVUA 4Y0NA 4GI1A 4RIEA 3FLEA 4MR7B 1YOBA 3IEIA 2HL6A 3N6RA 3LOQA 1W5EA 4M0DA 4PZEA 4Q19A 2JAPA 4DADA 4NV1A 4OAQA 4GI5A 4FP9A 5AOCA 5ECDA 2PX4A 4GPZA 3VBCA 1P5RA 1SXGA 3QKRB 1U9JA 4OB7A 4OFZA 5I8ZA 4A8JC 4B81A 4BMVA 2C00A 3T4UA 3AKEA 1UCFA 4FOLA 2F67A 4Y9DA 5AESA 5DM70 3EUWA 4R4JA 2GM4A 2OOKA 2AI2A 1W5TA 4IKPA 3QVGB 4OGLA 1RRGA 5L4LA 4R1UA 4GWLA 5G3YA 5IVDA 2QD4A 1G5QA 3OM8A 4HB4A 1HETA 4QOSA 4D3SA 2VCEA 2ECKA 3IV6A 3WK5A 1Q2XA 1FDSA 1H6DA 3H5LA 5K2MA 4OLJA 2ORWA 2J9YB 1NHWA 1H5NA 1IUPA 3O73A 4GZ6A 3FNEA 3IVXA 1FVOA 2DWOA 1DJMA 5EJ9A 3G0GA 2GUGA 4FFPA 4TUYA 2H51A 8ADHA 6PFKA 4RHCA 5TF0A 2ZBUA 1FFSA 2GAOA 3CNLA 3DPIA 2HT6A 3FKJA 1M1ZA 4K1XA 2MINB 5I3ZA 5KWEA 3G79A 3HGMA 1UJMA 1E79A 3LQ2A 1XEWY 2DSNA 4TLDA 3S55A 3QQPA 2Q3HA 3WA6A 1JBKA 1EB8A 2O2DA 2X6QA 3R7AA 4WACA 4C7JA 3HCWA 3OF3A 4B74A 4BC0A 1ZVVA 1P3Y1 2YIVX 4DRZA 3IAFA 1XZKA 3TLGB 3BJRA 1KZ1A 1ZGHA 2CL7X 2PYIA 1C0EA 4G4JA 1BXKA 1OI4A 3OQ6A 4ND6A 4BBZA 2B34A 4M3NA 4EELA 1GNSA 4FLFA 1VL0A 3L49A 4ZYUA 3PFGA 4E0BA 4CT4B 3EIQA 1KYWA 1J8FA 2GKOA 4PYQA 2NUTA 3VJMA 3D2CA 5LSAA 3ILXA 2B20A 3PENA 4D7AA 1OC4A 1W59A 3T41A 3HCOA 4KP7A 4DR4B 1E0JA 3I9V6 4EJ2A 2FSVA 3KQSA 2HI0A 2X7XA 4KH1A 2MR5A 1T0BA 1CR1A 1RM4A 4F4DA 5K01A 2Z8YM 3KS9A 3OG9A 4G07A 4D0SA 1RLTA 1Q22A 3LUCA 4OAPA 3SFTA 1YKFA 4JCOA 2ODQA 1M2OB 3PQEA 3NI2A 1G1AA 1FDIA 2FW8A 4FYVA 3F0TA 5KNCA 1KK3A 3VO2A 2ZPTX 4URFA 4E15A 3AKDA 5ALKA 3KJZA 2EX4A 5DYNA 5LZ7A 1U1FA 5P8WA 4BGEA 3DBVO 3AY7A 2XMQA 1ZM7A 2ANBA 3SJBA 4GXTA 3OT4A 5BXQC 1NFQA 3T0IA 1NR5A 2B5WA 4A0FA 3FN4A 3MQ4A 2WP0A 1GKKA 1LEHA 1UBEA 4W9RA 2ZYAA 3WX0A 3KVVA 2OYSA 4P82A 4KWHA 3R44A 3VNRA 4WUTA 3KZ1E 3QUAA 3WLHA 5F3RA 5B1DA 1QOQB 2MU1A 1BWSA 1KZ7B 2AFIB 3S70A 1Q7TA 1IG0A 3H1BA 3U49A 3UMSA 4CKYA 1LNQA 2F1RA 3PT9A 1LSOA 3I01A 4RSGA 4B3CA 1WCYA 4CV1A 3VNUA 1O08A 5I7VA 2GSWA 1BE1A 3K0SA 1EGQA 4WECA 1NF2A 3EG5A 4MWSA 1T0UA 2VJBA 3FZNA 5IYZB 3ETDA 5K0ZA 1FU4A 1M6HA 4EFNA 4EPWA 4JQZA 1T8YA 3MAAC 5JJLA 1FQKA 1F2TB 2JIRA 4MI9A 5BSHA 3ELWA 4L2IA 4Z7JA 4YPOA 5L95A 4DCNA 5JS2A 4GKKB 2BKLA 4BVBA 3PNBA 3R5KA 4BN4A 3R09A 1V2HE 2P6OA 4PFKA 3IR6A 3HP7A 4FS3A 2CJXA 1YNOA 3EGXA 1CUCA 2NU7B 3OECA 4TVBA 5REQA 4WI1A 2VFAA 2EZTA 4FKMA 1G8GA 3UNXA 4B6PA 2NUBA 2O2EA 4H17A 4X41A 5MN5A 4IY1A 4NENA 1VDZA 1YQEA 5TQ0A 1BJRE 3LRXA 2ZE8A 2QR3A 2CXPA 1BVHA 3OHMA 2PX5A 5CX4A 1WV1A 2B4RO 5C5EA 3AY6A 4LW8A 1PJZA 2A4KA 4NDZA 2DRIA 2XDAA 1OIVA 1ZKMA 1RP1A 4BX9A 1DHTA 3MWDA 4GZ3A 4I4TF 3S68A 2AFHE 3CLTC 5BUQA 3Q2IA 5JE8A 1TZKA 1GD1O 1FP6A 1LPAB 1NP6A 4RZIA 1E3QA 2DM6A 4DUPA 1DLIA 3X44A 4DR3B 3VR5H 3NQ41 1T24A 4XSVA 5BSKA 3QFFA 3FPKA 4GAEA 4XGRA 2IA5A 3G6WA 1KQGA 1ETHA 1E7SA 3V2GA 1GVHA 3VISA 3PDHA 3Q9LA 1YVRA 3ENQA 2OZKA 1I3LA 1VZ2A 3AVUA 3AFNA 3IAXA 4GX2A 1WCXA 2GJKA 5BWOA 3A31A 3YASA 1HOTA 3W5UA 1J8DA 1Q7CA 2I6TA 2GYUA 2E89A 4ZRMA 1X42A 3TSWA 2IH5A 4A82A 4MUHA 4EH1A 4IGAA 3ROKA 4DQDA 4CFYA 3ICCA 5I9SA 2RI0A 1ULSA 3KQQA 1U0HC 1W5SA 4MRMA 3SIXA 1YAHA 3ADOA 4QEZA 4RZ3A 3QNMA 1DX9A 1Z6QA 4UUBA 4OXKA 3TIFA 4OMFG 3FFBA 1N9ZA 4OQEA 4AB1A 3EXEB 5LB4A 4ARBA 1VJGA 3T3EA 1JXQA 3N8DA 4YRLA 5CX1A 1YS1X 3UUWA 3BJIC 5DLPA 4CKCA 3Q8LA 4MHTA 1W0JD 1NQVA 1Q3HA 3D1JA 3BA1A 4AZ3B 1UC5B 3CZQA 4FNOA 1N6KA 5CIWA 4OVKA 1UJNA 5IDWA 4JLDA 2UYQA 2FH5B 2JLQA 2W6PA 1SY7A 4XARA 7GPBA 3EX7C 2ZXUA 1OAOC 3HACA 4U2DA 4V0SA 5J47A 4BP9A 3CPEA 1UFKA 1TYBE 1OFHA 3CWZA 3RR2A 4IJ5A 4DMRA 3R4VA 5C81A 2F43B 1E9DA 1T8SA 2YWBA 2O6HA 1T29A 1KMQA 1U0NA 1JAZA 2Z2XA 1CJTC 3V8PA 3AINA 1L7RA 2ZQZA 1LQUA 3CWCA 4R16A 2W58A 1P33A 1YQQA 2Z8YA 3FYUB 2BEVB 1V6SA 4R2XA 4L4SA 3DE0X 4FJ2A 4GBJA 2C2YA 4LGMA 1L5FA 5JDIA 4I6GA 4HVLA 3IKTA 4FZRA 1BIFA 1M2VB 1UPCA 2A5GA 4HL6A 5J58A 1J7KA 2GD6A 2GRAA 2OWDA 3LUKA 4HNGA 1BXZA 1Q50A 3K31A 4NU6A 3VUEA 4DMGA 4WJLA 3MTQA 1HOXA 2YVLA 3LO5A 3NKLA 4B7CA 3HN2A 2FE4A 2XNDD 3M6LA 5AW9A 5KC9A 2A3NA 5KTRA 1Q7GA 3V2UA 3QVOA 4J0DA 3VNQA 2VHQA 3OTHA 4EUEA 1Q1EA 1RPNA 2O3TA 2BH9A 2BMFA 4J03A 3GGSA 3EGCA 2XBLA 5JYEA 2XIQA 4Y7DA 3HZZA 4CUKA 2IS1A 5DZSA 2GYYA 1OV6A 4BAUA 1SXJD 5BSGA 4R7ZA 1WPRA 3VR2A 1G60A 3K6SB 3FI0A 4IINA 1FFXB 3ZD7A 2W70A 4MLDA 2Z04A 4R69A 2X7HA 1FNSA 1X0VA 4TL8A 1JQKA 3MTGA 1OIWA 4OSPA 2EBHX 3NIDB 4P34A 1LRJA 2EJWA 1H9AA 2VTKA 2BIFA 3Q40A 5BW4A 1IVNA 1TJPB 1SUCA 2C84A 3PXBA 4CQMD 3KR1A 2JD2A 1H2BA 4GX5A 5HGJA 4D98A 2QTTA 1W75A 1RVV1 2V6IA 1JZTA 4YFVA 4EA6A 1DJLA 1C8KA 1EDDA 1OHHA 1UWKA 3E2MA 3EQ7A 1RAIA 3DLAA 3IV7A 4KDFA 4UVEA 2PCLA 4WEQA 4XCXA 5FPSA 3RSCA 4C2AA 5J2TB 1QPZA 4MUGA 5DGXA 3NORA 4ENRA 4MPTA 2ZQ5A 3BD6A 4O5AA 3NALA 3GCGA 5FHQA 3RK1A 3Q1LA 3L18A 2C61A 4JX9A 1O9HA 1ZJ5A 1NVDA 3WR5A 3PC2A 4BXOB 4QOJA 5HFNA 1SIUA 3B6IA 2IBMA 1CXZA 4YUXA 1G6Q1 1GN8A 2JFQA 3WNZA 3TUJC 4DZZA 3FF1A 4U6SA 1O95C 1YCDA 4CI9A 1QR2A 1YDWA 1ZRHA 3N07A 3BXFA 3DO8A 3EH1A 4M9RA 1UXHA 3A2LA 1CY1A 1AVTA 1R0BA 1R6XA 2J0UA 2O2JA 3C6ZA 3N2LA 5KWSA 1PS0A 2A94A 4HAOA 3SD7A 3CURA 1I2BA 1W0CA 5FBLB 5FTJA 1YIDA 4UPDA 3KHTA 5AKYA 4QBTA 4U2KA 4S1OA 1A72A 1ZD3A 1S7CA 2DLNA 3HEAA 3X1YA 1E77A 1ML4A 5IKPA 3FNFA 4ID9A 4N7JA 4OYRA 1DJQA 2I1VB 4KJZA 1SHJA 3FDZA 4RY2A 1BGXT 1PW5A 1DAIA 1XNHA 2DQKA 2NZJA 3COJA 1CUEA 3C1AA 4CR8A 2V3CC 1PL8A 1QG4A 2A1TS 5FPKA 1XDDA 3MPOA 2G36A 1SVIA 2QGZA 4CG3A 4YALA 1FNBA 1OXVA 5DX8A 5ECYA 2JCBA 1HRDA 4MW5A 4C89A 2DULA 2OHJA 4GSLA 3SCZA 1XN4A 3AFOA 3DFKA 4Q15A 5BNZA 1NHGA 3UMMA 3G7UA 1BCSB 1EK0A 4WLNA 2X86A 5AVJA 1H2HA 5E8RA 3U3XA 2ZWOA 4Q5IA 3P0FA 3IPLA 2WJ4A 2B2NA 5EIEA 1UBFA 2CYCA 3TIGA 3OQJA 3WGIA 3MJEA 4MYCA 3R74A 1VFPA 2QLTA 3TGWA 4FM9A 2NU7A 3B8HA 3GLKA 1MQAA 4OQQA 1I3CA 4F6RA 2RGRA 1JA9A 3Q3EA 4OHFA 4BB6A 3ZY4A 1LH0A 1MH9A 2HK9A 2V7TA 4XCQA 2WKSA 4UBOA 1AURA 3CUEF 4RD4A 4ZHQA 1D2AA 2VH5R 2VVTA 2EFYA 2WE7A 2DHQA 1CQJA 4WW0A 3UK7A 4WBNF 1JIVA 3HMKA 2IWRA 1L1EA 4HK4A 5TVGA 2IHBA 1C9YA 3IQDB 3FUCA 2PZEA 3LC1O 4TTJA 1T1IA 2L69A 3QMVA 3S1SA 2B7CA 5EFZA 3MF4A 4U9IS 4CIYA 4PC1A 3PR2B 3D7LA 3U39A 1U1DA 5ILOA 3ZZUA 4JYCA 2CVQA 3AFMA 3T1HB 4ZOBA 3ZOZA 1F7UA 2AHOA 3C14C 4WIAA 3MSCA 5KQGA 3TTTA 1QVVA 3EIXA 3HL0A 4LY9A 4NYIR 3GBVA 2JD1A 4P7JA 2C94A 2F9FA 1W1IA 5KO2A 2C4MA 3C0KA 3CX4A 2PAAA 3L4EA 4OO3A 2PMBA 1GO2A 3TKLA 2JVIA 1QDEA 1V3UA 4C4ZA 4F4HA 4BE4A 1XZNA 3KB8A 4LY3A 4BDSA 2JA1A 2E5WA 4Q1BA 4EY7A 3OY2A 1ZJ4A 1DFHA 1FF9A 2H4HA 3GI1A 1G3RA 3D8NA 3WLLA 4C14A 1PK7A 4XFJA 3R3VA 1R9GA 1N1EA 1TA9A 3MOGA 3FRHA 4X1KB 3BGVA 4XDZA 4IGKA 4EFKA 3PQ6A 1GCAA 3VJLA 4ALKA 2BM8A 3ABIA 4PRZA 3DC7A 5A4KA 1OF1A 1AZSC 1DIBA 4KXXA 4PHGA 1IE3A 3T0GA 3WZMA 3ZZ0A 5HXAA 3A3OA 3DL7A 1Y7LA 1RFLA 2FB9A 4BLVA 1M1YE 2NQTA 3HCNA 3R5XA 3WKCA 1V8PA 1YVUA 4ID3A 3ETEA 3TAXA 1QRRA 2DQYA 3E1SA 4CL8A 5JCZA 4FKBA 2JCYA 5ICGA 3CLKA 5K4GA 2DUWA 1MJNA 1CY7A 1Z12A 2O2CA 3CE6A 1VLQA 3H9GA 2O0MA 4GOXA 4RIFA 1ZVMA 3EXAA 3GIDA 4UM7A 2IE8A 2WIBA 2WWRA 5BT8A 3DHVA 3U37A 4BTLA 1KAMA 2QY9A 3FYDA 2V6JA 2FP4B 1M2WA 2EX0A 2IHKA 2OVBA 2R4TA 3IAM6 3QJ5A 4HOYA 1K4KA 4OK3A 5H5JA 1Y5RA 3GLHA 5J4YA 5EIWA 2HXSA 1M0EA 3NEYA 3HB9A 5L6MB 4CI0B 4YA6A 1XCBA 3I9LA 2G4CA 3RIEA 3VDQA 2O8BA 1P31A 2FEXA 2VAWA 4G6ZA 2FDCA 3P32A 3HHPA 2PLWA 1KEVA 3KOZA 4RX1A 3VNAA 4O25A 4G5XA 3DYIA 4WT7A 1XXLA 1ZJJA 2VJMA 3KVYA 2YXEA 4U5QA 5GTDA 1PUIA 1Z0DA 2RHOA 4AURA 5A3QA 4O2BF 5JVDB 3BQ9A 3E35A 5B1HA 4HLUC 3QFSA 2ETVA 5CFLA 1CG6A 1NSYA 2WK1A 2QXUA 3ITKA 4XASA 3AKZA 1PT8A 4L8WB 1NULA 3HCAA 4QVGA 1KVSA 1OAAA 3AEKB 4RF3A 4CV2A 2OC4A 2BFEA 2HA4A 1HDEA 4XM2A 3AR4A 3FFWA 3LV8A 4H0CA 4O59O 3CXRA 5EAIA 1CVRA 2Z0MA 3AX6A 4DILA 5JXWA 4HFMA 1PBTA 1U7PA 2IYAA 2O8FA 3WWYA 1C8LA 4AJJA 4P5PA 4ZVSA 4YAUA 1P6QA 1VL2A 1TZMA 3SMVA 4RPIA 2JFVA 4BNGA 4EIWA 1Z2NX 4R6XA 2PH3A 2G09A 1PL6A 1TM7E 3ZI0A 4D4GA 4S1PA 5COQA 1WOYA 2FRDC 3RU7A 4EI7A 5DV9A 2ZGVA 2W5UA 3SHTA 1UXJA 4Q1EA 1WW2A 2GPNA 1L7QA 3D4NA 1E4EB 4AK9A 3L2OB 4NF2A 4YAIA 1A4IA 1WEKA 4DMMA 3NTUA 2E5FA 2ECQA 5EGNA 3FBTA 2K2QB 5H8WA 5H4GA 3NVKI 1PU2A 1MNAA 3Q4GA 4UHFA 5H81A 2ZI7A 5CYOA 4E6PA 4J2OA 4FXOA 3M49A 5CT6A 1MKYA 2RARA 2W2QA 2AQ8A 1XMXA 2CF6A 3UW3A 3M2PA 1E6CA 3ED1A 5KKAA 3L1UA 1NFRA 2ZB2A 1E2HA 4B17A 3U44A 1U63A 5MN6A 5FFNA 3AV0B 3E1GA 4Q6WA 4YO8A 5BYKA 3TVTA 1MORA 3RSGA 1FBTA 3TYXA 3KYDB 1HQKA 1PP4A 4DC0A 4Z9XA 2G72A 4X1IA 4BQNA 1DZ3A 4KV9A 4XM0A 2MYNA 2RB4A 1DAKA 2W6ID 1R37A 4H6XA 4PNHA 3KLOA 1XSEA 3SZOA 5C8XA 5JROA 1NQWA 3HO1A 2BGNA 3NHSA 2OZLA 3WLQA 4HY3A 2IYWA 3BB1A 1K5DA 3C3XA 2G8NA 2CHQA 3L41A 5FT9A 4CMJA 1JB9A 3KWFA 3QBTA 1DQNA 2AFIA 1JG4A 1Y5MA 2C59A 3UW1A 5GONA 4ZZIA 3W4JA 3PQ7A 1M75A 1AXRA 3ELYA 4BQRA 3T06B 5A5DA 5DGCA 4H4DA 4C4OA 1ORTA 2CHVA 2LRHA 2QROA 3VAYA 2QJTA 4F97A 4WKOA 5BSEA 2F7SA 3DCIA 3KP1A 4CIDA 3MGGA 3LZCA 3VVBA 3UO8B 4DRYA 5SV2A 1RABA 1U80A 4XQ9A 1J2UA 4Z9YA 3UCFA 2VQFB 1C2YA 4G4SP 3K30A 4RQAA 3FDZB 1PJLA 2AKYA 1PVDA 2CNWA 4QREA 2FZLA 5IWCA 1BQEA 4BZPA 3RAGA 3WBJA 1K6EA 4EITA 1TPYA 1WXDA 5EWJA 2EQAA 2BUBA 3QUSA 1VPWA 5ED0A 1NJ1A 2ISCA 1ISPA 1DEKA 1U3FA 3RYTC 2JJ8A 1I8TA 2KSQA 2NWQA 1C0IA 1OLOA 1C3OB 3P4UA 3VQTA 5ES4B 5AVKA 1Y4UA 4FZVA 1MLDA 3W8FA 3LRTA 1EXVA 1FFWA 5EHNA 3BIFA 3LXMA 3PUZA 1XAIA 2EYQA 1R8SA 3IGFA 1J2TA 2V5VA 2A0XA 1U6JA 2FPOA 5BN1A 5IWAB 2JAUA 3KJNA 3RUEA 2C8LA 4Q66C 4EGJA 4PE5B 2Q5QA 1CLEA 4IF4A 5F12A 3X1ZA 1EXWA 2A86A 1F14A 2OYCA 4AO8A 1G9TA 4PO3X 3QG5A 1XPUA 5YASA 1DL5A 2GBLC 2NO4A 1CTQA 1QZUA 1UQTA 3SEFA 4B45A 7REQA 3TR0A 1U0GA 4QAQA 1J8MF 3D3NA 4ETNA 5I9NA 2WKQA 3C70A 3W9BA 2H92A 2WF6A 4F5EA 5A5VA 1MAHA 1SA0B 4DLTA 4TKVA 3F8SA 5K20A 1J2JA 2H08A 1O0CA 4MDYA 3S81A 2PO7A 5IU6A 4FYMA 4JENA 2B7LA 1KI3A 5L51A 5FEMA 1ZOOA 4DJJA 2HQ1A 3A1WA 1JDTA 3FETA 4NZYA 4Y6PA 1AXGA 1D7AA 2V55B 2IOFK 1DE0A 3FB1A 3KRTA 3LVBA 5CBPA 5IFKA 3B70A 2H06A 2EF0A 1JHAA 2VT2A 5LBIA 4KXWA 1UBOS 2VSNA 4RMNA 3IP6A 1HG0A 1OHHD 1QK5A 4Y6GB 1Z22A 5JXHA 2CFTA 4POAA 1VHWA 2P6UA 2QQ0A 4FHDA 4BN0A 4BUJA 3I61A 3Q7RA 1WXXA 3BMOA 4ARUA 1JQDA 4PAOA 1Q0LA 2D8MA 3HKBA 1RLIA 1P75A 3NWPA 5AH0A 4Z3OA 4KR7A 3I0MA 1PZEA 1FFCA 1RWNA 4XTRA 1NN1A 4K9LA 3V5NA 3LCVB 3TCKA 4DIEA 3I01M 2CKDA 1HQCA 1Q0UA 5JD5A 2HU5A 3P45A 2GVDC 5FF9A 1U2GC 3ON5A 1EHCA 3DE1X 3NLLA 1FDUA 4RKRA 3VR4D 5IJ9A 2J3EA 4B44A 4H7KA 4MV5A 1XTTA 5K1ZA 3WWCA 3BA6A 1Y6ZA 2OGSA 4OP2A 4INAA 3V4FA 1KYXA 4HTAA 2GI4A 3K9LA 3LK7A 3EMKA 3MWEB 5IKEA 5LQUA 3OKAA 1N36B 1L4YA 2ACVA 3H3XA 3HJAA 1B8UA 4AYTA 4A8PA 4RS4A 1V71A 4MV9A 2R1ZA 2AOUB 4HWSA 5EQTA 4J6FA 3WGMA 2XTJA 1BCSA 4NJEB 1BN7A 1V96A 2P5YA 5DHFA 3VZDA 2DPGA 5EQJB 4K0KB 1D0VA 4TV9F 5DASA 2X8AA 5DT2A 1KR5A 3A9WA 1YDGA 1U7OA 1ZVJA 3VX4A 1Q44A 3JXEA 3CEMA 3U16A 4DAEA 4G0WA 3LI2A 1EFAA 1JSCA 2JBHA 3HGTA 4K9RA 3IUNA 3KO8A 4R40A 2NU9B 3S99A 1Y8QA 4DM4A 1QTQA 2PIDA 3R3HA 1RPZA 4J0QA 3IBYA 1PT5A 4EVQA 1OA1A 3ZHXA 5T57A 4YJFB 5LXTF 5FPPA 4AULA 1JDBC 2QMZA 3H2KA 3HBMA 4MB2A 4OQFA 3TRKA 3ISJA 1B4DA 1MB0A 1D7OA 3SNHA 4FFRA 2W6QA 3PWKA 3OIFA 5FX2A 2AVDA 5KNBD 1FFXA 3EBLA 3QI2A 5KINB 4YY3B 2BR3A 3SQLA 3ADPA 2BFMA 2Y1DA 1DX6A 4O1HA 4M9XA 1OXBB 3UFBA 1JYSA 3ET5A 4UEQA 1ONOA 1K8RA 4NOKA 2QRQA 3A04A 3KBOA 4F4JA 1N75A 4RACA 1KAQA 4OJYA 1E59A 4OHMA 3GRUA 5BRNA 2UU9B 2PUEA 4LECA 4ZYZA 4MYRA 1NU8A 1VYUA 2GZ2A 4PPYA 2Z83A 1G9XA 1QBGA 4XJSA 2CK3A 4L3VA 1R0SA 3FHOA 3L84A 4J1SA 4JKIA 4LIPD 5ALFA 2R4UA 1G5FA 3E3MA 3LCJA 5TQVA 1A2QA 1G8FA 2A9KA 5DFAA 5J43A 4D26A 3WKDA 4S0XA 3WSTA 5I3CA 1KNQA 2G0TA 2K2WA 3DDZX 3MB8A 4OBBA 4ZO8A 1KZHA 5TT0A 2BH2A 3PFCA 1ZX1A 3ELBA 1KXJA 1QRDA 1EX6A 2I2CA 3ACDA 3AI1A 1WP4A 3G0OA 1Z82A 4DPLA 3WISA 3MLAA 3NM6B 3M70A 4IVRA 1LK7A 2YH2A 3Q87B 3SQWA 4D9BA 2Z6UA 2J6IA 3HU1A 1ISJA 4RXTA 4YAWA 1QB7A 3WNQA 1QU3A 3R0XA 4R0NA 2HA2A 2QZZA 1QMPA 5TSDA 4MYUA 1QIHA 2L82A 4M9UA 5HQTA 2PUVA 2NG1A 1RIIA 1HYEA 3OCVA 1VIMA 2AVNA 1ECBA 4OKIA 5KTKA 1Z88A 3RYHB 2OD9A 4GYJA 1N3YA 2HJRA 3DDHA 4XEUA 1ML3A 3PGVA 3NHZA 4XX0A 2MSDB 3K9WA 5IYZF 1YB6A 1M54A 2FY8A 1XTQA 1CVLA 1E6UA 1X1TA 2HD4A 2JKVA 1TMGE 2WWXA 4I1IA 4BFWA 5A4JA 3DSRA 5CRIA 1SQ0A 4HDSA 3E9RA 3MT9A 1PJTA 4JXKA 4DG9A 4B09A 1BOOA 3QLTA 1G66A 1PL0A 1NVFA 2QUIA 2WSIA 1P9OA 1XLWA 5FNVA 1MHTA 1GDTA 2J8ZA 3FCOA 1FIUA 3G85A 1XU9A 2BN4A 4FGSA 1I6LA 2GPTA 3L7DA 3W06A 5I9IA 4DREA 4DN6A 2GCPA 1KJJA 2RD2A 5CM8B 4K3UA 3RIGA 3U7JA 4NU0A 5K0BA 1CY6A 4WINA 2ODAA 3G0IA 1M8KA 4NXMB 4GMHA 2J48A 5IHXA 4PONA 3L7NA 4YRRA 2CV1A 2VUIB 4RPJA 1QF6A 4R1OA 1AD2A 1R6AA 5ENVA 1X70A 1NXQA 1US8B 2FWMX 1WG8A 2XMRA 1GSHA 1P4RA 4MJ3A 4NYJQ 4RO0A 4H7EA 2BBOA 2DE0X 1Z0UA 3B13B 4HEA6 1XCGB 1ZOIA 1FVHA 5CB0A 4G5OA 4D02A 5FTLA 2J4FA 4CM1A 5GOTA 3IPAA 1D6JA 3WHPA 2EERA 2O3RA 4QGBA 2Z3VA 1MTZA 5KVQA 5JQGB 3R76A 2C7PA 1EMDA 1PHRA 2D1QA 4P7GA 1TQHA 5KYYB 4EPTA 2WTMA 2B1GA 3RWBA 5F64A 4MO9A 1MF7A 1U2ZA 3E3NA 3EC1A 4N3GA 4BGDA 3BK7A 1T36A 4XOIA 1FFGA 1PZGA 2YWCA 3VR5D 3E5MA 5AYVA 3HZOA 4IXWA 2O3UA 1ENPA 4B32A 1P4GA 4BVGA 1SC3A 1LGYA 1XHEA 4I55A 1VRCA 1SUSA 4BYMA 4S1NA 1UJBA 1M76A 4DW8A 3PEWA 2GK4A 1SCQA 1NLFA 4CE6A 1JH8A 1KZ4A 3JQ6A 4OHKA 2D7DA 2ZANA 3GEHA 3URKA 3GG9A 5ALMA 2B3TA 2VWQA 3F7TA 4U0KA 2B21A 5E3IA 3SM3A 3T1OA 4X5OA 3HYLA 3TSZA 2YVQA 4ZYYA 3NDJA 4MRRA 3GFPA 4J29A 1D07A 1FSZA 2CB0A 2GK7A 1Q1GA 2R60A 3ESXA 4H0NA 4R9SA 4U2FA 5K3SA 2OFPA 4WK4B 4EGAA 4TYPA 5AO9A 1K63A 4TRNA 4X1KA 5KTSA 4D8WA 1OYWA 2HIHA 1IXYA 3OZ7A 3IQXA 5G2OA 2NM0A 4J3NA 5L9AA 3NUZA 1TGVA 3PXXA 1JMKC 1WXIA 4BV2A 1X9IA 4TKMA 2HV8A 1UOPA 2C4TA 3A1TA 4WNAB 5EJMA 4II7A 3UT0A 1NVAA 3KOMA 2ZUSA 2JFBA 3VOTA 1NOIA 3BQNB 3E18A 3FDXA 4NQZA 4PR0A 5FOUA 1B6SA 5FAKA 1W88A 2YN4A 4YJ2A 1GTRA 1MC5A 4QOEA 3FMGA 5GP1A 1U2TA 5IZCA 1YJQA 5IEJA 1I30A 2HRCA 3TMYA 3VC2A 1BGWA 3ZV5A 3REFA 1OV4A 2DWUA 2VNIA 1S9DA 1I3KA 1Z25A 1I1OA 2FN7A 2JZOA 2XAAA 3DDCA 3DFUA 3B5JA 3FCUB 4W8GA 4BRZA 5JS6A 3VVLA 5KNCH 5J4KA 3H11A 3LHFA 3TS1A 3RTGA 1OGIA 1VMIA 4DBLC 2DGDA 4I08A 5C3UA 2RB5A 4ZTBA 2O2IA 1XQ1A 2LDBA 1MIOB 4BVJA 2FXIA 3L5KA 1SC6A 2G80A 1NQXA 4J7UA 5DEIA 1LW7A 2EKDA 1O97C 3NNNA 1HDIA 4HDAA 4MAMA 3AUYA 5EWJB 3A4TA 2G08A 3CKLA 4P83A 3NATA 4LWOA 4B80A 4QD3A 1J5XA 4DA8A 1XWFA 5BORA 2PUGA 1WXHA 1XWIA 3ORQA 5JDCA 4WXPA 3TPCA 1PUXA 1CJKC 4UU0A 3GZNB 5IRCD 2FQ1A 4C78A 3L6CA 2PH7A 4ZD6A 4NG4A 3OJLA 1J0AA 4MHSA 2G9VA 1QX3A 1OXTA 2OFWA 3COWA 4RKEA 4HXFB 4QOGA 1EUQA 2XQFA 1QF7A 2IHTA 3JD0A 3EAFA 3FKQA 2OK7A 4XPIA 3WRWA 4D9EA 3G82C 4Q9KA 4TTAA 4ZTZB 1Z28A 2NU9A 4I4IA 4MXDA 1Z5NA 3G0BA 4HGRA 3OI7A 3IODA 1ZN9A 2XIJA 4ABTA 4MDEA 2UUPA 1YB4A 1REQB 3RUHA 1FYDA 3DE2X 1W4BA 1XFDA 1G98A 1VJ0A 3KLMX 1CRQA 3STUA 4D0RA 1WPGA 3EWAA 3KOWA 3UAGA 4X8LA 2J59A 3EA4A 1U31A 3ENKA 1FYFA 1ECGA 4Q4AA 5J2UB 4BLSA 5CB4A 1HK7A 2AUTA 2GPWA 1MOPA 1YOVA 1N0VC 4B6SA 1G8KA 3QVWA 1T91A 1QKKA 4GLLA 4RTOA 1FCJA 4JP2A 1G55A 3FCEA 2WF9A 1AQIA 4DUZB 1VZ3A 2F3QA 3W79A 1D6SA 2MSCB 3VYWA 3RV3A 2IY8A 3BFJA 2XRFA 5BR8B 2I62A 2JHFA 3P0HA 1Z6XA 3O74A 4NCJA 4JT4A 2P6MA 1Z4MA 3M9LA 3C3PA 1KQNA 3V34A 2H4XA 1Q6YA 3PUVA 5AKEA 4ZCPA 5TQ2B 3QXSA 3U44B 1JR4A 2HJHA 3O3NB 4PLYA 3T3GA 5AJVB 2NSDA 3EODA 4TKUB 1ZGAA 2NZYA 5DCYA 4TYNA 3WV4A 2AFVA 1OH8A 1LK5A 3UAZA 2WYVA 1DRUA 1FLAA 4QFBA 5JXIA 4W5OA 4DLWA 3D3WB 2J31A 4L4ZA 1ODTC 4BO8A 2EBFX 1UFRA 4PBRA 4QOIA 3UATA 3NHWA 1ODJA 1Z5WA 2XNKA 1O97D 1J70A 5EJ2A 4AP5A 1J07A 3IDOA 5F7XA 4L6IA 4M46A 4XAQA 2GVNA 2PKEA 3RC9A 5HQ3B 2Z30A 3ZYCA 5DBFA 2G5CA 3V46A 4HBGA 1O4VA 2MSLA 1V6CA 2EHDA 3KZMA 3TAUA 1Q19A 2AKEA 3K20A 4BCBA 1SBZA 2GBIA 5IN5A 3A9CA 3ZKAA 4CMHA 4JK3A 2ANCA 1KK0A 3SJAA 4MS4B 4F5YA 2IYEA 3M6IA 3U7QB 5HBGA 1ZRNA 1SVNA 5JNSA 4EKYA 1RRKA 1JXMA 2VTEA 4A8JB 3ROXA 4F85A 3I62A 3A0UA 1IJEA 1OX4A 3EYWA 1AUPA 1X92A 2HBQA 3T7RA 4ZJUA 3W34A 1P6XA 1RM5A 4OJKA 5MDHA 5E6RA 4TWJA 4DDMA 1W1UA 3CLUC 4TXLA 4QFCA 3T1YB 3M33A 2GEJA 1F0YA 1E0KA 1Y8QB 3B9BA 5JASA 1G7CA 3E9YA 3PQDA 2ZIGA 3AOGA 3JD1A 4WCFC 3HA2A 4RZSA 2C42A 4QG3A 3IP3A 5AM4A 2H1HA 2BBTA 5AVXA 1TTTA 2O5EA 3I2IA 1JKIA 1ZC4A 1T6NA 5BMVB 4HQ0A 2FKAA 4FMPA 1TMKA 5CNJA 1B0UA 3FH0A 4J0HA 1MJGM 1XAJA 2ECPA 4B8YA 1GKYA 4XWAA 4D9GA 1M7BA 4D0GA 3TQFA 5C4IA 5C18A 1PR9A 3ZHSA 1X14A 2P8SA 1KO5A 4FZJA 1US8A 2JI6A 2ONYA 1HO3A 2PMKA 3MWKA 3IPRA 1E61A 4Q1CA 5EIHA 3TNYA 3GPIA 1H4VB 1SHTX 1K5HA 2HB6A 7REQB 3I52A 3GJZA 1A97A 1JUDA 1XT6A 4QQRA 1IN7A 5LP6B 4DR7B 3W1VA 5G0VA 3M34A 2R62A 3LNCA 4CDMA 4KACA 2Q07A 4HX9A 4R05A 4XYEA 2C95A 1E4OA 1XCOA 3GFRA 1NMYA 1R0ZA 3IBGA 1YU6A 3RCBA 1IHDA 2BKUA 2COKA 2GEFA 1VG0B 2MSEB 3X0DA 2QUKA 3GMSA 1IBRA 4LWPA 1OPRA 6ABPA 2YFKA 5KVVA 1PR5A 2OBXA 3G5UA 4DDVA 1QS0B 3BRCA 2Q6OA 3AJ9A 3NRBA 2YIDA 1M34B 2OENG 5GIPE 4P84A 5K0GA 4HZGA 5I7OA 3W5DA 2ZVPX 1CJSA 3N86A 3TQCA 1RM3A 3LFTA 4XD7A 1U9ZA 1BJTA 1E6MA 2AOTA 3FGPA 5ERGB 3F71A 3U3KA 3T12A 4C3VA 2YIJA 4JJ4A 4DLXA 4DQUA 4DYHA 4WQMA 3SBOA 3ICPA 4N0PA 1ZXXA 3GFBA 2X76A 2P2DA 3KEOA 4DXDA 1M2VA 2TMDA 2A84A 5KHOC 1YF3A 4YUYA 1XNGA 2FMHA 1GU7A 1WCV1 3F74A 2BEKA 1EQAA 2Y77A 1C80A 3P4XA 4BKOA 1S2DA 4HX2A 1QYWA 6REQA 2D1SA 4Z4IA 1Y3IA 1NUPA 2O7SA 1D2EA 2Q5HA 3TW8A 5KZMB 2PD3A 3O9ZA 1Y8AA 3RANA 5GOZA 3CLUD 1DO0A 4BMYA 4G0MA 1QFMA 4M6WA 4OA8A 5KTNA 1E64A 2CWDA 4ZQGA 2QK4A 4Q9LA 3O91A 3C3BA 4ZEVA 1T8WA 3X1KA 4YRSA 5EOVA 3KELA 4IZ6A 1A4UA 3IP1A 3WL5A 1I4DD 2DU8A 1WCIB 1CX9B 3E58A 2P9HA 4JGIA 4MVJM 1TPZA 3TLAA 2JBAA 1LTHR 2GHQA 2VEOA 3PWZA 5A0TA 3SR4A 1A9PA 1TGYA 2CZGA 1MIOA 2WNIA 1RXIA 2PVSA 2QDKA 4XQGA 4H77A 2ATEA 4JLOA 5AK3A 1FYEA 3WXMA 2GT1A 4DRXB 4GVPA 4OLBA 3KWLA 5C8YB 3E0QA 5AXBA 5C9ZA 1XJ5A 3PGLA 5C7IO 2H5IA 2DWCA 2XVZA 3VOSA 3DXYA 1F48A 3OQPA 1XZFA 1Z17A 1Y4ZA 1TUEA 3HJCA 3RRZA 3ZGLA 3EPRA 1FDWA 1RXYA 3UB3A 3JZIA 4DIBA 1MC1A 4BQSA 4F1WA 4NMHA 1WA5A 2BZ0A 3HE3A 3OETA 3OPYA 4WCFA 2CL6X 2HSWA 2P4EA 3KQUA 1X94A 1NYRA 2ZQYA 5IKOA 3MERA 4AMBA 3K4PA 4GUAA 2XCSB 3ONWA 3U7GA 2ATCA 3Q7TA 1MENA 2W6OA 2ZI9A 4GOMD 2ET6A 1PV4A 3PEYA 1J56A 4JLBA 1YRLA 5JY1A 5I47A 4XTCS 1XLVA 1H2WA 4HQLA 5DI9A 5F3WB 1MT3A 4E14A 2H57A 4BMNA 1XOIA 2QRNA 3C3YA 4NJMA 4MRPA 1UL1X 3ZBPA 3LUBA 2EG9A 1EBBA 4YGYA 4YMVA 3WO0A 1R6DA 2FWPA 2JW5A 4XIGS 4AROA 1D1TA 3MW8A 1H6CA 3AEXA 5DHSA 3BORA 2QUHA 1Y6FA 1BZYA 3HR7A 1ISFA 2X23A 1PQUA 3CPHA 2YZMA 3HCEA 4MEAA 4WNYA 5KOYA 4COOA 3CSSA 2JS7A 4ZVKA 5K7SA 4R0MA 1PJQA 1V1RB 3F7NA 2BEUA 4RVFA 3EFBA 3EVFA 3MMZA 3ES9A 3PQFA 4IFIA 4PANA 1Y9EA 1Z6PA 4TLCA 1XZEA 3U4MA 3VFDA 1ZIDA 2ZUWA 1J7JA 2RBGA 2VSFA 1ESZA 2IQIA 3QV1A 4OGKA 4RBNA 4KQCA 1R74A 1QQTA 3FB4A 4G86A 521PA 1HWYA 3SNKA 4LF4B 1Q11A 4UZSA 3V3TA 3L1JA 4FGLA 2N75A 3DOCA 2FAXA 4UATA 3BVPA 5K6AA 3CF6R 1YTUA 3ZGZA 4L76A 2NQ8A 4QECA 2LVBA 1LV7A 1PX0A 5DBEX 3PEUA 5KQRA 5IF9A 4C0XA 2Q49A 2YY6A 3EZ2A 2Q8NA 1O5IA 2YKGA 2RK3A 1GNVA 1XQ9A 3HB4X 3HQ4O 3RC1A 3WO1A 1Q83A 1SH7A 3W5HA 5JT1A 1NV8A 4GZMA 1A8HA 4LHEA 5T4HA 1W7AA 4RVOA 4PZUA 4WZAB 1P0IA 2C92A 2A1UB 4JC5A 4E5NA 3REOA 1VTKA 2XGSA 1DPGA 1AS3A 1Z56C 3HZRA 1U2PA 4M83A 5H3CA 2HF2A 5LN1A 5H3LA 4G0UA 1I2MA 1PNQA 1RXSA 2XQKA 3SEZA 4NCAA 4JOSA 1UR5A 1I6KA 2HWXA 5BOSA 1GTMA 1NKSA 2V7UA 1FW8A 3U3JA 1HFWA 2YJTD 1UZNA 1Z0FA 5DEOA 4W99A 3EZGA 4UEKA 3DV2A 5HTKA 4FD2A 1UKZA 3DF7A 3A9VA 2JIZD 3PJGA 2R751 4G9BA 1P8JA 2OCAA 3FWKA 4HATA 4MCIA 4XPIB 5LZ5A 4YMIA 1JIUA 3ESQA 5KYGA 2ZKLA 3WLEA 3Q10A 1WUIS 2AD1A 1UOOA 4BLRA 4EO7A 3PXUA 2DT5A 3UK2A 1B8NA 4CM7A 4TZ6A 4P54A 3UQZA 1R50A 5HZMA 2OB1A 4FFBB 2HJ9A 3O4IA 4HN9A 2JFNA 2X0KA 2RG1A 1ACJA 1TAHA 3B20A 1X7YB 2E6KA 4FI3C 5DU2A 4QGHA 3C2QA 2QAGA 3HXMA 4DR1B 4LCEA 2WZQA 4LJSA 4CN8A 2I2WA 4W6QA 2PL9A 1PDVA 4IVPA 1UPFA 3G9ZA 5K2OA 2NP7A 4LMPA 4KCGA 4YP1A 3N5CA 4YLGA 4MVJP 1NVEA 2DPLA 4KXLA 1S8FA 3W5VA 3AQIA 1QGUB 3VI3B 1AKVA 2CVFA 4DHEA 5EJ4A 3OIVA 1H1DA 1T9GR 3LL4A 3EXHC 2R6HA 3DL4A 4Z4QA 2F9LA 4QWWA 1OC2A 4K9KA 1RJEA 2GFQA 4W5WA 4X8OA 4BE7B 2UXBB 3GLQA 3IALA 3HVHA 3EJWA 4V0ME 5HRCA 5IC6A 1CZLA 4PM4A 2V9CA 1DIHA 1I4EB 1R8JA 4K6FA 1E32A 2NO5A 3BSWA 2OZPA 3NJRA 1DBRA 1UOQA 5ERXA 4I1YA 1KI7A 1VKZA 5GJWC 4MIOA 5KOHB 3OTGA 3BF7A 4D56A 4YUVA 4QTTB 5G53C 1D6MA 1L8XA 4CGZA 3D6MA 5EINA 3LBHA 2YJ6A 2IBSA 5DWVA 1FNMA 1FX0B 4EEZA 1I14A 1PR6A 3OY7A 1EP2B 3AU8A 2DZDA 3ZI4A 1J21A 5EA2A 4KU4A 2JJ1A 4ITRC 1WIWA 3I5YA 1II8B 2Y99A 2VJPA 4MW6A 3CCFA 4AXXA 5ALVA 1C3VA 3BOSA 3T38A 2C8JA 1YBVA 2FGKA 3FVQA 1BEUB 2QRZA 1NRJB 3G9TA 2D54A 3PLNA 7ADHA 1XMIA 2OO3A 1IIBA 3G8DA 2VLBA 2DC1A 2OXRA 3KUCA 5E4TA 3AR3A 3O9MA 3OICA 3EPPA 1KEEB 4S12A 5FUVA 3TIVA 1XD8A 3V00A 3WHKA 3DAFA 1URPA 4JBWA 3KJEA 5CAEB 3TZLA 4EDFA 3USCS 4YRBA 5A1JA 1DB3A 1A7JA 3AJ8A 4EPXA 3K1JA 1HKHA 5J4VA 4J2HA 4PG5A 5U1PA 3OEHD 4IXMA 4NFHA 1CUYA 3IDFA 4UVIA 1COWD 4J90A 5FAXA 5KTPA 3CX6A 1J8QA 2X22A 3HYNA 1UKBA 3CG0A 3O4GA 3QPBA 3LA8A 4JJ8A 5NLLA 2YWEA 3B9QA 1ZCJA 4F72A 1NOJA 3D6UA 4KR2A 3VV3A 2AKAB 2CLCX 1TCVA 3UHAA 3E2IA 1JIJA 1GL9B 2V58A 2CNNA 4UQOA 1KU6A 3DNFA 1ZGGA 5LA6B 5FDFA 3V1UA 1KH1A 2FF7A 5I7UA 2OC9A 3LBNA 3B51X 3L7AA 4W7HA 1HQYE 3QGMA 2CLOB 3V42A 4NDAA 3GPLA 2HK8A 3U0VA 3W7BA 3VPAA 2D5CA 3IBFA 3TTXA 1XDWA 2NSHA 2B3DA 3IPYA 4P22A 3STXA 3OFJA 1M83A 5JHGB 3N9IA 2P2CA 4DIUA 4H7FA 3ZY5A 1MX9A 1JEQA 3P2MA 1IN1A 1U2RA 1N1DA 2WIDA 1TE2A 2BKAA 3O4VA 2R4QA 5AI5A 5KNBH 1XZCA 2GWRA 3MZ0A 3H5NA 5JCXA 2WPNA 3EGWA 4O2AA 4DA7A 1LY1A 1I2DA 3EXHA 2YMQA 4RHYA 3HWWA 1RC1A 2IUEA 2Y27A 4D9MA 1YXMA 5DP1A 5KVSA 3M1YA 4WLEA 1OYOA 1ZGZA 4WBSA 3IA2A 4TWAA 4W9NA 1T5TA 4B8WA 2ZUCA 4Y6QA 4EHLA 3LE8A 2C58A 1CQZA 1Z5OA 4UARA 6Q21A 1QFYA 4XR9A 3JASB 5EERA 3MGKA 3O31A 1Y8CA 1LNSA 1F6BA 1WWKA 1IRXA 4ISCA 4LE0A 4MX8A 5CPBA 3WJAA 4QPZA 3ZCVA 4DY4A 2GN0A 1FLNA 4R9RA 1M6VB 1V25A 2EFCB 1TJ3A 3BWVA 2Y68A 3VZQA 1ZIOA 4B2PA 3DZFA 4FINA 1E0AA 4M53A 1JB1A 4NBVA 4Y1RA 2WHEA 4J0FA 4EPYA 3NC0C 1E18A 5GGXA 3ZXUB 2DXIA 1ISGA 1QC5A 1UBCA 5CDHA 4OI4A 3GAMA 1R5OA 4TKUA 2JKZA 4Q05A 5HX7A 4D6YA 3LOPA 3OPYI 3PRYA 4I50F 4KFUA 4DMLA 4PC7A 5A6SB 4K6CA 5F3DA 3ENVA 3FPFA 3QVKA 4OQXA 5BSUA 1E7MA 5AR1A 4F8JA 2PUFA 1AKTA 2RIPA 3L02A 5CK4A 3NTRA 4KPYA 3O8QB 3UWOA 3W8NA 3CLTD 5KS2A 1OZHA 3K53A 2CFOA 2BJHA 3FMVA 2WU3A 4XGQA 2OHVA 1DCFA 3HJNA 2W93A 1SZJG 3M0EA 4IQGA 1VBFA 1V4VA 2AEJA 2NXCA 1FVFA 2ZR0A 1ULZA 2GXQA 1W5AA 1WVMA 1DINA 1HT3A 3FZGA 3BF8A 2FTKE 1I7NA 3OE7A 3NP7A 3VO1A 5H1YA 1C3OA 2WNHA 2HZBA 4E22A 3P5BA 5DTQA 5BW5A 3HSSA 4QJ4A 2VXBA 2GJSA 4RTQA 2D3WA 3AJDA 3U7QA 1YVPA 3MUEA 4MWDA 5AKIA 4LFBB 3ISVA 1X7GA 3NHUA 1HSOA 2W4MA 2ZUDA 4KQ2A 4RK4A 5FOWA 2FUCA 1RXUA 1D2GA 2R5FA 1L7VC 4OYLA 4RHFA 3KPWA 4Z0PA 2I54A 1L3BA 1K08A 1R9JA 2Q41A 3WYBA 1II9A 2PSFA 3BHJA 4UOEA 4XUDA 2YV1A 5JSUA 4KSCA 4AJIA 5EXTA 4MMZB 1SGWA 3IEVA 2FZCA 1DBPA 1KQ3A 1IXSB 4YJKA 3O3MB 2WJAA 1GTSA 2GJ4A 1SCJA 2Y1CA 3CJQA 4M1YA 2VDKB 1UAYA 1PL7A 4TMTA 2Z1MA 1FSGA 1Z4JA 4OKNA 2XMCA 3MN1A 1PGQA 4IMIB 2NPIA 1DMRA 4AMUA 1EFVB 1TYCA 4IO1A 3U4DA 2QN8A 2VF8A 3AHFA 4L75A 1LRKA 1XRQA 4G67A 2DP4E 3NHFA 4KWIA 1TVMA 2PKRA 1J4AA 5TMBA 2WYOA 3GJRA 1BWPA 1BSVA 2C7GA 3R6WA 2OCYC 1QGAA 3Q8MA 4KR3A 2J3IA 3OPMA 1FP4A 4L16A 4S05A 1GTVA 3DGFC 4KR9A 4CFSA 4FFBA 4KR6A 3UHOA 3TBHA 2J7PD 4KWEA 5IT4A 1T6BY 1UBHS 1DBWA 2W2XA 2YYAA 5KJCA 5IVHA 3WTBA 1PWZA 2BE9A 3C6QA 3EHDA 2PWZA 1ZUD1 4MQBA 1S01A 3OF5A 4I1UA 5CCXA 2AQHA 1IY2A 4O1MA 3O0DA 3MMXA 4IDOA 3SSNA 4DWJA 1B2LA 1Q1AA 1V3TA 2X4DA 2WHQA 3EUAA 2ZB7A 3NDPA 2NLOA 1D8AA 3EEIA 3NCHA 4QG7A 3SZMA 1CLUA 5JJKA 3ND7A 5F76A 1NY6A 1LBTA 5CBKA 3HJTA 5DIZA 5FOQA 3HTXA 3MG9A 1XAGA 3TLYA 1JL3A 1KDTA 2I1QA 5M29A 1XXHE 4ZGBA 4YXWD 1KH3A 1T2CA 1OT3A 9ABPA 3DL2A 5HMMA 3DEKA 5GY7A 2AMVA 2VPPA 1NJ2A 2R6JA 4Y2TA 4RGBA 1VE6A 1DBQA 4B6EA 3LWBA 5FBKA 3B60A 4CV0A 3EQ8A 4EJ0A 1Y9JA 2CVOA 3K5PA 2WTNA 2G4LA 4E5MA 4OHXA 2PUAA 2ZYHA 4IMPA 4L2IB 4ZO6A 4BO9A 1RPTA 2ZM6B 1BNCA 3CEHA 3W8EA 3LCCA 4DF3A 2PXCA 2PN1A 2QTVA 2R2GA 1H8HA 2YVKA 3F9CA 4AF8A 2P7HA 3M6AA 1Z18A 1WL8A 1P9NA 2VP9A 2ZYVX 5AJYA 5IKMA 4NS4A 3TEFA 4EUNA 4F3RA 4LZPA 1MH1A 2BZ1A 4HXGA 1FJGB 1F9EA 1SC4A 1LK0A 3DWGA 3N53A 4EA8A 4YHHB 4EUKA 3KPYA 3LWDA 4S2EA 1PGOA 5LL6P 2HDWA 1OXKB 1FDRA 2AQKA 3IQIX 4W63A 5M04A 1MO6A 3CBGA 1N6NA 5FWYA 4K9OA 2EFJA 1SCUB 4E5SA 4PFSA 1AH2A 3C7KA 4BQQA 3K0FA 4DLPA 4ZEOA 4U2CA 2Y3IA 2P90A 5GWXA 3EARA 1D4AA 5PGMA 3I72A 2Q1XA 1L5HB 2Q0QA 1FUYB 2E1PA 2G63A 4CLXA 5AVUA 4MWEA 4DCOA 2ZBQA 4INPA 3EMBA 3U7HB 2EP7A 2XLCA 2WT9A 1AK1A 1P91A 2YWRA 3IOBA 3K15A 1GG5A 3JWEA 4IM7A 2GCNA 4WE3A 3NBMA 3R7WB 1XTUA 4ZFNA 2QAGB 5KU1A 1A1VA 4BY9E 2IVZA 3OFNA 3PFNA 3JZMA 1EGHA 2IUUA 2MOKA 5A9SB 2QU8A 2G1JA 4K1LA 1ATZA 1AKEA 4ZU3A 3BE8A 1VBKA 2FW9A 3ZCQA 4ZZ3A 1T9HA 3THYA 4RVCA 3RFCA 4EZEA 2RI6A 5B1YA 3ZW9A 4NHOA 2Q28A 3KVOA 3MLEA 1KHHA 2PZKA 2WA1A 2I0FA 4JR0A 1U3TA 1ZA2A 2PQ6A 3KE9A 4LDPA 4OUDA 3RVOA 1YT5A 5EHIA 3RH0A 1NR1A 1TX4B 3JQRA 1GRRA 1LWOA 4TGLA 2YTZA 5EESA 4YCJA 5FUMA 3EY9A 2G4VA 3OCZA 2M6LA 4BO4A 5CM2Z 3O4FA 1DADA 2XUIA 4LJ5A 4YP5A 2IEDA 3IVMA 2VDPB 4EFMA 4FOOA 4WZBB 5EJAA 3UCEA 1POXA 2HFJA 3OPVA 4ZI7B 4EB6A 2AEFA 3P0JA 1OJLA 1M6VA 5GJVC 3MTIA 1OZAA 1ZNYA 4YJGB 1GLNA 5CBPB 5JRDS 4FVTA 4QQ8A 4TLEA 1E3LA 1MVLA 3L7IA 1MIHA 1GPLA 1BOFA 1RLUA 3AHEA 4MARA 2HEGA 4R8KA 1D09A 3ITEA 3NT2A 3R5HA 4QOFA 1ZM4A 1ZRSA 5HS6A 5DM2A 1K8QA 3TLBA 1XTPA 4MQLA 2WT8A 3R9XA 2W2TA 3BRQA 4CTJA 1E2NA 3S29A 4CWAA 5J3JA 1P3DA 2HLNA 5EMMA 3QKRA 4DLVA 4HDKB 1I9CA 4HB2A 1OZ0A 1YR6A 3HCCA 4KBYA 1S2LA 2BHTA 3MWLA 2ZI6A 4IVNA 2PRSA 1LTQA 3KWMA 1Y81A 2PWPA 4CQMA 1CUWA 1IEWA 3TI7A 4YCNA 3ZJVA 2UV8A 5ES3A 4DT1B 5DVZA 3C4QA 3U7EB 1NRIA 2WHXA 3H18A 4AJ2A 3C1TA 4C0AC 2JHAA 2ZUBA 1HYBA 1EJ2A 3C3AA 3GVPA 1U0EA 3R77A 4G36A 2QV0A 3H2SA 3WZLA 1WB9A 2XCOA 1S1CA 1K66A 1UK9A 2OLJA 1G8YA 3CCCA 4E31A 3AF5A 1XJ0A 2HXGA 1P0QA 1IC6A 3AYZB 1HBJA 3KUDA 2GN6A 3GFVA 1KYTA 1UFVA 1Q92A 4I4NA 4ZC8A 4URHA 5EE5B 4I0WB 4FMCB 4RQUA 1TW3A 1DV2A 5F78A 3V6MA 1CUAA 3NRCA 1UPAA 4YJHB 1OLSA 3IL2A 3VPCA 4E6EA 1R12A 4QYIA 4DWWA 1B6TA 1X6VA 1R6UA 3A37A 3MEQA 3PQ8A 4HLNA 4UHCA 3K6KA 3UHPA 2PSHA 4EBBA 5KDOA 1YQTA 3BILA 4QGSA 1CVIA 4WOCA 5CJ2A 1UQRA 5FTNA 3U9TA 4DXAA 4G1FA 4NV0A 5FA8A 3ZDZB 3KOYA 1NVMB 4FQ5A 4HLDA 3UAOA 3PICA 4YP0A 1TIPA 3N7TA 1D4OA 3HJBA 3L0PA 2IYYA 3ZE2B 1CEEA 2QRMA 4RIIA 2JAQA 3O8BA 4Z86A 3WIBA 3HBLA 4EHKA 1L7OA 4JEHA 3VR0A 4Z4FA 2ECOA 4EYGA 3QPCA 3GMIA 4NC9A 3ZE0B 1DFIA 1AKQA 1Q0PA 3GVXA 4I5DA 3AERB 5BSRA 3UICA 4YMLA 5KOIA 3T7IA 4XYLA 2C5GA 2G5GX 5LDDC 4QYWA 4PSVA 2EZ8A 3ZW8A 1EFCA 2Q5FA 1HEIA 1MG5A 1HR0B 1RU3A 3HXPA 1SAYA 4Z6KA 3OUZA 3SICE 1FUUA 5D85A 3QENA 4U5XA 1G2PA 3SSOA 1FFHA 1T3GA 2W2MA 4EHHA 4MYSA 1A9QA 4IIBA 1C7EA 3NM4A 4JYAB 2J0UB 1XRLA 1XMQB 2JJMA 1ZK4A 1SBNE 1G9SA 4H3KB 4FQ7A 2EW2A 3QYJA 4MGYR 4PBSA 4QUJA 3RARA 4XE5A 3RUDA 3T1TA 3WGJA 3MNFA 1CR2A 1W73A 2QOEA 3RD5A 3G1WA 4P0PB 1JHXA 3CB2A 5LBUA 4YDRA 1EUCB 1JPUA 2GN9A 1A0OA 1CCWA 5AKXA 3ZQKA 1GRQA 4LBWA 2W37A 3O8QA 4XYBA 2HC9A 8LDHA 1M1XB 1CY4A 1II8A 3BXEA 1ICEA 1SUIA 4JVNA 4PNZA 4PLCA 4HPXB 1J39A 4M98A 1L5GB 2XA9A 2LCIA 1XEWX 1HE3A 4TXHA 3ZEIA 2ZYUX 1G21A 1X7ZA 5EPUA 1EE2A 5K0LA 1V39A 5ALYA 1L5SA 1OBFO 3FM9A 3AM3A 4NBLA 3DEIA 1E1NA 4N7BA 4UMEA 5M3BA 3TMAA 2BM0A 4ZO9A 1ZH8A 4B7XA 1XTZA 3EEQA 1SNYA 1IBLB 5AVYA 2JB9A 4MCHA 3PITA 4EECA 5BMOA 4O4LB 1E63A 4P3OA 2Y0EA 1I3OA 4LBYA 4J3JA 4RUKA 5LXTB 1ZUNA 1NVGA 3U81A 2MYPA 4OXIA 5MF6A 4MV0A 2ZJ4A 3ZHVA 1HTWA 1WKBA 2OO5C 2WSBA 4IRUB 2NTJA 2OB2A 3OCXA 1DP4A 2HLDA 5HZKA 4RANA 1RXVA 2VHZA 2ZRFA 1PFQA 2GRJA 3OPXA 1VDMA 2X2FA 4FE3A 1WZUA 4HR7A 2JFPA 2FPGA 4ITUA 2HRBA 1ZIPA 2FSVC 4ABYA 1YMQA 1U3VA 4N01A 5EE9A 2A9FA 1MX5A 1JHOA 2GFHA 2VHXA 4I19A 3H0CA 2X8BA 5AWFC 1GILA 2ZTSA 13PKA 4JLJA 3V7WA 4FILA 3IQGX 4UBJA 3VDNB 4CHGA 1RWBA 4XX1A 4P38A 2IDKA 1YOVB 4E09A 4OQNA 2FEAA 4OKSA 5TGZA 3U09A 1NXTA 3BG5A 3QNUA 1USUA 3Q7QA 1RCTE 2IY7A 4M9QA 4D6PA 2V7XA 1PN3A 5HJ5A 5LZ9A 4TYYA 1SPXA 3DTVD 1O0SA 5IBRA 4ACBA 3F9RA 2F8SA 3TLEA 4BNDA 2VTDA 1S3GA 2NAPA 2Z2KA 3NBUA 2DETA 4OSEA 4QDKA 4QT4A 1DAHA 3EAQA 3ZU3A 3HXTA 2X4LA 1SPBS 5J1SB 1E8MA 4YYZA 1TLLA 1NBAA 3IT1A 3LU1A 1RRMA 4H08A 5D51S 3S2ZA 1CDOA 2WJZB 5KSOA 2FZKA 4HQNA 4YT5A 2IP1A 5D1NA 1SHLA 4RTJA 4AKHA 3L6DA 1PRYA 4NZZA 2MTBA 3HMQA 4MRSA 3ICOA 4BWVA 4MWBA 1CR6A 4QUAA 4DR2B 1D8TA 3LUHA 3K3PA 5BSWA 4CQNA 3V4RA 5T3YA 3HU5A 4JI5B 2HREA 2JEYA 5SYAA 3PQ4A 3CWQA 1UKVY 2EATA 3X2EA 3KOXA 3SXUA 1Z6YA 4JGBA 4C7XA 1DQYA 3MELA 1N32B 1G63A 2Q0XA 1DPFA 3HJUA 4KPUB 3FYTA 3EXEA 3TL2A 4YRMA 1N5JA 4NCXA 3H5AA 4BE9A 1JR3A 2YFHA 1IXZA 3IUSA 1ISMA 1X8LA 3CONA 3QWIA 4B6FA 1WB5A 3MHTA 1Z06A 1KF0A 4R31A 1MW9X 4US1R 3CLSC 4AJNA 3ZBUA 2BDUA 4M1EA 3O2NA 2ALJA 3CNNA 1ZP6A 4WN9A 1DIRA 5ETJA 3BTUA 4KKXB 1I0ZA 2JGMA 2DPXA 4IQ8A 4PXYA 3CISA 1W88B 3G2IA 2WABA 4J1NA 3WZ2A 1W36B 2ZZMA 4Y9SA 1PJ4A 2Q8QA 2Y2UA 2FPLA 3VTAA 5DK6A 1CERA 3A9RA 1NP7A 1I7SB 2E7ZA 1TF5A 1IQ0A 1L2TA 3LRPA 3TKYA 3VVMA 3BBPA 1WO8A 4CDNA 4IUDS 1VMDA 3DQQA 3Q3GE 3MJRA 4FYKA 1Q6ZA 2J6BA 4OMDA 5KTTA 5B58C 1NZDA 4NY1A 4QBGB 5DHAA 4R68A 5KYUB 2ISQA 1V5FA 3HP1A 1J97A 1DKQA 1FTSA 5EP4A 4RV9A 4EY6A 5M7EA 3T5AA 4A73A 2OAP1 1UEIA 5BNIA 2OY0A 5B37A 3REQA 1ZWKA 1OTHA 4MGZR 1ODCA 5E6SA 3O90A 3VR4H 3IYLW 2A3RA 1A5BB 5U4QA 1RAGA 3GLUA 2IEYA 2ORYA 4KE7A 1ZXBA 2WD7B 5JAUA 5KX5F 1QGOA 1U8TA 1E5VA 3CTMA 1XU4A 3BD7A 2H8KA 4LGYA 2MT9A 2ZBGA 1B0ZA 3C3CA 5SICE 3CNHA 1IUKA 1QXSA 2L17A 1G5PA 1KEWA 2VOEA 3WA7A 2C82A 4HNUA 5EKDA 4NK5A 2H59A 421PA 4AWXA 5KNDH 4KQHA 3WKBA 3AR2A 5TVKA 3OAAA 3FMOB 3DZCA 2AV6A 3GLIB 1CE8A 2IXBA 1GUZA 1X2BA 3A1FA 4IAOA 5MFZA 3FPBA 1A9XB 4K9SA 4LJ9A 5FBRB 3VNSA 4D8TA 3NG1A 1O94D 3C5EA 3HB5X 4N4AA 2YIMA 4F7DA 3KT8A 2VCHA 5IFLA 1XL0A 3RS0A 1CR0A 3D7MA 1DTSA 4X1IB 5B7GA 2CYBA 3EFOB 2OD2A 3N0RA 4MYDA 1M2NA 1XYGA 2FLVA 4YQFA 3DZIA 3EUEA 1I0IA 4GE3A 5ALGA 4EB6B 1WZ2A 1E3WB 4MEBA 1N0UA 1R00A 5FIUA 1GGFA 1QHGA 2QI9C 4CLRA 5TE9A 4LE1A 3DEJA 3LO8A 3EOAI 3TN7A 2FOIA 5JJBA 1QE5A 3NWEA 2W11A 3NYIA 5CLIA 4P4LA 1AKRA 1ORDA 1WXQA 2COEA 4OL0A 3EC7A 4GPTA 5D84A 4GP6A 5FO0A 3G7SA 2ZIZA 5BQOA 2XB4A 2QVZX 2PPLA 1IJKA 2UYGA 2C77A 2TMYA 3GU3A 4RXMA 4WK6A 2AZXA 2D2EA 4WUVA 2C0QA 3OM0A 4ZVTA 5TLSA 3IDZA 4JLUA 3C87A 3ORSA 4MQFA 1H8HD 2ZOSA 3TCXB 2P9YA 2VBIA 4CMIB 3LPAA 3LQQA 1UBTS 2NU6B 3K0BA 1MVNA 3R0QA 5DN6A 3V8EA 2LNDA 3GRCA 4AIIA 3K2IA 4TRMA 4K28A 4GSYA 2FU5C 1LVGA 2I7CA 1WS6A 2CY0A 5LKAA 4JP1A 2H1SA 4PICA 4FFSA 3ST7A 4KIJA 2Q50A 2XR1A 3NZEA 3E03A 2GTHA 2VBGA 1P3JA 3FCYA 3GVCA 3LVRE 2IZ5A 3DEFA 4KN8A 5CA0A 5ICSA 1IVSA 3JTEA 1Q7RA 3RYCA 1H2EA 1P9WA 4IFTA 6GPBA 3UJNA 3BFXA 3GLVA 1J9ZA 1XALA 2W48A 6AT1A 1NLZA 2V7QD 3OM1A 2XXBA 3MCAA 5E9WA 3USES 4F11A 4ZVOA 5HBRA 2QM3A 2Z8XA 4R84A 1G20B 4ND4A 3PD1A 5JD6A 1SQ5A 2LWIA 5C7OO 2R84A 4CLDA 3EQ2A 2QORA 1R4ZA 4YMGA 3L4KA 1M0WA 2I4IA 1ULTA 3DLTA 3KZCA 3PNMA 4RELA 4RL4A 3DHEA 2AS0A 3RC7A 4DDWA 4RKQA 1YFZA 4JLAA 4DWVA 4GO1A 3KDSE 3H05A 4GOLD 1Q21A 1QF9A 3AFHA 2PGLA 5EXPA 3I9OA 3BRSA 4U7JA 3IOCA 3LSTA 4ENVA 1Q3KA 4A0RA 4DCUA 1SA0A 3IB3A 3MHPA 4L6CA 1CQPA 1DC3A 1KVUA 1CKEA 1TJ5A 2CKMA 2Q1YA 4TT8A 4TMXA 1NF8A 2I3GA 4ZAXA 2HF7A 1RADA 3CF4A 4FHZA 4YMHA 3F7MA 2IW3A 4P4SA 5LQNA 2EJUA 3TQIA 4YECA 3NBZC 1L7BA 4BVHA 2GN1A 5I51A 4PPFA 2FMFA 2LIPA 1ZKDA 1AMNA 1KFCB 3JQ9A 3TD9A 1GG2A 2ZB8A 1U8EA 3HWRA 4DCTA 4C0BA 3FFAA 1L1RA 1ULAA 2WWFA 3RQIA 1PW7A 4YX9A 1AQYA 3QE9Y 2CJWB 2ENUA 3BHNA 5E9JA 2P0EA 3FUWA 3ITDA 3AVYA 5G41A 4M0UA 2E37A 2ZWIA 5CFPA 3JRXA 1W36D 3GLHE 3CZAA 4WZBA 5CU7A 1N8SA 4RD6A 2X9VA 3DW1X 3DR3A 3NP9A 3U2QA 3RSFA 3ZCSA 3AJRA 3LPLA 2OCBA 3KJXA 4HP8A 4RH1A 4C01A 2C5AA 4QE3A 5J4LA 4YJGA 2F3SA 2I65A 1K68A 2IELA 4IXTA 2DOKA 3CX8A 1P1CA 2FWBA 2H3HA 2C4NA 4OP3A 4DCVA 4CM8A 5B5SA 4J1TC 2B8NA 1FTQA 1UMKA 2W6CX 2XNHA 4AO6A 2OL4A 3CZRA 1HEYA 3ADDA 2FPKA 2FZEA 1E2LA 2J08A 5WRFA 4PYOA 4UHEA 1G0OA 4U39A 2AXQA 3F6PA 4DJAA 4DEVA 4H7JA 1NN5A 3G8BA 5B3KA 1A69A 1YHYA 5JVDA 1BCRB 3DQZA 2IU3A 5C1OA 4MUAA 4O4LA 2I6XA 2DG2A 3PNOA 5LXTA 2GA8A 3UV3A 1CS0B 2Q7XA 2RGXA 3R9KA 5A0VA 4O0MA 2Y0BA 3KYIB 4Q34A 3PGMA 4JJFA 2WJPA 3ND5A 4JXXA 1IH8A 3BH7A 1G8JA 1JA1A 3I45A 4TZTA 2B1IA 1RWMA 2XDWA 4Y8VA 3VA7A 3PGKA 1ADBA 1NF9A 1XRNA