4GE4A

Kynurenine aminotransferase ii inhibitors
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
428
structure length
422
Chain Sequence
MNYARFITAASAARNPSPIRTMTDILSSMISLAGGLPNPNMFPFKTAVITVGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNSGRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 145
structure length 422
sequence length 428
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ge4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ge4A03
3BV0A 1LW5A 3FVSA 2VI8A 3PIUA 4LC3A 1V2FA 1AHYA 3DR4A 2HORA 1J32A 2E7UA 2ZC0A 1AICA 2O0RA 4W1VA 1D7RA 4LW4A 2E7IA 1EJIA 1SZSA 3A9XA 4BA5A 3BWNA 4FL0A 1TOKA 3WCOA 2CFBA 4RLGA 2Z61A 1N2TA 3ISLA 1B4XA 2O7CA 2QB2A 3K40A 1W7LA 1GEWA 3WZFA 3NUIA 1VJOA 5TF5A 1M0NA 1G7XA 2BI3A 1AKAA 2YKXA 1AX4A 4ADCA 2HOXA 1S09A 3E2ZB 4WXFA 2BWPA 2EPJA 3DYDA 4UHOA 3OP7A 1BT4A 2AY9A 2DKJA 3CQ6A 3PD6B 2Z9WA 1QIRA 1DKAA 3EIAA 3ZRRA 1RVUA 3AOWA 1M4NA 4W8IA 4E3QA 3UAKA 1DJ9A 1AMQA 4MSOA 2VMQA 1O69A 4JF0A 2HUFA 1AY4A 3PDBB 3DC1A 1QITA 3GR9A 4ZWVA 3E77A 4XK1A 3B46A 1C0NA 4A0FA 2EGYA 1GC3A 2HOZA 1MDZA 1BKGA 3AEJA 1JS3A 2YCPA 2BI2A 5HDMA 1XEYA 2HUIA 4R2NA 1S0AA 4XQ2A 5E3KA 2VMXA 1DFOA 1GEXA 5DJ9A 1GC2A 2D66A 3BB8A 4JF1A 2Z9UA 2VMSA 1OHWA 2X8UA 2VLHA 3FD0A 3BCAA 1YIZA 3FFRA 4IXOA 1BJOB 3D6KA 4WP0A 2HP2A 2VIBA 3A8UX 3B1CA 5BJ3A 1JS6A 3FQ8A 3R9AA 3WY7A 1KL1A 1OXPA 4ATPA 3EI6A 1ARHA 1CZCA 1ORDA 4WBTA 2BI5A 1WKHA 5EUNA 3FZ8A 4WB0B 3G8MA 3GZDA 4OT8A 3EIBA 3LVJA 4NOGA 4R5FA 4CVQA 1OXOA 2JGTA 3BCBA 4CXQA 2W7KA 5G09A 4K2IA 1AJSA 2Z67A 1O61A 1KKPA 2GMUA 1AY5A 3F0HA 1WYUB 3EZSA 3PDXA 4I8AA 4WYFA 2ZYJA 1J04A 3ACZA 4U1TA 1Z3ZA 2QMAA 1UU1A 3H7FA 1X28A 1LS3A 2W7LA 2D5YA 1ARIA 1JG8A 1G4VA 3QGUA 1AMAA 2R5CA 2Z9XA 4Q75A 1ASAA 4JEYA 2VGUA 3ZZKA 1M6SA 1SZKA 1QGNA 5EAAA 2W7DA 4ATQA 4E77A 4ITXA 4RKCA 2YKVA 3GSBA 1IAYA 2VGWA 4F5HA 3JWAA 5AX8A 1H1CA 3E9KA 5BJ4A 1AAWA 2BIEA 4DBCA 2VGSA 2D61A 4GE7A 5K8BA 2ORDA 4ADDA 3TATA 1D7SA 2Z1YA 1ZC9A 4ZDPA 1W7MA 3WCNA 2XH1A 4A6RA 3WKRA 1IAXA 1KMKA 4EMYA 3NDNA 3PGYA 3HQTA 4Y0DA 4WD2A 1OATA 1CL1A 2W8TA 1BW0A 3HVYA 4W1WA 2VYCA 3HBXA 2AY3A 3NX3A 9AATA 4MQRA 4J8LA 5G2QA 4E3RA 2ZY2A 3JZLA 2OQXA 2EH6A 1LK9A 2C7TA 4A0RA 1YNUA 2VIAA 2PO3A 5G4IA 1Y4IA 2V0YA 4PIWA 2YCTA 4JEZA 1O62A 2V1PA 3OKSA 3QBOA 4IX8A 4UHNA 5FT8A 3JTXA 2VLFA 3LVMA 4P7YA 2R5EA 4LNLA 1W23A 2OGEA 3FRKA 4F5MA 3EUCA 2BYLA 1N8PA 4WYAA 1RV3A 1C7NA 3AATA 1P3WA 2JJFA 1VP4A 3PAAA 5EUDA 3AV7A 1AIAA 1WYVA 1TOJA 2BI1A 1FG7A 3MKJA 2WK9A 4L0OA 2CJGA 2C44A 3G0TA 1OHYA 1GCKA 3VP6A 1ZOBA 1AHGA 4WYCA 2W8JA 5HXXA 2VMVA 5EIGA 4UOYA 3TCMA 1WYTA 1DGEA 3COGA 4M2JA 2HOYA 3WLXA 1BQDA 3AEMC 3AELA 2AATA 3GZCA 3EI8A 2EO5A 2FYFA 4JEVA 5EFSA 3VAXA 2BIAA 4IXZA 1I41A 2VMRA 4WXBA 1TPLA 3E6GA 3VK2A 3QI6A 2Z1ZA 4M2MA 4Y0IA 4GDYA 4JEXA 2VI9A 2FN6A 1IX7A 5EQCA 1SF2A 3WGCA 2GMSA 4AO4A 2CH2A 1E5EA 1O4SA 5JAYA 4TMRA 3PDBA 4IYOA 3ASAA 2BIGA 1ASLA 1KKJA 2AY8A 2AEVA 3A9YA 4M2KA 1G7WA 2E7JA 2W7EA 3FTBA 4RITA 1MAPA 1X0MA 4FFCA 1V2DA 3USFA 4TV7A 5IWQA 3L8AA 4DGTA 3MC6A 4BA4A 4IXSA 2VGTA 4PVFA 3RQ1A 3CAIA 3FVXA 4CBSA 2CINA 2C81A 2CY8A 3RI6A 2CTZA 2F8JA 2OKKA 3H14A 2D7YA 5F8VA 1DTYA 3T32A 4U2HA 1MDXA 2DKBA 2D64A 2AY7A 2W7IA 4KXKA 4AOAA 1SZUA 3DR7A 1EG5A 4TN4A 1BJNA 4A00A 4ITGA 1E5FA 4ZM3A 4W5KA 2Z9VA 4MY5A 4QGRA 3QN6A 4H51A 4OC9A 3MAUA 2W7HA 4WB0A 4W91A 3ECDA 4AZJA 2R2NA 4MKJA 3TQXA 3RBFA 2ZY5A 1IX6A 3ELEA 2E54A 1QISA 1PMMA 3KGXA 2Q7WA 3L44A 3W1JA 1WYUA 1M0QA 4JE5D 1ASGA 5D5SA 3F6TA 2YRIA 3UWCA 4A0HA 2YOBA 1D2FA 3M5UA 4ZAHA 1B9IA 2EZ2A 4ZSWA 4ADEA 3PA9A 1LC8A 4WLHA 3FFHA 4ZSYA 3DZZA 2FNUA 3W1IA 1LW4A 1WKGA 1DGDA 1MLYA 1TOEA 3HMUA 2AY2A 5E4ZA 2GSAA 2AY4A 3LG0A 2W8VA 3AEPA 1DJUA 3HLMA 1YAAA 2WKAA 3CQ5A 1SVVA 1TASA 4MQQA 4RAEA 1ASEA 2EZ1A 2ZY3A 1M0OA 2NMPA 2FM1A 1AIBA 1W3UA 3DXWA 5M49A 3BCXA 4MGRA 3CQ4A 2WK7A 2VMOA 4LW2A 5G0AA 3WX9A 1AMSA 2JJHA 1ELUA 4OMAA 2BWNA 1AJSB 3UE8A 1LKCA 3NU8A 5D95A 1ZODA 2OGAA 5M4BA 3KKIA 3RCHA 1YIYA 1ARTA 1SPAA 1JF9A 1GEYA 1MGVA 8AATA 2R5CB 2GB3A 2BYJA 3E2YA 3QPGA 3ZRPA 3AENA 2AY5A 1IUGA 1RV4A 3EI7A 1AKCA 1AAMA 2CH1A 5LH9A 1AHFA 4A0GA 2W8UA 3FZ6A 2ZJGA 3I5TA 4ISYA 4HF8A 1IVRA 4ZM4A 1AHXA 1ECXA 2W7JA 4BMKA 1MDOA 4RM1A 2VMUA 3I4JA 4OBVA 4RJYA 3AEJC 1PMOA 3MEBA 3JWBA 3VOMA 3A9ZA 1C7GA 3IF2A 2BHXA 2JJEA 2X3LA 4KAMA 1GC4A 1B5OA 3ATHA 2VGZA 1ASDA 2Z20A 3GZDC 1M7YA 2ZUKA 4Q31A 2YHKA 1CQ7A 1KL2A 4PFFA 4A6UA 1M32A 2TPLA 4EB5A 1V72A 5DJ1A 2QBTA 2VMYA 1I48A 4GEBA 3BWOA 3AEOA 5M4DA 4EU1A 3MAFB 1BS0A 4N0BA 2VMTA 5DB5A 5C6UA 3FQAA 3B1EA 2JJGA 4OYTA 3FQ7A 2FQ6A 1TOIA 3B8XA 2ZSMA 4XAUA 4ZASA 2CJDA 3FVUA 4CXRA 3DU4A 2CANA 2DR1A 3E2ZA 3I16A 3B1DA 3P6KA 4OBUA 3VK4A 1AHEA 1WSTA 3FDBA 3BC8A 3MADA 4XJLA 1WYVB 1YJYA 4BQ0A 4RIZA 1SFFA 1H0CA 3LVKA 4UQVA 1PFFA 1CS1A 1XI9A 3PD6A 2C0RA 4OTLA 4OCAA 1S08A 4PFNA 3JU7A 1UU0A 2QLRA 4K2MA 4R8DA 1ASNA 2YKUA 2CB1A 5EIGB 4A72A 4XJOA 1WYTB 4WYDA 2D63A 3K7YA 3JW9A 4RJ0A 2ZY4A 2BKWA 1X2AA 1YJSA 2AY1A 3GBXA 3WKSA 3WGBA 4AH3A 1CQ6A 2PB2A 5M46A 4W1XA 4R5ZA 3QM2A 4A6TA 2QB3A 4O6ZA 5FT4A 1QJ3A 4EFFA 3LWSA 2DGKA 3R4TA 1GDEA 5G4JA 2G6WA 4F4EA 1BJOA 4LNJA 4F5KA 1YJZA 4XJMA 4RKDA 3N75A 4B98A 2HUUA 1C9CA 3GETA 3LV2A 4WLJA 1I43A 3FKDA 4IYOB 1B5PA 3G7QA 4KYOA 3FCRA 3E2FA 3ZRQA 1ASCA 4ZDOA 3BS8A 1VEFA 3NYTA 3FSLA 1OHVA 3MBBA 5HHYA 3PJ0A 2GQNA 4IY7A 1ARGA 1TARA 3ZZJA 3N5MA 3KE3A 3NYUA 5F9SA 1AMRA 1AY8A 1YOOA 3HT4A 1V2EA 2W8WA 4MQPA 2JG2A 4CBRA 2VMWA 4IW7A 1AJRA 4EB7A 1CL2A 4F5LA 3LY1A 3HDOA 4DQ6A 3AEMA 2DGMA 1QZ9A 3ELPA 3GWPA 4P3MA 1Z7DA 1RVYA 4BHDA 4F5JA 3NUBA 4Q6RA 3Q8NA 4F5GA 2VGVA 2X5FA 1C7OA 2AY6A 1MAQA 3HL2A 3P1TA 3VK3A 2HZPA 5I92A 1ASMA 3EI5A 1B9HA 3RBLA 4Q76A 2BI9A 3IHJA 1ASFA 3DODA 3BWNC 2ZP7A 1FC4A 1ASBA 1N31A 2W7MA 7AATA 4AO9A 1T3IA 1TOGA 4N0WA 3EI9A 2WK8A 4J5UA 1PG8A 1IBJA 2YRRA 3FZ7A 2D7ZA 1UU2A 1IX8A 2XBNA 5DX5A 4ZDLA 2YKYA 2DOUA 1TATA 3F9TA 5EAVA 2ZSLA 3EZ1A 3LVLB 1AKBA 4F5FA 5J8QA 1ARSA 3II0A 4B9BA 2X5DA 3GJUA 3N0LA 1I29A 1LC5A 2R0TA 3BN1A 2RFVA 2VMNA 4GSAA 1CQ8A 3AOVA 4JE5A 1W7NA 2CJHA 4K2BA 4WYGA 1BJ4A 4ZWMA 3A2BA 4GE4A 4XEWA 3W1HA 1M0PA 4GE9A 1GD9A 1S07A 1GC0A 2W7GA 3PPLA 2W7FA 5EUEA 1FG3A 4F5IA 4UHMA 1IJIA 1X29A 4AZKA 1B8GA 3NYSA 3RCHB 4HVKA 5FT5A 3KGWA 3MC6C 5FT6A 3FDDA 1BQAA 1G4XA 1KMJA 3DXVA 1CZEA 3NNKA 1D7UA 3NRAA 4JEWA 1ELQA 2D65A 2OKJA 4ZLVA 2HP1A 1C4KA 1DJEA 1U08A 1BJWA 2DGLA 2JISA 2YCNA 3QHXA 4E1OA 1GBNA 2BWOA 3AENB 4WYEA 3TFUA 4ADBA 2O1BA 3MAFA 4LNMA 3RUYA 2FNIA 3K28A 4MKKA 1S06A 1MLZA 4GRXA 3NU7A 5E5IA 2CSTA 4WXGA 1CJ0A 1LC7A 2OATA 3ASBA 2VMPA 5G2PA 3TFTA 2VMZA 1UKJA 3DRDA 1D7VA 2QA3A 1QJ5A 4XJPA 2AEUA 4Y0HA 1EQBA 2PB0A 3CBFA 5LHAA 3NTJA
chains in the Genus database with same CATH superfamily
3BV0A 1LW5A 3FVSA 2VI8A 3PIUA 4LC3A 1V2FA 1AHYA 3DR4A 2HORA 1J32A 2E7UA 2ZC0A 1AICA 2O0RA 4W1VA 1D7RA 4LW4A 2E7IA 1EJIA 1SZSA 3A9XA 4BA5A 3BWNA 4FL0A 1TOKA 4H63Q 3WCOA 2CFBA 4RLGA 2Z61A 1N2TA 3ISLA 1B4XA 2O7CA 2QB2A 3K40A 1W7LA 1GEWA 3WZFA 3NUIA 1VJOA 5TF5A 1M0NA 1G7XA 2BI3A 1AKAA 2YKXA 1AX4A 4ADCA 2HOXA 1S09A 3E2ZB 4WXFA 2BWPA 2EPJA 3DYDA 4UHOA 3OP7A 1BT4A 2AY9A 2DKJA 3CQ6A 3PD6B 2Z9WA 1QIRA 1DKAA 3EIAA 3ZRRA 1RVUA 3AOWA 2KFPA 1M4NA 4W8IA 4E3QA 3UAKA 1DJ9A 1AMQA 4MSOA 2VMQA 1O69A 4JF0A 2HUFA 1AY4A 3PDBB 3DC1A 1QITA 3GR9A 4ZWVA 3E77A 4XK1A 3B46A 1C0NA 4A0FA 2EGYA 1GC3A 2HOZA 1MDZA 1BKGA 3AEJA 1JS3A 2YCPA 2BI2A 5HDMA 1XEYA 2HUIA 4R2NA 1S0AA 4XQ2A 5E3KA 2VMXA 1DFOA 1GEXA 5DJ9A 1GC2A 2D66A 3BB8A 4JF1A 2Z9UA 2VMSA 1OHWA 2X8UA 2VLHA 3FD0A 3BCAA 1YIZA 3FFRA 4IXOA 1BJOB 3D6KA 4WP0A 2HP2A 2VIBA 3A8UX 3B1CA 5BJ3A 1JS6A 3FQ8A 3R9AA 3WY7A 1KL1A 1OXPA 4ATPA 4K05A 3EI6A 1ARHA 1CZCA 1ORDA 4WBTA 2BI5A 1WKHA 5EUNA 3FZ8A 4WB0B 3G8MA 3GZDA 4OT8A 3EIBA 3LVJA 4NOGA 4R5FA 4CVQA 1OXOA 2JGTA 3BCBA 4CXQA 2W7KA 5G09A 4K2IA 1AJSA 2Z67A 1O61A 1KKPA 2GMUA 1AY5A 3F0HA 1WYUB 3EZSA 3PDXA 4I8AA 4WYFA 2ZYJA 1J04A 3ACZA 4U1TA 1Z3ZA 2QMAA 1UU1A 3H7FA 1X28A 1LS3A 2W7LA 2D5YA 1ARIA 1JG8A 1G4VA 3QGUA 1AMAA 2R5CA 2Z9XA 4Q75A 1ASAA 4JEYA 2VGUA 3ZZKA 1M6SA 1SZKA 1QGNA 5EAAA 2W7DA 4ATQA 4E77A 4ITXA 4RKCA 2YKVA 3GSBA 1IAYA 2VGWA 4F5HA 3JWAA 5AX8A 1H1CA 3E9KA 5BJ4A 1AAWA 2BIEA 3H9XA 4DBCA 2VGSA 2D61A 4GE7A 5K8BA 2ORDA 4ADDA 3TATA 1D7SA 2Z1YA 1ZC9A 4ZDPA 1W7MA 3WCNA 2XH1A 4A6RA 3WKRA 1IAXA 1KMKA 4EMYA 3NDNA 2WB6A 3PGYA 3HQTA 4Y0DA 4WD2A 1OATA 1CL1A 2W8TA 1BW0A 3HVYA 4W1WA 2VYCA 3HBXA 2AY3A 3NX3A 9AATA 4MQRA 4J8LA 5G2QA 4E3RA 2ZY2A 3JZLA 2OQXA 2EH6A 1LK9A 2C7TA 4A0RA 1YNUA 2VIAA 2PO3A 5G4IA 1Y4IA 2V0YA 4PIWA 2YCTA 4JEZA 1O62A 2V1PA 3OKSA 3QBOA 4IX8A 4UHNA 5FT8A 3JTXA 3N4XA 2VLFA 3LVMA 4P7YA 2R5EA 4LNLA 1W23A 2OGEA 3FRKA 4F5MA 3EUCA 2BYLA 1N8PA 4WYAA 1RV3A 1C7NA 3AATA 1P3WA 2JJFA 1VP4A 3PAAA 5EUDA 3AV7A 1KAFA 1AIAA 1WYVA 1TOJA 2BI1A 1FG7A 3MKJA 2WK9A 4L0OA 2CJGA 2C44A 3G0TA 1OHYA 1GCKA 3VP6A 1ZOBA 1AHGA 4WYCA 2W8JA 5HXXA 2VMVA 5EIGA 4UOYA 3TCMA 1WYTA 1DGEA 3COGA 4M2JA 2HOYA 3WLXA 1BQDA 3AEMC 3AELA 2AATA 3GZCA 3EI8A 2EO5A 2FYFA 4JEVA 5EFSA 3VAXA 2BIAA 4IXZA 1I41A 2VMRA 4WXBA 1TPLA 3E6GA 3VK2A 3QI6A 2Z1ZA 4M2MA 4Y0IA 4GDYA 4JEXA 2VI9A 2FN6A 1IX7A 5EQCA 1SF2A 3WGCA 2GMSA 4AO4A 2CH2A 1E5EA 1O4SA 5JAYA 4TMRA 3PDBA 4IYOA 3ASAA 2BIGA 1ASLA 1KKJA 2AY8A 2AEVA 3A9YA 4M2KA 1G7WA 2E7JA 2W7EA 3FTBA 4RITA 1MAPA 1X0MA 3N4SA 4FFCA 1V2DA 3USFA 4TV7A 5IWQA 3L8AA 4DGTA 3MC6A 4BA4A 4IXSA 2VGTA 4PVFA 3RQ1A 3CAIA 3FVXA 4CBSA 2CINA 2C81A 2CY8A 3RI6A 2CTZA 2F8JA 2OKKA 3H14A 2D7YA 5F8VA 1DTYA 3T32A 3N4RA 4U2HA 1MDXA 2DKBA 2D64A 2AY7A 2W7IA 4KXKA 4AOAA 1SZUA 3DR7A 1EG5A 4TN4A 1BJNA 4A00A 4ITGA 1E5FA 4ZM3A 4W5KA 2Z9VA 4MY5A 4QGRA 3QN6A 4H51A 4OC9A 3MAUA 2W7HA 4WB0A 4W91A 3ECDA 4AZJA 2R2NA 4MKJA 3TQXA 3RBFA 2ZY5A 1IX6A 3ELEA 2E54A 1QISA 5KTBA 1PMMA 3KGXA 2Q7WA 3L44A 3W1JA 1WYUA 1M0QA 4JE5D 1ASGA 5D5SA 3F6TA 2YRIA 3UWCA 4A0HA 2YOBA 1D2FA 3M5UA 4ZAHA 1B9IA 2EZ2A 4ZSWA 4ADEA 3PA9A 1LC8A 4WLHA 3FFHA 4ZSYA 3DZZA 2FNUA 3W1IA 1LW4A 3N7NA 1WKGA 1DGDA 1MLYA 1TOEA 3HMUA 2AY2A 5E4ZA 2GSAA 2AY4A 3LG0A 2W8VA 3AEPA 1DJUA 3HLMA 1YAAA 2WKAA 3CQ5A 1SVVA 1TASA 4MQQA 4RAEA 1ASEA 2EZ1A 2ZY3A 1M0OA 2NMPA 2FM1A 1AIBA 1W3UA 3DXWA 5M49A 3BCXA 4MGRA 3CQ4A 2WK7A 2VMOA 4LW2A 5G0AA 3WX9A 1AMSA 2JJHA 1ELUA 4OMAA 2BWNA 1AJSB 3UE8A 1LKCA 3NU8A 5D95A 1ZODA 2OGAA 5M4BA 3KKIA 3RCHA 1YIYA 1ARTA 1SPAA 1JF9A 1GEYA 1MGVA 8AATA 2R5CB 2GB3A 2BYJA 3E2YA 3QPGA 3ZRPA 3AENA 2AY5A 1IUGA 1RV4A 3EI7A 1AKCA 1AAMA 2CH1A 5LH9A 1AHFA 4A0GA 2W8UA 3FZ6A 2ZJGA 3I5TA 4ISYA 4HF8A 1IVRA 4ZM4A 1AHXA 1ECXA 2W7JA 4BMKA 1MDOA 4RM1A 2VMUA 3I4JA 4OBVA 4RJYA 3AEJC 1PMOA 3MEBA 3JWBA 3VOMA 3A9ZA 1C7GA 3IF2A 2BHXA 2JJEA 2X3LA 4KAMA 1GC4A 1B5OA 3ATHA 2VGZA 1ASDA 2Z20A 3GZDC 1M7YA 2ZUKA 4Q31A 2YHKA 1CQ7A 1KL2A 4PFFA 4A6UA 1M32A 2TPLA 4EB5A 1V72A 5DJ1A 2QBTA 2VMYA 1I48A 4GEBA 3BWOA 3AEOA 5M4DA 4EU1A 3MAFB 1BS0A 4N0BA 2VMTA 5DB5A 5C6UA 3FQAA 3B1EA 2JJGA 4OYTA 3FQ7A 2FQ6A 1TOIA 3B8XA 2ZSMA 4XAUA 4ZASA 2CJDA 3FVUA 4CXRA 3DU4A 2CANA 2DR1A 3E2ZA 3I16A 3B1DA 3P6KA 4OBUA 3VK4A 1AHEA 1WSTA 3FDBA 3BC8A 3MADA 4XJLA 1WYVB 1YJYA 4BQ0A 4RIZA 1SFFA 1H0CA 3LVKA 2FKIA 4UQVA 1PFFA 1CS1A 1XI9A 3PD6A 2C0RA 4OTLA 4OCAA 1S08A 4PFNA 3JU7A 1UU0A 2QLRA 4K2MA 4R8DA 1ASNA 2YKUA 2CB1A 5EIGB 4A72A 2EYQA 4XJOA 1WYTB 4WYDA 2D63A 3K7YA 3JW9A 4RJ0A 2ZY4A 2BKWA 1X2AA 1YJSA 2AY1A 3GBXA 3WKSA 3WGBA 4AH3A 1CQ6A 2PB2A 5M46A 4W1XA 4R5ZA 3QM2A 4A6TA 2QB3A 4O6ZA 5FT4A 1QJ3A 4EFFA 3LWSA 2DGKA 3R4TA 1GDEA 5G4JA 2G6WA 4F4EA 1BJOA 4LNJA 4F5KA 1YJZA 4XJMA 4RKDA 2QSRA 3N75A 4B98A 2HUUA 1C9CA 3GETA 3LV2A 4WLJA 1I43A 3FKDA 4IYOB 1B5PA 3G7QA 4KYOA 3FCRA 3E2FA 3ZRQA 1ASCA 4ZDOA 3BS8A 1VEFA 3NYTA 3FSLA 1OHVA 3MBBA 5HHYA 3PJ0A 2GQNA 4IY7A 1ARGA 1TARA 3ZZJA 3N5MA 3KE3A 3NYUA 5F9SA 1AMRA 1AY8A 1YOOA 3HT4A 2G7JA 1V2EA 2W8WA 4MQPA 2JG2A 4CBRA 2VMWA 4IW7A 1AJRA 4EB7A 1CL2A 4F5LA 3LY1A 3HDOA 4DQ6A 3AEMA 2DGMA 1QZ9A 3ELPA 3GWPA 4P3MA 1Z7DA 1RVYA 4BHDA 4F5JA 3NUBA 4Q6RA 3Q8NA 4F5GA 2VGVA 2X5FA 1C7OA 2AY6A 1MAQA 3HL2A 3P1TA 3VK3A 2HZPA 5I92A 1ASMA 3EI5A 1B9HA 3RBLA 4Q76A 2BI9A 3IHJA 1ASFA 3DODA 2A1VA 3BWNC 2ZP7A 1FC4A 1ASBA 1N31A 2W7MA 7AATA 4AO9A 1T3IA 1TOGA 4N0WA 3EI9A 2WK8A 4J5UA 1PG8A 1IBJA 2YRRA 3FZ7A 2D7ZA 1UU2A 1IX8A 2XBNA 5DX5A 4ZDLA 2YKYA 2DOUA 1TATA 3F9TA 5EAVA 2ZSLA 3EZ1A 3LVLB 1AKBA 4F5FA 5J8QA 1ARSA 3II0A 4B9BA 2X5DA 3GJUA 3N0LA 1I29A 1LC5A 2R0TA 3BN1A 2RFVA 2VMNA 4GSAA 1CQ8A 3AOVA 4JE5A 1W7NA 2CJHA 4K2BA 4WYGA 1BJ4A 4ZWMA 3A2BA 4GE4A 4XEWA 3W1HA 1M0PA 4GE9A 1GD9A 1S07A 1GC0A 2W7GA 3PPLA 2W7FA 5EUEA 1FG3A 4F5IA 4UHMA 1IJIA 1X29A 4AZKA 1B8GA 3NYSA 3RCHB 4HVKA 5FT5A 3KGWA 3MC6C 5FT6A 3FDDA 1BQAA 1G4XA 1KMJA 3DXVA 1CZEA 3NNKA 1D7UA 3NRAA 4JEWA 1ELQA 2D65A 2OKJA 4ZLVA 2HP1A 1C4KA 1DJEA 1U08A 1BJWA 2DGLA 2JISA 2YCNA 3QHXA 4E1OA 1GBNA 2BWOA 3AENB 4WYEA 3TFUA 4ADBA 2O1BA 3MAFA 4LNMA 3RUYA 2FNIA 3K28A 4MKKA 1S06A 1MLZA 4GRXA 3NU7A 5E5IA 2CSTA 4WXGA 1CJ0A 1LC7A 2OATA 3ASBA 2VMPA 5G2PA 3TFTA 2VMZA 1UKJA 3DRDA 1D7VA 2QA3A 1QJ5A 4XJPA 2AEUA 4Y0HA 1EQBA 2PB0A 3CBFA 5LHAA 3NTJA
chains in the Genus database with same CATH topology
3BV0A 1LW5A 3FVSA 2VI8A 3PIUA 4LC3A 1V2FA 1AHYA 3DR4A 2HORA 1J32A 2E7UA 2ZC0A 1AICA 2O0RA 4W1VA 1D7RA 4LW4A 2E7IA 1EJIA 1SZSA 3A9XA 4BA5A 3BWNA 4FL0A 1TOKA 4H63Q 3WCOA 2CFBA 4RLGA 2Z61A 1N2TA 3ISLA 1B4XA 2O7CA 2QB2A 3K40A 1W7LA 1GEWA 3WZFA 3NUIA 1VJOA 5TF5A 1M0NA 1G7XA 2BI3A 1AKAA 2YKXA 1AX4A 4ADCA 2HOXA 1S09A 3E2ZB 4WXFA 2BWPA 2EPJA 3DYDA 4UHOA 3OP7A 1BT4A 2AY9A 2DKJA 3CQ6A 3PD6B 2Z9WA 1QIRA 1DKAA 3EIAA 3ZRRA 1RVUA 3AOWA 2KFPA 1M4NA 4W8IA 4E3QA 3UAKA 1DJ9A 1AMQA 4MSOA 2VMQA 1O69A 4JF0A 2HUFA 1AY4A 3PDBB 3DC1A 1QITA 3GR9A 4ZWVA 3E77A 4XK1A 3B46A 1C0NA 4A0FA 2EGYA 1GC3A 2HOZA 1MDZA 1BKGA 3AEJA 1JS3A 2YCPA 2BI2A 5HDMA 1XEYA 2HUIA 4R2NA 1S0AA 4XQ2A 5E3KA 2VMXA 1DFOA 1GEXA 5DJ9A 1GC2A 2D66A 3BB8A 4JF1A 2Z9UA 2VMSA 1OHWA 2X8UA 2VLHA 3FD0A 3BCAA 1YIZA 3FFRA 4IXOA 1BJOB 3D6KA 4WP0A 2HP2A 2VIBA 3A8UX 3B1CA 5BJ3A 1JS6A 3FQ8A 3R9AA 3WY7A 1KL1A 1OXPA 4ATPA 4K05A 3EI6A 1ARHA 1CZCA 1ORDA 4WBTA 2BI5A 1WKHA 5EUNA 3FZ8A 4WB0B 3G8MA 3GZDA 4OT8A 3EIBA 3LVJA 4NOGA 4R5FA 4CVQA 1OXOA 2JGTA 3BCBA 4CXQA 2W7KA 5G09A 4K2IA 1AJSA 2Z67A 1O61A 1KKPA 2GMUA 1AY5A 3F0HA 1WYUB 3EZSA 3PDXA 4I8AA 4WYFA 2ZYJA 1J04A 3ACZA 4U1TA 1Z3ZA 2QMAA 1UU1A 3H7FA 1X28A 1LS3A 2W7LA 2D5YA 1ARIA 1JG8A 1G4VA 3QGUA 1AMAA 2R5CA 2Z9XA 4Q75A 1ASAA 4JEYA 2VGUA 3ZZKA 1M6SA 1SZKA 1QGNA 5EAAA 2W7DA 4ATQA 4E77A 4ITXA 4RKCA 2YKVA 3GSBA 1IAYA 2VGWA 4F5HA 3JWAA 5AX8A 1H1CA 3E9KA 5BJ4A 1AAWA 2BIEA 3H9XA 4DBCA 2VGSA 2D61A 4GE7A 5K8BA 2ORDA 4ADDA 3TATA 1D7SA 2Z1YA 1ZC9A 4ZDPA 1W7MA 3WCNA 2XH1A 4A6RA 3WKRA 1IAXA 1KMKA 4EMYA 3NDNA 2WB6A 3PGYA 3HQTA 4Y0DA 4WD2A 1OATA 1CL1A 2W8TA 1BW0A 3HVYA 4W1WA 2VYCA 3HBXA 2AY3A 3NX3A 9AATA 4MQRA 4J8LA 5G2QA 4E3RA 2ZY2A 3JZLA 2OQXA 2EH6A 1LK9A 2C7TA 4A0RA 1YNUA 2VIAA 2PO3A 5G4IA 1Y4IA 2V0YA 4PIWA 2YCTA 4JEZA 1O62A 2V1PA 3OKSA 3QBOA 4IX8A 4UHNA 5FT8A 3JTXA 3N4XA 2VLFA 3LVMA 4P7YA 2R5EA 4LNLA 1W23A 2OGEA 3FRKA 4F5MA 3EUCA 2BYLA 1N8PA 4WYAA 1RV3A 1C7NA 3AATA 1P3WA 2JJFA 1VP4A 3PAAA 5EUDA 3AV7A 1AIAA 1WYVA 1TOJA 2BI1A 1FG7A 3MKJA 2WK9A 4L0OA 2CJGA 2C44A 3G0TA 1OHYA 1GCKA 3VP6A 1ZOBA 1AHGA 4WYCA 2W8JA 5HXXA 2VMVA 5EIGA 4UOYA 3TCMA 1WYTA 1DGEA 3COGA 4M2JA 2HOYA 3WLXA 1BQDA 3AEMC 3AELA 2AATA 3GZCA 3EI8A 2EO5A 2FYFA 4JEVA 5EFSA 3VAXA 2BIAA 4IXZA 1I41A 2VMRA 4WXBA 1TPLA 3E6GA 3VK2A 3QI6A 2Z1ZA 4M2MA 4Y0IA 4GDYA 4JEXA 2VI9A 2FN6A 1IX7A 5EQCA 1SF2A 3WGCA 2GMSA 4AO4A 2CH2A 1E5EA 1O4SA 5JAYA 4TMRA 3PDBA 4IYOA 3ASAA 2BIGA 1ASLA 1KKJA 2AY8A 2AEVA 3A9YA 4M2KA 1G7WA 2E7JA 2W7EA 3FTBA 4RITA 1MAPA 1X0MA 3N4SA 4FFCA 1V2DA 3USFA 4TV7A 5IWQA 3L8AA 4DGTA 3MC6A 4BA4A 4IXSA 2VGTA 4PVFA 3RQ1A 3CAIA 3FVXA 4CBSA 2CINA 2C81A 2CY8A 3RI6A 2CTZA 2F8JA 2OKKA 3H14A 2D7YA 5F8VA 1DTYA 3T32A 3N4RA 4U2HA 1MDXA 2DKBA 2D64A 2AY7A 2W7IA 4KXKA 4AOAA 1SZUA 3DR7A 1EG5A 4TN4A 1BJNA 4A00A 4ITGA 1E5FA 4ZM3A 4W5KA 2Z9VA 4MY5A 4QGRA 3QN6A 4H51A 4OC9A 3MAUA 2W7HA 4WB0A 4W91A 3ECDA 4AZJA 2R2NA 4MKJA 3TQXA 3RBFA 2ZY5A 1IX6A 3ELEA 2E54A 1QISA 5KTBA 1PMMA 3KGXA 2Q7WA 3L44A 3W1JA 1WYUA 1M0QA 4JE5D 1ASGA 5D5SA 3F6TA 2YRIA 3UWCA 4A0HA 2YOBA 1D2FA 3M5UA 4ZAHA 1B9IA 2EZ2A 4ZSWA 4ADEA 3PA9A 1LC8A 4WLHA 3FFHA 4ZSYA 3DZZA 2FNUA 3W1IA 1LW4A 3N7NA 1WKGA 1DGDA 1MLYA 1TOEA 3HMUA 2AY2A 5E4ZA 2GSAA 2AY4A 3LG0A 2W8VA 3AEPA 1DJUA 3HLMA 1YAAA 2WKAA 3CQ5A 1SVVA 1TASA 4MQQA 4RAEA 1ASEA 2EZ1A 2ZY3A 1M0OA 2NMPA 2FM1A 1AIBA 1W3UA 3DXWA 5M49A 3BCXA 4MGRA 3CQ4A 2WK7A 2VMOA 4LW2A 5G0AA 3WX9A 1AMSA 2JJHA 1ELUA 4OMAA 2BWNA 1AJSB 3UE8A 1LKCA 3NU8A 5D95A 1ZODA 2OGAA 5M4BA 3KKIA 3RCHA 1YIYA 1ARTA 1SPAA 1JF9A 1GEYA 1MGVA 8AATA 2R5CB 2GB3A 2BYJA 3E2YA 3QPGA 3ZRPA 3AENA 2AY5A 1IUGA 1RV4A 3EI7A 1AKCA 1AAMA 2CH1A 5LH9A 1AHFA 4A0GA 2W8UA 3FZ6A 2ZJGA 3I5TA 4ISYA 4HF8A 1IVRA 4ZM4A 1AHXA 1ECXA 2W7JA 4BMKA 1MDOA 4RM1A 2VMUA 3I4JA 4OBVA 4RJYA 3AEJC 1PMOA 3MEBA 3JWBA 3VOMA 3A9ZA 1C7GA 3IF2A 2BHXA 2JJEA 2X3LA 4KAMA 1GC4A 1B5OA 3ATHA 2VGZA 1ASDA 2Z20A 3GZDC 1M7YA 2ZUKA 4Q31A 2YHKA 1CQ7A 1KL2A 4PFFA 4A6UA 1M32A 2TPLA 4EB5A 1V72A 5DJ1A 2QBTA 2VMYA 1I48A 4GEBA 3BWOA 3AEOA 5M4DA 4EU1A 3MAFB 1BS0A 4N0BA 2VMTA 5DB5A 5C6UA 3FQAA 3B1EA 2JJGA 4OYTA 3FQ7A 2FQ6A 1TOIA 3B8XA 2ZSMA 4XAUA 4ZASA 2CJDA 3FVUA 4CXRA 3DU4A 2CANA 2DR1A 3E2ZA 3I16A 3B1DA 3P6KA 4OBUA 3VK4A 1AHEA 1WSTA 3FDBA 3BC8A 3MADA 4XJLA 1WYVB 1YJYA 4BQ0A 4RIZA 1SFFA 1H0CA 3LVKA 2FKIA 4UQVA 1PFFA 1CS1A 1XI9A 3PD6A 2C0RA 4OTLA 4OCAA 1S08A 4PFNA 3JU7A 1UU0A 2QLRA 4K2MA 4R8DA 1ASNA 2YKUA 2CB1A 5EIGB 4A72A 2EYQA 4XJOA 1WYTB 4WYDA 2D63A 3K7YA 3JW9A 4RJ0A 2ZY4A 2BKWA 1X2AA 1YJSA 2AY1A 3GBXA 3WKSA 3WGBA 4AH3A 1CQ6A 2PB2A 5M46A 4W1XA 4R5ZA 3QM2A 4A6TA 2QB3A 4O6ZA 5FT4A 1QJ3A 4EFFA 3LWSA 2DGKA 3R4TA 1GDEA 5G4JA 2G6WA 4F4EA 1BJOA 4LNJA 4F5KA 1YJZA 4XJMA 4RKDA 2QSRA 3N75A 4B98A 2HUUA 1C9CA 3GETA 3LV2A 4WLJA 1I43A 3FKDA 4IYOB 1B5PA 3G7QA 4KYOA 3FCRA 3E2FA 3ZRQA 1ASCA 4ZDOA 3BS8A 1VEFA 3NYTA 3FSLA 1OHVA 3MBBA 5HHYA 3PJ0A 2GQNA 4IY7A 1ARGA 1TARA 3ZZJA 3N5MA 3KE3A 3NYUA 5F9SA 1AMRA 1AY8A 1YOOA 3HT4A 2G7JA 1V2EA 2W8WA 4MQPA 2JG2A 4CBRA 2VMWA 4IW7A 1AJRA 4EB7A 1CL2A 4F5LA 3LY1A 3HDOA 4DQ6A 3AEMA 2DGMA 1QZ9A 3ELPA 3GWPA 4P3MA 1Z7DA 1RVYA 4BHDA 4F5JA 3NUBA 4Q6RA 3Q8NA 4F5GA 2VGVA 2X5FA 1C7OA 2AY6A 1MAQA 3HL2A 3P1TA 3VK3A 2HZPA 5I92A 1ASMA 3EI5A 1B9HA 3RBLA 4Q76A 2BI9A 3IHJA 1ASFA 3DODA 2A1VA 3BWNC 2ZP7A 1FC4A 1ASBA 1N31A 2W7MA 7AATA 4AO9A 1T3IA 1TOGA 4N0WA 3EI9A 2WK8A 4J5UA 1PG8A 1IBJA 2YRRA 3FZ7A 2D7ZA 1UU2A 1IX8A 2XBNA 5DX5A 4ZDLA 2YKYA 2DOUA 1TATA 3F9TA 5EAVA 2ZSLA 3EZ1A 3LVLB 1AKBA 4F5FA 5J8QA 1ARSA 3II0A 4B9BA 2X5DA 3GJUA 3N0LA 1I29A 1LC5A 2R0TA 3BN1A 2RFVA 2VMNA 4GSAA 1CQ8A 3AOVA 4JE5A 1W7NA 2CJHA 4K2BA 4WYGA 1BJ4A 4ZWMA 3A2BA 4GE4A 4XEWA 3W1HA 1M0PA 4GE9A 1GD9A 1S07A 1GC0A 2W7GA 3PPLA 2W7FA 5EUEA 1FG3A 4F5IA 4UHMA 1IJIA 1X29A 4AZKA 1B8GA 3NYSA 3RCHB 4HVKA 5FT5A 3KGWA 3MC6C 5FT6A 3FDDA 1BQAA 1G4XA 1KMJA 3DXVA 1CZEA 3NNKA 1D7UA 3NRAA 4JEWA 1ELQA 2D65A 2OKJA 4ZLVA 2HP1A 1C4KA 1DJEA 1U08A 1BJWA 2DGLA 2JISA 2YCNA 3QHXA 4E1OA 1GBNA 2BWOA 3AENB 4WYEA 3TFUA 4ADBA 2O1BA 3MAFA 4LNMA 3RUYA 2FNIA 3K28A 4MKKA 1S06A 1MLZA 4GRXA 3NU7A 5E5IA 2CSTA 4WXGA 1CJ0A 1LC7A 2OATA 3ASBA 2VMPA 5G2PA 3TFTA 2VMZA 1UKJA 3DRDA 1D7VA 2QA3A 1QJ5A 4XJPA 2AEUA 4Y0HA 1EQBA 2PB0A 3CBFA 5LHAA 3NTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BV0 A;  1LW5 A;  3FVS A;  2VI8 A;  3PIU A;  4LC3 A;  1V2F A;  1AHY A;  3DR4 A;  2HOR A;  1J32 A;  2E7U A;  2ZC0 A;  1AIC A;  2O0R A;  4W1V A;  1D7R A;  4LW4 A;  2E7I A;  1EJI A;  1SZS A;  3A9X A;  4BA5 A;  3BWN A;  4FL0 A;  1TOK A;  3WCO A;  2CFB A;  4RLG A;  2Z61 A;  1N2T A;  3ISL A;  1B4X A;  2O7C A;  2QB2 A;  3K40 A;  1W7L A;  1GEW A;  3WZF A;  3NUI A;  1VJO A;  5TF5 A;  1M0N A;  1G7X A;  2BI3 A;  1AKA A;  2YKX A;  1AX4 A;  4ADC A;  2HOX A;  1S09 A;  3E2Z B;  4WXF A;  2BWP A;  2EPJ A;  3DYD A;  4UHO A;  3OP7 A;  1BT4 A;  2AY9 A;  2DKJ A;  3CQ6 A;  3PD6 B;  2Z9W A;  1QIR A;  1DKA A;  3EIA A;  3ZRR A;  1RVU A;  3AOW A;  1M4N A;  4W8I A;  4E3Q A;  3UAK A;  1DJ9 A;  1AMQ A;  4MSO A;  2VMQ A;  1O69 A;  4JF0 A;  2HUF A;  1AY4 A;  3PDB B;  3DC1 A;  1QIT A;  3GR9 A;  4ZWV A;  3E77 A;  4XK1 A;  3B46 A;  1C0N A;  4A0F A;  2EGY A;  1GC3 A;  2HOZ A;  1MDZ A;  1BKG A;  3AEJ A;  1JS3 A;  2YCP A;  2BI2 A;  5HDM A;  1XEY A;  2HUI A;  4R2N A;  1S0A A;  4XQ2 A;  5E3K A;  2VMX A;  1DFO A;  1GEX A;  5DJ9 A;  1GC2 A;  2D66 A;  3BB8 A;  4JF1 A;  2Z9U A;  2VMS A;  1OHW A;  2X8U A;  2VLH A;  3FD0 A;  3BCA A;  1YIZ A;  3FFR A;  4IXO A;  1BJO B;  3D6K A;  4WP0 A;  2HP2 A;  2VIB A;  3A8U X;  3B1C A;  5BJ3 A;  1JS6 A;  3FQ8 A;  3R9A A;  3WY7 A;  1KL1 A;  1OXP A;  4ATP A;  3EI6 A;  1ARH A;  1CZC A;  1ORD A;  4WBT A;  2BI5 A;  1WKH A;  5EUN A;  3FZ8 A;  4WB0 B;  3G8M A;  3GZD A;  4OT8 A;  3EIB A;  3LVJ A;  4NOG A;  4R5F A;  4CVQ A;  1OXO A;  2JGT A;  3BCB A;  4CXQ A;  2W7K A;  5G09 A;  4K2I A;  1AJS A;  2Z67 A;  1O61 A;  1KKP A;  2GMU A;  1AY5 A;  3F0H A;  1WYU B;  3EZS A;  3PDX A;  4I8A A;  4WYF A;  2ZYJ A;  1J04 A;  3ACZ A;  4U1T A;  1Z3Z A;  2QMA A;  1UU1 A;  3H7F A;  1X28 A;  1LS3 A;  2W7L A;  2D5Y A;  1ARI A;  1JG8 A;  1G4V A;  3QGU A;  1AMA A;  2R5C A;  2Z9X A;  4Q75 A;  1ASA A;  4JEY A;  2VGU A;  3ZZK A;  1M6S A;  1SZK A;  1QGN A;  5EAA A;  2W7D A;  4ATQ A;  4E77 A;  4ITX A;  4RKC A;  2YKV A;  3GSB A;  1IAY A;  2VGW A;  4F5H A;  3JWA A;  5AX8 A;  1H1C A;  3E9K A;  5BJ4 A;  1AAW A;  2BIE A;  4DBC A;  2VGS A;  2D61 A;  4GE7 A;  5K8B A;  2ORD A;  4ADD A;  3TAT A;  1D7S A;  2Z1Y A;  1ZC9 A;  4ZDP A;  1W7M A;  3WCN A;  2XH1 A;  4A6R A;  3WKR A;  1IAX A;  1KMK A;  4EMY A;  3NDN A;  3PGY A;  3HQT A;  4Y0D A;  4WD2 A;  1OAT A;  1CL1 A;  2W8T A;  1BW0 A;  3HVY A;  4W1W A;  2VYC A;  3HBX A;  2AY3 A;  3NX3 A;  9AAT A;  4MQR A;  4J8L A;  5G2Q A;  4E3R A;  2ZY2 A;  3JZL A;  2OQX A;  2EH6 A;  1LK9 A;  2C7T A;  4A0R A;  1YNU A;  2VIA A;  2PO3 A;  5G4I A;  1Y4I A;  2V0Y A;  4PIW A;  2YCT A;  4JEZ A;  1O62 A;  2V1P A;  3OKS A;  3QBO A;  4IX8 A;  4UHN A;  5FT8 A;  3JTX A;  2VLF A;  3LVM A;  4P7Y A;  2R5E A;  4LNL A;  1W23 A;  2OGE A;  3FRK A;  4F5M A;  3EUC A;  2BYL A;  1N8P A;  4WYA A;  1RV3 A;  1C7N A;  3AAT A;  1P3W A;  2JJF A;  1VP4 A;  3PAA A;  5EUD A;  3AV7 A;  1AIA A;  1WYV A;  1TOJ A;  2BI1 A;  1FG7 A;  3MKJ A;  2WK9 A;  4L0O A;  2CJG A;  2C44 A;  3G0T A;  1OHY A;  1GCK A;  3VP6 A;  1ZOB A;  1AHG A;  4WYC A;  2W8J A;  5HXX A;  2VMV A;  5EIG A;  4UOY A;  3TCM A;  1WYT A;  1DGE A;  3COG A;  4M2J A;  2HOY A;  3WLX A;  1BQD A;  3AEM C;  3AEL A;  2AAT A;  3GZC A;  3EI8 A;  2EO5 A;  2FYF A;  4JEV A;  5EFS A;  3VAX A;  2BIA A;  4IXZ A;  1I41 A;  2VMR A;  4WXB A;  1TPL A;  3E6G A;  3VK2 A;  3QI6 A;  2Z1Z A;  4M2M A;  4Y0I A;  4GDY A;  4JEX A;  2VI9 A;  2FN6 A;  1IX7 A;  5EQC A;  1SF2 A;  3WGC A;  2GMS A;  4AO4 A;  2CH2 A;  1E5E A;  1O4S A;  5JAY A;  4TMR A;  3PDB A;  4IYO A;  3ASA A;  2BIG A;  1ASL A;  1KKJ A;  2AY8 A;  2AEV A;  3A9Y A;  4M2K A;  1G7W A;  2E7J A;  2W7E A;  3FTB A;  4RIT A;  1MAP A;  1X0M A;  4FFC A;  1V2D A;  3USF A;  4TV7 A;  5IWQ A;  3L8A A;  4DGT A;  3MC6 A;  4BA4 A;  4IXS A;  2VGT A;  4PVF A;  3RQ1 A;  3CAI A;  3FVX A;  4CBS A;  2CIN A;  2C81 A;  2CY8 A;  3RI6 A;  2CTZ A;  2F8J A;  2OKK A;  3H14 A;  2D7Y A;  5F8V A;  1DTY A;  3T32 A;  4U2H A;  1MDX A;  2DKB A;  2D64 A;  2AY7 A;  2W7I A;  4KXK A;  4AOA A;  1SZU A;  3DR7 A;  1EG5 A;  4TN4 A;  1BJN A;  4A00 A;  4ITG A;  1E5F A;  4ZM3 A;  4W5K A;  2Z9V A;  4MY5 A;  4QGR A;  3QN6 A;  4H51 A;  4OC9 A;  3MAU A;  2W7H A;  4WB0 A;  4W91 A;  3ECD A;  4AZJ A;  2R2N A;  4MKJ A;  3TQX A;  3RBF A;  2ZY5 A;  1IX6 A;  3ELE A;  2E54 A;  1QIS A;  1PMM A;  3KGX A;  2Q7W A;  3L44 A;  3W1J A;  1WYU A;  1M0Q A;  4JE5 D;  1ASG A;  5D5S A;  3F6T A;  2YRI A;  3UWC A;  4A0H A;  2YOB A;  1D2F A;  3M5U A;  4ZAH A;  1B9I A;  2EZ2 A;  4ZSW A;  4ADE A;  3PA9 A;  1LC8 A;  4WLH A;  3FFH A;  4ZSY A;  3DZZ A;  2FNU A;  3W1I A;  1LW4 A;  1WKG A;  1DGD A;  1MLY A;  1TOE A;  3HMU A;  2AY2 A;  5E4Z A;  2GSA A;  2AY4 A;  3LG0 A;  2W8V A;  3AEP A;  1DJU A;  3HLM A;  1YAA A;  2WKA A;  3CQ5 A;  1SVV A;  1TAS A;  4MQQ A;  4RAE A;  1ASE A;  2EZ1 A;  2ZY3 A;  1M0O A;  2NMP A;  2FM1 A;  1AIB A;  1W3U A;  3DXW A;  5M49 A;  3BCX A;  4MGR A;  3CQ4 A;  2WK7 A;  2VMO A;  4LW2 A;  5G0A A;  3WX9 A;  1AMS A;  2JJH A;  1ELU A;  4OMA A;  2BWN A;  1AJS B;  3UE8 A;  1LKC A;  3NU8 A;  5D95 A;  1ZOD A;  2OGA A;  5M4B A;  3KKI A;  3RCH A;  1YIY A;  1ART A;  1SPA A;  1JF9 A;  1GEY A;  1MGV A;  8AAT A;  2R5C B;  2GB3 A;  2BYJ A;  3E2Y A;  3QPG A;  3ZRP A;  3AEN A;  2AY5 A;  1IUG A;  1RV4 A;  3EI7 A;  1AKC A;  1AAM A;  2CH1 A;  5LH9 A;  1AHF A;  4A0G A;  2W8U A;  3FZ6 A;  2ZJG A;  3I5T A;  4ISY A;  4HF8 A;  1IVR A;  4ZM4 A;  1AHX A;  1ECX A;  2W7J A;  4BMK A;  1MDO A;  4RM1 A;  2VMU A;  3I4J A;  4OBV A;  4RJY A;  3AEJ C;  1PMO A;  3MEB A;  3JWB A;  3VOM A;  3A9Z A;  1C7G A;  3IF2 A;  2BHX A;  2JJE A;  2X3L A;  4KAM A;  1GC4 A;  1B5O A;  3ATH A;  2VGZ A;  1ASD A;  2Z20 A;  3GZD C;  1M7Y A;  2ZUK A;  4Q31 A;  2YHK A;  1CQ7 A;  1KL2 A;  4PFF A;  4A6U A;  1M32 A;  2TPL A;  4EB5 A;  1V72 A;  5DJ1 A;  2QBT A;  2VMY A;  1I48 A;  4GEB A;  3BWO A;  3AEO A;  5M4D A;  4EU1 A;  3MAF B;  1BS0 A;  4N0B A;  2VMT A;  5DB5 A;  5C6U A;  3FQA A;  3B1E A;  2JJG A;  4OYT A;  3FQ7 A;  2FQ6 A;  1TOI A;  3B8X A;  2ZSM A;  4XAU A;  4ZAS A;  2CJD A;  3FVU A;  4CXR A;  3DU4 A;  2CAN A;  2DR1 A;  3E2Z A;  3I16 A;  3B1D A;  3P6K A;  4OBU A;  3VK4 A;  1AHE A;  1WST A;  3FDB A;  3BC8 A;  3MAD A;  4XJL A;  1WYV B;  1YJY A;  4BQ0 A;  4RIZ A;  1SFF A;  1H0C A;  3LVK A;  4UQV A;  1PFF A;  1CS1 A;  1XI9 A;  3PD6 A;  2C0R A;  4OTL A;  4OCA A;  1S08 A;  4PFN A;  3JU7 A;  1UU0 A;  2QLR A;  4K2M A;  4R8D A;  1ASN A;  2YKU A;  2CB1 A;  5EIG B;  4A72 A;  4XJO A;  1WYT B;  4WYD A;  2D63 A;  3K7Y A;  3JW9 A;  4RJ0 A;  2ZY4 A;  2BKW A;  1X2A A;  1YJS A;  2AY1 A;  3GBX A;  3WKS A;  3WGB A;  4AH3 A;  1CQ6 A;  2PB2 A;  5M46 A;  4W1X A;  4R5Z A;  3QM2 A;  4A6T A;  2QB3 A;  4O6Z A;  5FT4 A;  1QJ3 A;  4EFF A;  3LWS A;  2DGK A;  3R4T A;  1GDE A;  5G4J A;  2G6W A;  4F4E A;  1BJO A;  4LNJ A;  4F5K A;  1YJZ A;  4XJM A;  4RKD A;  3N75 A;  4B98 A;  2HUU A;  1C9C A;  3GET A;  3LV2 A;  4WLJ A;  1I43 A;  3FKD A;  4IYO B;  1B5P A;  3G7Q A;  4KYO A;  3FCR A;  3E2F A;  3ZRQ A;  1ASC A;  4ZDO A;  3BS8 A;  1VEF A;  3NYT A;  3FSL A;  1OHV A;  3MBB A;  5HHY A;  3PJ0 A;  2GQN A;  4IY7 A;  1ARG A;  1TAR A;  3ZZJ A;  3N5M A;  3KE3 A;  3NYU A;  5F9S A;  1AMR A;  1AY8 A;  1YOO A;  3HT4 A;  1V2E A;  2W8W A;  4MQP A;  2JG2 A;  4CBR A;  2VMW A;  4IW7 A;  1AJR A;  4EB7 A;  1CL2 A;  4F5L A;  3LY1 A;  3HDO A;  4DQ6 A;  3AEM A;  2DGM A;  1QZ9 A;  3ELP A;  3GWP A;  4P3M A;  1Z7D A;  1RVY A;  4BHD A;  4F5J A;  3NUB A;  4Q6R A;  3Q8N A;  4F5G A;  2VGV A;  2X5F A;  1C7O A;  2AY6 A;  1MAQ A;  3HL2 A;  3P1T A;  3VK3 A;  2HZP A;  5I92 A;  1ASM A;  3EI5 A;  1B9H A;  3RBL A;  4Q76 A;  2BI9 A;  3IHJ A;  1ASF A;  3DOD A;  3BWN C;  2ZP7 A;  1FC4 A;  1ASB A;  1N31 A;  2W7M A;  7AAT A;  4AO9 A;  1T3I A;  1TOG A;  4N0W A;  3EI9 A;  2WK8 A;  4J5U A;  1PG8 A;  1IBJ A;  2YRR A;  3FZ7 A;  2D7Z A;  1UU2 A;  1IX8 A;  2XBN A;  5DX5 A;  4ZDL A;  2YKY A;  2DOU A;  1TAT A;  3F9T A;  5EAV A;  2ZSL A;  3EZ1 A;  3LVL B;  1AKB A;  4F5F A;  5J8Q A;  1ARS A;  3II0 A;  4B9B A;  2X5D A;  3GJU A;  3N0L A;  1I29 A;  1LC5 A;  2R0T A;  3BN1 A;  2RFV A;  2VMN A;  4GSA A;  1CQ8 A;  3AOV A;  4JE5 A;  1W7N A;  2CJH A;  4K2B A;  4WYG A;  1BJ4 A;  4ZWM A;  3A2B A;  4GE4 A;  4XEW A;  3W1H A;  1M0P A;  4GE9 A;  1GD9 A;  1S07 A;  1GC0 A;  2W7G A;  3PPL A;  2W7F A;  5EUE A;  1FG3 A;  4F5I A;  4UHM A;  1IJI A;  1X29 A;  4AZK A;  1B8G A;  3NYS A;  3RCH B;  4HVK A;  5FT5 A;  3KGW A;  3MC6 C;  5FT6 A;  3FDD A;  1BQA A;  1G4X A;  1KMJ A;  3DXV A;  1CZE A;  3NNK A;  1D7U A;  3NRA A;  4JEW A;  1ELQ A;  2D65 A;  2OKJ A;  4ZLV A;  2HP1 A;  1C4K A;  1DJE A;  1U08 A;  1BJW A;  2DGL A;  2JIS A;  2YCN A;  3QHX A;  4E1O A;  1GBN A;  2BWO A;  3AEN B;  4WYE A;  3TFU A;  4ADB A;  2O1B A;  3MAF A;  4LNM A;  3RUY A;  2FNI A;  3K28 A;  4MKK A;  1S06 A;  1MLZ A;  4GRX A;  3NU7 A;  5E5I A;  2CST A;  4WXG A;  1CJ0 A;  1LC7 A;  2OAT A;  3ASB A;  2VMP A;  5G2P A;  3TFT A;  2VMZ A;  1UKJ A;  3DRD A;  1D7V A;  2QA3 A;  1QJ5 A;  4XJP A;  2AEU A;  4Y0H A;  1EQB A;  2PB0 A;  3CBF A;  5LHA A;  3NTJ A; 
#chains in the Genus database with same CATH topology
 3BV0 A;  1LW5 A;  3FVS A;  2VI8 A;  3PIU A;  4LC3 A;  1V2F A;  1AHY A;  3DR4 A;  2HOR A;  1J32 A;  2E7U A;  2ZC0 A;  1AIC A;  2O0R A;  4W1V A;  1D7R A;  4LW4 A;  2E7I A;  1EJI A;  1SZS A;  3A9X A;  4BA5 A;  3BWN A;  4FL0 A;  1TOK A;  4H63 Q;  3WCO A;  2CFB A;  4RLG A;  2Z61 A;  1N2T A;  3ISL A;  1B4X A;  2O7C A;  2QB2 A;  3K40 A;  1W7L A;  1GEW A;  3WZF A;  3NUI A;  1VJO A;  5TF5 A;  1M0N A;  1G7X A;  2BI3 A;  1AKA A;  2YKX A;  1AX4 A;  4ADC A;  2HOX A;  1S09 A;  3E2Z B;  4WXF A;  2BWP A;  2EPJ A;  3DYD A;  4UHO A;  3OP7 A;  1BT4 A;  2AY9 A;  2DKJ A;  3CQ6 A;  3PD6 B;  2Z9W A;  1QIR A;  1DKA A;  3EIA A;  3ZRR A;  1RVU A;  3AOW A;  2KFP A;  1M4N A;  4W8I A;  4E3Q A;  3UAK A;  1DJ9 A;  1AMQ A;  4MSO A;  2VMQ A;  1O69 A;  4JF0 A;  2HUF A;  1AY4 A;  3PDB B;  3DC1 A;  1QIT A;  3GR9 A;  4ZWV A;  3E77 A;  4XK1 A;  3B46 A;  1C0N A;  4A0F A;  2EGY A;  1GC3 A;  2HOZ A;  1MDZ A;  1BKG A;  3AEJ A;  1JS3 A;  2YCP A;  2BI2 A;  5HDM A;  1XEY A;  2HUI A;  4R2N A;  1S0A A;  4XQ2 A;  5E3K A;  2VMX A;  1DFO A;  1GEX A;  5DJ9 A;  1GC2 A;  2D66 A;  3BB8 A;  4JF1 A;  2Z9U A;  2VMS A;  1OHW A;  2X8U A;  2VLH A;  3FD0 A;  3BCA A;  1YIZ A;  3FFR A;  4IXO A;  1BJO B;  3D6K A;  4WP0 A;  2HP2 A;  2VIB A;  3A8U X;  3B1C A;  5BJ3 A;  1JS6 A;  3FQ8 A;  3R9A A;  3WY7 A;  1KL1 A;  1OXP A;  4ATP A;  4K05 A;  3EI6 A;  1ARH A;  1CZC A;  1ORD A;  4WBT A;  2BI5 A;  1WKH A;  5EUN A;  3FZ8 A;  4WB0 B;  3G8M A;  3GZD A;  4OT8 A;  3EIB A;  3LVJ A;  4NOG A;  4R5F A;  4CVQ A;  1OXO A;  2JGT A;  3BCB A;  4CXQ A;  2W7K A;  5G09 A;  4K2I A;  1AJS A;  2Z67 A;  1O61 A;  1KKP A;  2GMU A;  1AY5 A;  3F0H A;  1WYU B;  3EZS A;  3PDX A;  4I8A A;  4WYF A;  2ZYJ A;  1J04 A;  3ACZ A;  4U1T A;  1Z3Z A;  2QMA A;  1UU1 A;  3H7F A;  1X28 A;  1LS3 A;  2W7L A;  2D5Y A;  1ARI A;  1JG8 A;  1G4V A;  3QGU A;  1AMA A;  2R5C A;  2Z9X A;  4Q75 A;  1ASA A;  4JEY A;  2VGU A;  3ZZK A;  1M6S A;  1SZK A;  1QGN A;  5EAA A;  2W7D A;  4ATQ A;  4E77 A;  4ITX A;  4RKC A;  2YKV A;  3GSB A;  1IAY A;  2VGW A;  4F5H A;  3JWA A;  5AX8 A;  1H1C A;  3E9K A;  5BJ4 A;  1AAW A;  2BIE A;  3H9X A;  4DBC A;  2VGS A;  2D61 A;  4GE7 A;  5K8B A;  2ORD A;  4ADD A;  3TAT A;  1D7S A;  2Z1Y A;  1ZC9 A;  4ZDP A;  1W7M A;  3WCN A;  2XH1 A;  4A6R A;  3WKR A;  1IAX A;  1KMK A;  4EMY A;  3NDN A;  2WB6 A;  3PGY A;  3HQT A;  4Y0D A;  4WD2 A;  1OAT A;  1CL1 A;  2W8T A;  1BW0 A;  3HVY A;  4W1W A;  2VYC A;  3HBX A;  2AY3 A;  3NX3 A;  9AAT A;  4MQR A;  4J8L A;  5G2Q A;  4E3R A;  2ZY2 A;  3JZL A;  2OQX A;  2EH6 A;  1LK9 A;  2C7T A;  4A0R A;  1YNU A;  2VIA A;  2PO3 A;  5G4I A;  1Y4I A;  2V0Y A;  4PIW A;  2YCT A;  4JEZ A;  1O62 A;  2V1P A;  3OKS A;  3QBO A;  4IX8 A;  4UHN A;  5FT8 A;  3JTX A;  3N4X A;  2VLF A;  3LVM A;  4P7Y A;  2R5E A;  4LNL A;  1W23 A;  2OGE A;  3FRK A;  4F5M A;  3EUC A;  2BYL A;  1N8P A;  4WYA A;  1RV3 A;  1C7N A;  3AAT A;  1P3W A;  2JJF A;  1VP4 A;  3PAA A;  5EUD A;  3AV7 A;  1KAF A;  1AIA A;  1WYV A;  1TOJ A;  2BI1 A;  1FG7 A;  3MKJ A;  2WK9 A;  4L0O A;  2CJG A;  2C44 A;  3G0T A;  1OHY A;  1GCK A;  3VP6 A;  1ZOB A;  1AHG A;  4WYC A;  2W8J A;  5HXX A;  2VMV A;  5EIG A;  4UOY A;  3TCM A;  1WYT A;  1DGE A;  3COG A;  4M2J A;  2HOY A;  3WLX A;  1BQD A;  3AEM C;  3AEL A;  2AAT A;  3GZC A;  3EI8 A;  2EO5 A;  2FYF A;  4JEV A;  5EFS A;  3VAX A;  2BIA A;  4IXZ A;  1I41 A;  2VMR A;  4WXB A;  1TPL A;  3E6G A;  3VK2 A;  3QI6 A;  2Z1Z A;  4M2M A;  4Y0I A;  4GDY A;  4JEX A;  2VI9 A;  2FN6 A;  1IX7 A;  5EQC A;  1SF2 A;  3WGC A;  2GMS A;  4AO4 A;  2CH2 A;  1E5E A;  1O4S A;  5JAY A;  4TMR A;  3PDB A;  4IYO A;  3ASA A;  2BIG A;  1ASL A;  1KKJ A;  2AY8 A;  2AEV A;  3A9Y A;  4M2K A;  1G7W A;  2E7J A;  2W7E A;  3FTB A;  4RIT A;  1MAP A;  1X0M A;  3N4S A;  4FFC A;  1V2D A;  3USF A;  4TV7 A;  5IWQ A;  3L8A A;  4DGT A;  3MC6 A;  4BA4 A;  4IXS A;  2VGT A;  4PVF A;  3RQ1 A;  3CAI A;  3FVX A;  4CBS A;  2CIN A;  2C81 A;  2CY8 A;  3RI6 A;  2CTZ A;  2F8J A;  2OKK A;  3H14 A;  2D7Y A;  5F8V A;  1DTY A;  3T32 A;  3N4R A;  4U2H A;  1MDX A;  2DKB A;  2D64 A;  2AY7 A;  2W7I A;  4KXK A;  4AOA A;  1SZU A;  3DR7 A;  1EG5 A;  4TN4 A;  1BJN A;  4A00 A;  4ITG A;  1E5F A;  4ZM3 A;  4W5K A;  2Z9V A;  4MY5 A;  4QGR A;  3QN6 A;  4H51 A;  4OC9 A;  3MAU A;  2W7H A;  4WB0 A;  4W91 A;  3ECD A;  4AZJ A;  2R2N A;  4MKJ A;  3TQX A;  3RBF A;  2ZY5 A;  1IX6 A;  3ELE A;  2E54 A;  1QIS A;  5KTB A;  1PMM A;  3KGX A;  2Q7W A;  3L44 A;  3W1J A;  1WYU A;  1M0Q A;  4JE5 D;  1ASG A;  5D5S A;  3F6T A;  2YRI A;  3UWC A;  4A0H A;  2YOB A;  1D2F A;  3M5U A;  4ZAH A;  1B9I A;  2EZ2 A;  4ZSW A;  4ADE A;  3PA9 A;  1LC8 A;  4WLH A;  3FFH A;  4ZSY A;  3DZZ A;  2FNU A;  3W1I A;  1LW4 A;  3N7N A;  1WKG A;  1DGD A;  1MLY A;  1TOE A;  3HMU A;  2AY2 A;  5E4Z A;  2GSA A;  2AY4 A;  3LG0 A;  2W8V A;  3AEP A;  1DJU A;  3HLM A;  1YAA A;  2WKA A;  3CQ5 A;  1SVV A;  1TAS A;  4MQQ A;  4RAE A;  1ASE A;  2EZ1 A;  2ZY3 A;  1M0O A;  2NMP A;  2FM1 A;  1AIB A;  1W3U A;  3DXW A;  5M49 A;  3BCX A;  4MGR A;  3CQ4 A;  2WK7 A;  2VMO A;  4LW2 A;  5G0A A;  3WX9 A;  1AMS A;  2JJH A;  1ELU A;  4OMA A;  2BWN A;  1AJS B;  3UE8 A;  1LKC A;  3NU8 A;  5D95 A;  1ZOD A;  2OGA A;  5M4B A;  3KKI A;  3RCH A;  1YIY A;  1ART A;  1SPA A;  1JF9 A;  1GEY A;  1MGV A;  8AAT A;  2R5C B;  2GB3 A;  2BYJ A;  3E2Y A;  3QPG A;  3ZRP A;  3AEN A;  2AY5 A;  1IUG A;  1RV4 A;  3EI7 A;  1AKC A;  1AAM A;  2CH1 A;  5LH9 A;  1AHF A;  4A0G A;  2W8U A;  3FZ6 A;  2ZJG A;  3I5T A;  4ISY A;  4HF8 A;  1IVR A;  4ZM4 A;  1AHX A;  1ECX A;  2W7J A;  4BMK A;  1MDO A;  4RM1 A;  2VMU A;  3I4J A;  4OBV A;  4RJY A;  3AEJ C;  1PMO A;  3MEB A;  3JWB A;  3VOM A;  3A9Z A;  1C7G A;  3IF2 A;  2BHX A;  2JJE A;  2X3L A;  4KAM A;  1GC4 A;  1B5O A;  3ATH A;  2VGZ A;  1ASD A;  2Z20 A;  3GZD C;  1M7Y A;  2ZUK A;  4Q31 A;  2YHK A;  1CQ7 A;  1KL2 A;  4PFF A;  4A6U A;  1M32 A;  2TPL A;  4EB5 A;  1V72 A;  5DJ1 A;  2QBT A;  2VMY A;  1I48 A;  4GEB A;  3BWO A;  3AEO A;  5M4D A;  4EU1 A;  3MAF B;  1BS0 A;  4N0B A;  2VMT A;  5DB5 A;  5C6U A;  3FQA A;  3B1E A;  2JJG A;  4OYT A;  3FQ7 A;  2FQ6 A;  1TOI A;  3B8X A;  2ZSM A;  4XAU A;  4ZAS A;  2CJD A;  3FVU A;  4CXR A;  3DU4 A;  2CAN A;  2DR1 A;  3E2Z A;  3I16 A;  3B1D A;  3P6K A;  4OBU A;  3VK4 A;  1AHE A;  1WST A;  3FDB A;  3BC8 A;  3MAD A;  4XJL A;  1WYV B;  1YJY A;  4BQ0 A;  4RIZ A;  1SFF A;  1H0C A;  3LVK A;  2FKI A;  4UQV A;  1PFF A;  1CS1 A;  1XI9 A;  3PD6 A;  2C0R A;  4OTL A;  4OCA A;  1S08 A;  4PFN A;  3JU7 A;  1UU0 A;  2QLR A;  4K2M A;  4R8D A;  1ASN A;  2YKU A;  2CB1 A;  5EIG B;  4A72 A;  2EYQ A;  4XJO A;  1WYT B;  4WYD A;  2D63 A;  3K7Y A;  3JW9 A;  4RJ0 A;  2ZY4 A;  2BKW A;  1X2A A;  1YJS A;  2AY1 A;  3GBX A;  3WKS A;  3WGB A;  4AH3 A;  1CQ6 A;  2PB2 A;  5M46 A;  4W1X A;  4R5Z A;  3QM2 A;  4A6T A;  2QB3 A;  4O6Z A;  5FT4 A;  1QJ3 A;  4EFF A;  3LWS A;  2DGK A;  3R4T A;  1GDE A;  5G4J A;  2G6W A;  4F4E A;  1BJO A;  4LNJ A;  4F5K A;  1YJZ A;  4XJM A;  4RKD A;  2QSR A;  3N75 A;  4B98 A;  2HUU A;  1C9C A;  3GET A;  3LV2 A;  4WLJ A;  1I43 A;  3FKD A;  4IYO B;  1B5P A;  3G7Q A;  4KYO A;  3FCR A;  3E2F A;  3ZRQ A;  1ASC A;  4ZDO A;  3BS8 A;  1VEF A;  3NYT A;  3FSL A;  1OHV A;  3MBB A;  5HHY A;  3PJ0 A;  2GQN A;  4IY7 A;  1ARG A;  1TAR A;  3ZZJ A;  3N5M A;  3KE3 A;  3NYU A;  5F9S A;  1AMR A;  1AY8 A;  1YOO A;  3HT4 A;  2G7J A;  1V2E A;  2W8W A;  4MQP A;  2JG2 A;  4CBR A;  2VMW A;  4IW7 A;  1AJR A;  4EB7 A;  1CL2 A;  4F5L A;  3LY1 A;  3HDO A;  4DQ6 A;  3AEM A;  2DGM A;  1QZ9 A;  3ELP A;  3GWP A;  4P3M A;  1Z7D A;  1RVY A;  4BHD A;  4F5J A;  3NUB A;  4Q6R A;  3Q8N A;  4F5G A;  2VGV A;  2X5F A;  1C7O A;  2AY6 A;  1MAQ A;  3HL2 A;  3P1T A;  3VK3 A;  2HZP A;  5I92 A;  1ASM A;  3EI5 A;  1B9H A;  3RBL A;  4Q76 A;  2BI9 A;  3IHJ A;  1ASF A;  3DOD A;  2A1V A;  3BWN C;  2ZP7 A;  1FC4 A;  1ASB A;  1N31 A;  2W7M A;  7AAT A;  4AO9 A;  1T3I A;  1TOG A;  4N0W A;  3EI9 A;  2WK8 A;  4J5U A;  1PG8 A;  1IBJ A;  2YRR A;  3FZ7 A;  2D7Z A;  1UU2 A;  1IX8 A;  2XBN A;  5DX5 A;  4ZDL A;  2YKY A;  2DOU A;  1TAT A;  3F9T A;  5EAV A;  2ZSL A;  3EZ1 A;  3LVL B;  1AKB A;  4F5F A;  5J8Q A;  1ARS A;  3II0 A;  4B9B A;  2X5D A;  3GJU A;  3N0L A;  1I29 A;  1LC5 A;  2R0T A;  3BN1 A;  2RFV A;  2VMN A;  4GSA A;  1CQ8 A;  3AOV A;  4JE5 A;  1W7N A;  2CJH A;  4K2B A;  4WYG A;  1BJ4 A;  4ZWM A;  3A2B A;  4GE4 A;  4XEW A;  3W1H A;  1M0P A;  4GE9 A;  1GD9 A;  1S07 A;  1GC0 A;  2W7G A;  3PPL A;  2W7F A;  5EUE A;  1FG3 A;  4F5I A;  4UHM A;  1IJI A;  1X29 A;  4AZK A;  1B8G A;  3NYS A;  3RCH B;  4HVK A;  5FT5 A;  3KGW A;  3MC6 C;  5FT6 A;  3FDD A;  1BQA A;  1G4X A;  1KMJ A;  3DXV A;  1CZE A;  3NNK A;  1D7U A;  3NRA A;  4JEW A;  1ELQ A;  2D65 A;  2OKJ A;  4ZLV A;  2HP1 A;  1C4K A;  1DJE A;  1U08 A;  1BJW A;  2DGL A;  2JIS A;  2YCN A;  3QHX A;  4E1O A;  1GBN A;  2BWO A;  3AEN B;  4WYE A;  3TFU A;  4ADB A;  2O1B A;  3MAF A;  4LNM A;  3RUY A;  2FNI A;  3K28 A;  4MKK A;  1S06 A;  1MLZ A;  4GRX A;  3NU7 A;  5E5I A;  2CST A;  4WXG A;  1CJ0 A;  1LC7 A;  2OAT A;  3ASB A;  2VMP A;  5G2P A;  3TFT A;  2VMZ A;  1UKJ A;  3DRD A;  1D7V A;  2QA3 A;  1QJ5 A;  4XJP A;  2AEU A;  4Y0H A;  1EQB A;  2PB0 A;  3CBF A;  5LHA A;  3NTJ A; 
#chains in the Genus database with same CATH homology
 3BV0 A;  1LW5 A;  3FVS A;  2VI8 A;  3PIU A;  4LC3 A;  1V2F A;  1AHY A;  3DR4 A;  2HOR A;  1J32 A;  2E7U A;  2ZC0 A;  1AIC A;  2O0R A;  4W1V A;  1D7R A;  4LW4 A;  2E7I A;  1EJI A;  1SZS A;  3A9X A;  4BA5 A;  3BWN A;  4FL0 A;  1TOK A;  4H63 Q;  3WCO A;  2CFB A;  4RLG A;  2Z61 A;  1N2T A;  3ISL A;  1B4X A;  2O7C A;  2QB2 A;  3K40 A;  1W7L A;  1GEW A;  3WZF A;  3NUI A;  1VJO A;  5TF5 A;  1M0N A;  1G7X A;  2BI3 A;  1AKA A;  2YKX A;  1AX4 A;  4ADC A;  2HOX A;  1S09 A;  3E2Z B;  4WXF A;  2BWP A;  2EPJ A;  3DYD A;  4UHO A;  3OP7 A;  1BT4 A;  2AY9 A;  2DKJ A;  3CQ6 A;  3PD6 B;  2Z9W A;  1QIR A;  1DKA A;  3EIA A;  3ZRR A;  1RVU A;  3AOW A;  2KFP A;  1M4N A;  4W8I A;  4E3Q A;  3UAK A;  1DJ9 A;  1AMQ A;  4MSO A;  2VMQ A;  1O69 A;  4JF0 A;  2HUF A;  1AY4 A;  3PDB B;  3DC1 A;  1QIT A;  3GR9 A;  4ZWV A;  3E77 A;  4XK1 A;  3B46 A;  1C0N A;  4A0F A;  2EGY A;  1GC3 A;  2HOZ A;  1MDZ A;  1BKG A;  3AEJ A;  1JS3 A;  2YCP A;  2BI2 A;  5HDM A;  1XEY A;  2HUI A;  4R2N A;  1S0A A;  4XQ2 A;  5E3K A;  2VMX A;  1DFO A;  1GEX A;  5DJ9 A;  1GC2 A;  2D66 A;  3BB8 A;  4JF1 A;  2Z9U A;  2VMS A;  1OHW A;  2X8U A;  2VLH A;  3FD0 A;  3BCA A;  1YIZ A;  3FFR A;  4IXO A;  1BJO B;  3D6K A;  4WP0 A;  2HP2 A;  2VIB A;  3A8U X;  3B1C A;  5BJ3 A;  1JS6 A;  3FQ8 A;  3R9A A;  3WY7 A;  1KL1 A;  1OXP A;  4ATP A;  4K05 A;  3EI6 A;  1ARH A;  1CZC A;  1ORD A;  4WBT A;  2BI5 A;  1WKH A;  5EUN A;  3FZ8 A;  4WB0 B;  3G8M A;  3GZD A;  4OT8 A;  3EIB A;  3LVJ A;  4NOG A;  4R5F A;  4CVQ A;  1OXO A;  2JGT A;  3BCB A;  4CXQ A;  2W7K A;  5G09 A;  4K2I A;  1AJS A;  2Z67 A;  1O61 A;  1KKP A;  2GMU A;  1AY5 A;  3F0H A;  1WYU B;  3EZS A;  3PDX A;  4I8A A;  4WYF A;  2ZYJ A;  1J04 A;  3ACZ A;  4U1T A;  1Z3Z A;  2QMA A;  1UU1 A;  3H7F A;  1X28 A;  1LS3 A;  2W7L A;  2D5Y A;  1ARI A;  1JG8 A;  1G4V A;  3QGU A;  1AMA A;  2R5C A;  2Z9X A;  4Q75 A;  1ASA A;  4JEY A;  2VGU A;  3ZZK A;  1M6S A;  1SZK A;  1QGN A;  5EAA A;  2W7D A;  4ATQ A;  4E77 A;  4ITX A;  4RKC A;  2YKV A;  3GSB A;  1IAY A;  2VGW A;  4F5H A;  3JWA A;  5AX8 A;  1H1C A;  3E9K A;  5BJ4 A;  1AAW A;  2BIE A;  3H9X A;  4DBC A;  2VGS A;  2D61 A;  4GE7 A;  5K8B A;  2ORD A;  4ADD A;  3TAT A;  1D7S A;  2Z1Y A;  1ZC9 A;  4ZDP A;  1W7M A;  3WCN A;  2XH1 A;  4A6R A;  3WKR A;  1IAX A;  1KMK A;  4EMY A;  3NDN A;  2WB6 A;  3PGY A;  3HQT A;  4Y0D A;  4WD2 A;  1OAT A;  1CL1 A;  2W8T A;  1BW0 A;  3HVY A;  4W1W A;  2VYC A;  3HBX A;  2AY3 A;  3NX3 A;  9AAT A;  4MQR A;  4J8L A;  5G2Q A;  4E3R A;  2ZY2 A;  3JZL A;  2OQX A;  2EH6 A;  1LK9 A;  2C7T A;  4A0R A;  1YNU A;  2VIA A;  2PO3 A;  5G4I A;  1Y4I A;  2V0Y A;  4PIW A;  2YCT A;  4JEZ A;  1O62 A;  2V1P A;  3OKS A;  3QBO A;  4IX8 A;  4UHN A;  5FT8 A;  3JTX A;  3N4X A;  2VLF A;  3LVM A;  4P7Y A;  2R5E A;  4LNL A;  1W23 A;  2OGE A;  3FRK A;  4F5M A;  3EUC A;  2BYL A;  1N8P A;  4WYA A;  1RV3 A;  1C7N A;  3AAT A;  1P3W A;  2JJF A;  1VP4 A;  3PAA A;  5EUD A;  3AV7 A;  1AIA A;  1WYV A;  1TOJ A;  2BI1 A;  1FG7 A;  3MKJ A;  2WK9 A;  4L0O A;  2CJG A;  2C44 A;  3G0T A;  1OHY A;  1GCK A;  3VP6 A;  1ZOB A;  1AHG A;  4WYC A;  2W8J A;  5HXX A;  2VMV A;  5EIG A;  4UOY A;  3TCM A;  1WYT A;  1DGE A;  3COG A;  4M2J A;  2HOY A;  3WLX A;  1BQD A;  3AEM C;  3AEL A;  2AAT A;  3GZC A;  3EI8 A;  2EO5 A;  2FYF A;  4JEV A;  5EFS A;  3VAX A;  2BIA A;  4IXZ A;  1I41 A;  2VMR A;  4WXB A;  1TPL A;  3E6G A;  3VK2 A;  3QI6 A;  2Z1Z A;  4M2M A;  4Y0I A;  4GDY A;  4JEX A;  2VI9 A;  2FN6 A;  1IX7 A;  5EQC A;  1SF2 A;  3WGC A;  2GMS A;  4AO4 A;  2CH2 A;  1E5E A;  1O4S A;  5JAY A;  4TMR A;  3PDB A;  4IYO A;  3ASA A;  2BIG A;  1ASL A;  1KKJ A;  2AY8 A;  2AEV A;  3A9Y A;  4M2K A;  1G7W A;  2E7J A;  2W7E A;  3FTB A;  4RIT A;  1MAP A;  1X0M A;  3N4S A;  4FFC A;  1V2D A;  3USF A;  4TV7 A;  5IWQ A;  3L8A A;  4DGT A;  3MC6 A;  4BA4 A;  4IXS A;  2VGT A;  4PVF A;  3RQ1 A;  3CAI A;  3FVX A;  4CBS A;  2CIN A;  2C81 A;  2CY8 A;  3RI6 A;  2CTZ A;  2F8J A;  2OKK A;  3H14 A;  2D7Y A;  5F8V A;  1DTY A;  3T32 A;  3N4R A;  4U2H A;  1MDX A;  2DKB A;  2D64 A;  2AY7 A;  2W7I A;  4KXK A;  4AOA A;  1SZU A;  3DR7 A;  1EG5 A;  4TN4 A;  1BJN A;  4A00 A;  4ITG A;  1E5F A;  4ZM3 A;  4W5K A;  2Z9V A;  4MY5 A;  4QGR A;  3QN6 A;  4H51 A;  4OC9 A;  3MAU A;  2W7H A;  4WB0 A;  4W91 A;  3ECD A;  4AZJ A;  2R2N A;  4MKJ A;  3TQX A;  3RBF A;  2ZY5 A;  1IX6 A;  3ELE A;  2E54 A;  1QIS A;  5KTB A;  1PMM A;  3KGX A;  2Q7W A;  3L44 A;  3W1J A;  1WYU A;  1M0Q A;  4JE5 D;  1ASG A;  5D5S A;  3F6T A;  2YRI A;  3UWC A;  4A0H A;  2YOB A;  1D2F A;  3M5U A;  4ZAH A;  1B9I A;  2EZ2 A;  4ZSW A;  4ADE A;  3PA9 A;  1LC8 A;  4WLH A;  3FFH A;  4ZSY A;  3DZZ A;  2FNU A;  3W1I A;  1LW4 A;  3N7N A;  1WKG A;  1DGD A;  1MLY A;  1TOE A;  3HMU A;  2AY2 A;  5E4Z A;  2GSA A;  2AY4 A;  3LG0 A;  2W8V A;  3AEP A;  1DJU A;  3HLM A;  1YAA A;  2WKA A;  3CQ5 A;  1SVV A;  1TAS A;  4MQQ A;  4RAE A;  1ASE A;  2EZ1 A;  2ZY3 A;  1M0O A;  2NMP A;  2FM1 A;  1AIB A;  1W3U A;  3DXW A;  5M49 A;  3BCX A;  4MGR A;  3CQ4 A;  2WK7 A;  2VMO A;  4LW2 A;  5G0A A;  3WX9 A;  1AMS A;  2JJH A;  1ELU A;  4OMA A;  2BWN A;  1AJS B;  3UE8 A;  1LKC A;  3NU8 A;  5D95 A;  1ZOD A;  2OGA A;  5M4B A;  3KKI A;  3RCH A;  1YIY A;  1ART A;  1SPA A;  1JF9 A;  1GEY A;  1MGV A;  8AAT A;  2R5C B;  2GB3 A;  2BYJ A;  3E2Y A;  3QPG A;  3ZRP A;  3AEN A;  2AY5 A;  1IUG A;  1RV4 A;  3EI7 A;  1AKC A;  1AAM A;  2CH1 A;  5LH9 A;  1AHF A;  4A0G A;  2W8U A;  3FZ6 A;  2ZJG A;  3I5T A;  4ISY A;  4HF8 A;  1IVR A;  4ZM4 A;  1AHX A;  1ECX A;  2W7J A;  4BMK A;  1MDO A;  4RM1 A;  2VMU A;  3I4J A;  4OBV A;  4RJY A;  3AEJ C;  1PMO A;  3MEB A;  3JWB A;  3VOM A;  3A9Z A;  1C7G A;  3IF2 A;  2BHX A;  2JJE A;  2X3L A;  4KAM A;  1GC4 A;  1B5O A;  3ATH A;  2VGZ A;  1ASD A;  2Z20 A;  3GZD C;  1M7Y A;  2ZUK A;  4Q31 A;  2YHK A;  1CQ7 A;  1KL2 A;  4PFF A;  4A6U A;  1M32 A;  2TPL A;  4EB5 A;  1V72 A;  5DJ1 A;  2QBT A;  2VMY A;  1I48 A;  4GEB A;  3BWO A;  3AEO A;  5M4D A;  4EU1 A;  3MAF B;  1BS0 A;  4N0B A;  2VMT A;  5DB5 A;  5C6U A;  3FQA A;  3B1E A;  2JJG A;  4OYT A;  3FQ7 A;  2FQ6 A;  1TOI A;  3B8X A;  2ZSM A;  4XAU A;  4ZAS A;  2CJD A;  3FVU A;  4CXR A;  3DU4 A;  2CAN A;  2DR1 A;  3E2Z A;  3I16 A;  3B1D A;  3P6K A;  4OBU A;  3VK4 A;  1AHE A;  1WST A;  3FDB A;  3BC8 A;  3MAD A;  4XJL A;  1WYV B;  1YJY A;  4BQ0 A;  4RIZ A;  1SFF A;  1H0C A;  3LVK A;  2FKI A;  4UQV A;  1PFF A;  1CS1 A;  1XI9 A;  3PD6 A;  2C0R A;  4OTL A;  4OCA A;  1S08 A;  4PFN A;  3JU7 A;  1UU0 A;  2QLR A;  4K2M A;  4R8D A;  1ASN A;  2YKU A;  2CB1 A;  5EIG B;  4A72 A;  2EYQ A;  4XJO A;  1WYT B;  4WYD A;  2D63 A;  3K7Y A;  3JW9 A;  4RJ0 A;  2ZY4 A;  2BKW A;  1X2A A;  1YJS A;  2AY1 A;  3GBX A;  3WKS A;  3WGB A;  4AH3 A;  1CQ6 A;  2PB2 A;  5M46 A;  4W1X A;  4R5Z A;  3QM2 A;  4A6T A;  2QB3 A;  4O6Z A;  5FT4 A;  1QJ3 A;  4EFF A;  3LWS A;  2DGK A;  3R4T A;  1GDE A;  5G4J A;  2G6W A;  4F4E A;  1BJO A;  4LNJ A;  4F5K A;  1YJZ A;  4XJM A;  4RKD A;  2QSR A;  3N75 A;  4B98 A;  2HUU A;  1C9C A;  3GET A;  3LV2 A;  4WLJ A;  1I43 A;  3FKD A;  4IYO B;  1B5P A;  3G7Q A;  4KYO A;  3FCR A;  3E2F A;  3ZRQ A;  1ASC A;  4ZDO A;  3BS8 A;  1VEF A;  3NYT A;  3FSL A;  1OHV A;  3MBB A;  5HHY A;  3PJ0 A;  2GQN A;  4IY7 A;  1ARG A;  1TAR A;  3ZZJ A;  3N5M A;  3KE3 A;  3NYU A;  5F9S A;  1AMR A;  1AY8 A;  1YOO A;  3HT4 A;  2G7J A;  1V2E A;  2W8W A;  4MQP A;  2JG2 A;  4CBR A;  2VMW A;  4IW7 A;  1AJR A;  4EB7 A;  1CL2 A;  4F5L A;  3LY1 A;  3HDO A;  4DQ6 A;  3AEM A;  2DGM A;  1QZ9 A;  3ELP A;  3GWP A;  4P3M A;  1Z7D A;  1RVY A;  4BHD A;  4F5J A;  3NUB A;  4Q6R A;  3Q8N A;  4F5G A;  2VGV A;  2X5F A;  1C7O A;  2AY6 A;  1MAQ A;  3HL2 A;  3P1T A;  3VK3 A;  2HZP A;  5I92 A;  1ASM A;  3EI5 A;  1B9H A;  3RBL A;  4Q76 A;  2BI9 A;  3IHJ A;  1ASF A;  3DOD A;  2A1V A;  3BWN C;  2ZP7 A;  1FC4 A;  1ASB A;  1N31 A;  2W7M A;  7AAT A;  4AO9 A;  1T3I A;  1TOG A;  4N0W A;  3EI9 A;  2WK8 A;  4J5U A;  1PG8 A;  1IBJ A;  2YRR A;  3FZ7 A;  2D7Z A;  1UU2 A;  1IX8 A;  2XBN A;  5DX5 A;  4ZDL A;  2YKY A;  2DOU A;  1TAT A;  3F9T A;  5EAV A;  2ZSL A;  3EZ1 A;  3LVL B;  1AKB A;  4F5F A;  5J8Q A;  1ARS A;  3II0 A;  4B9B A;  2X5D A;  3GJU A;  3N0L A;  1I29 A;  1LC5 A;  2R0T A;  3BN1 A;  2RFV A;  2VMN A;  4GSA A;  1CQ8 A;  3AOV A;  4JE5 A;  1W7N A;  2CJH A;  4K2B A;  4WYG A;  1BJ4 A;  4ZWM A;  3A2B A;  4GE4 A;  4XEW A;  3W1H A;  1M0P A;  4GE9 A;  1GD9 A;  1S07 A;  1GC0 A;  2W7G A;  3PPL A;  2W7F A;  5EUE A;  1FG3 A;  4F5I A;  4UHM A;  1IJI A;  1X29 A;  4AZK A;  1B8G A;  3NYS A;  3RCH B;  4HVK A;  5FT5 A;  3KGW A;  3MC6 C;  5FT6 A;  3FDD A;  1BQA A;  1G4X A;  1KMJ A;  3DXV A;  1CZE A;  3NNK A;  1D7U A;  3NRA A;  4JEW A;  1ELQ A;  2D65 A;  2OKJ A;  4ZLV A;  2HP1 A;  1C4K A;  1DJE A;  1U08 A;  1BJW A;  2DGL A;  2JIS A;  2YCN A;  3QHX A;  4E1O A;  1GBN A;  2BWO A;  3AEN B;  4WYE A;  3TFU A;  4ADB A;  2O1B A;  3MAF A;  4LNM A;  3RUY A;  2FNI A;  3K28 A;  4MKK A;  1S06 A;  1MLZ A;  4GRX A;  3NU7 A;  5E5I A;  2CST A;  4WXG A;  1CJ0 A;  1LC7 A;  2OAT A;  3ASB A;  2VMP A;  5G2P A;  3TFT A;  2VMZ A;  1UKJ A;  3DRD A;  1D7V A;  2QA3 A;  1QJ5 A;  4XJP A;  2AEU A;  4Y0H A;  1EQB A;  2PB0 A;  3CBF A;  5LHA A;  3NTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...