4GE7A

Kynurenine aminotransferase ii inhibitors
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
427
Chain Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNSGRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 140
structure length 427
sequence length 428
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ge7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ge7A03
3FVXA 2EGYA 4ZSWA 1ASFA 4XJMA 5G4IA 1GC2A 4ZAHA 2WK7A 3MAFB 4J8LA 1KMKA 2OKJA 1EJIA 3E2FA 2CANA 4WB0B 1DGEA 3BWNA 1RVYA 4A6TA 1IX8A 5EUEA 3WZFA 2CB1A 4MQRA 3QHXA 2VI8A 4QGRA 3W1JA 2W7JA 1TOKA 4CVQA 2W8VA 3DXVA 3EI7A 3FZ7A 1OXPA 2FYFA 1AJRA 3DRDA 1M32A 4RAEA 5K8BA 2VGZA 4RKDA 1PFFA 4F5MA 1BJNA 4W91A 2ZY2A 5BJ4A 1MDOA 3L44A 1AMAA 1KL1A 2AY2A 5M46A 2DR1A 2CH2A 3ELEA 4RKCA 4BA5A 5G0AA 4JEXA 5E4ZA 1IX7A 3R9AA 4OTLA 1YIYA 3GETA 3I16A 4KAMA 5EQCA 4GDYA 4R5ZA 4ITXA 2AEUA 1CL2A 3BN1A 4GE7A 4IX8A 3BWOA 3G7QA 4R5FA 4DBCA 1MGVA 1CL1A 4WYFA 1CS1A 1VEFA 1JF9A 1AHXA 1TPLA 3WLXA 3CBFA 3E77A 5EAVA 1GEXA 1W7NA 2GSAA 4O6ZA 4A00A 4N0BA 1ECXA 2VGSA 2ZY5A 1WSTA 3MBBA 1BT4A 3HQTA 2BI2A 2GMUA 3FFHA 1ASAA 3AOVA 2RFVA 3B1DA 3ZZJA 5D5SA 1LW4A 3MKJA 3ZZKA 2YRRA 4GE9A 2YOBA 3FVSA 3LWSA 2FN6A 2R2NA 4TMRA 5G09A 4A72A 2AY4A 2Z61A 2D64A 2W7FA 4E77A 3KGXA 4LC3A 2VMRA 2VMVA 2BWPA 1SF2A 1U08A 2QMAA 1AICA 1MDZA 3IHJA 1G7XA 1V2DA 4XJOA 1SFFA 1ASDA 1IBJA 3A9YA 2ZC0A 1PG8A 2JG2A 3LVJA 4WYDA 3RCHA 1YJZA 4RM1A 1AY5A 3ZRRA 1LKCA 4U1TA 2VMYA 3QPGA 1M0OA 1LW5A 1G4VA 3GZCA 3GR9A 3QBOA 1BS0A 3OKSA 1BJWA 4Q6RA 1WYVB 4MQQA 4UHMA 2GB3A 5DJ1A 4AOAA 1W3UA 1QJ5A 3W1HA 3N75A 1GCKA 3NYSA 1I41A 3EI5A 3JW9A 4ZSYA 3A8UX 1QIRA 4WYAA 1TOIA 4A0FA 1BJ4A 2BIAA 1GC4A 1JS3A 1GC3A 2W7GA 3K28A 3LVMA 3FDDA 3KGWA 3WKRA 4E3QA 3A2BA 2R5CB 1O4SA 4OT8A 2YKYA 3VK3A 4F5FA 4OYTA 2W7LA 1ASBA 5FT6A 1FC4A 1AY8A 1QISA 1WYUA 5EUNA 1CQ7A 1AX4A 1WKGA 4AZKA 4CXQA 1DTYA 2D7ZA 2QB2A 3JWAA 3FQAA 3BB8A 5DB5A 4CXRA 3CQ6A 3TCMA 3BS8A 1AKBA 4GEBA 2VMWA 2W8UA 1C9CA 2W8WA 1B9HA 3B1CA 1CZEA 1AMRA 3FQ7A 5FT4A 2VMTA 1RVUA 4XJPA 2V1PA 5BJ3A 2QB3A 3HMUA 4JEYA 4ADBA 4IW7A 1SZKA 1LS3A 4U2HA 2X5FA 3EIBA 3WX9A 4RITA 4OMAA 1AMQA 1CQ6A 3GWPA 4ZWMA 2HUFA 2AY9A 2DKJA 2E54A 2W8JA 2YKXA 3HVYA 1KKJA 2FNUA 1P3WA 2YCTA 4JEZA 3VK4A 2AY8A 3GZDC 4OCAA 1S08A 2CJDA 1UKJA 3RBLA 2E7IA 2JJFA 1M0PA 1TOEA 2DGLA 2Z9UA 1WYTB 3IF2A 4PFNA 2X3LA 2W7DA 2TPLA 3TATA 2EZ2A 2HP2A 3PD6A 4PIWA 1E5FA 2DOUA 1DJUA 2JISA 3NYUA 1D7UA 5LHAA 2VGUA 3H14A 3AENB 2BKWA 3BV0A 2FM1A 2O1BA 4R8DA 4F5HA 5M4DA 1GC0A 3MAFA 3PDBB 4JEVA 2AY1A 5F8VA 4WB0A 2CY8A 3AEPA 4OBVA 1V72A 4WLJA 4PVFA 5EIGA 5G2QA 2Z67A 2AY3A 3NNKA 3NU8A 4RJ0A 3NUIA 4WXGA 3ZRPA 4WXBA 2BI3A 3RQ1A 2X5DA 2DGKA 2HOZA 3B46A 4W1XA 5F9SA 2ZUKA 4OC9A 2VIAA 1AHGA 1XI9A 4XJLA 5FT8A 4F5IA 4ZASA 4WBTA 2OQXA 3WY7A 2W7EA 2AEVA 2W8TA 4E3RA 2VGTA 3HT4A 2O7CA 2BI5A 4IYOB 1AAWA 3A9XA 4RIZA 1XEYA 2AATA 1QGNA 5AX8A 1M7YA 1N8PA 4IY7A 4WLHA 2YHKA 3F9TA 1SZUA 3FTBA 3P6KA 2VMOA 2QA3A 3DC1A 1KKPA 4HF8A 4M2MA 9AATA 1MAQA 4CBRA 1ASEA 1MAPA 2FNIA 1LC7A 1C0NA 4B98A 3AEJA 5M4BA 4KXKA 2W7KA 2XBNA 4LW2A 1G7WA 3DU4A 3DYDA 1ELUA 1VJOA 1I43A 2ORDA 4W1WA 4A6RA 1ASNA 1G4XA 2D61A 3EUCA 3II0A 3UAKA 4ADEA 4AZJA 1V2FA 1YOOA 2HOYA 3TFUA 4ZM4A 5EFSA 3AEMA 1UU0A 3FCRA 3KE3A 4HVKA 3P1TA 4F5GA 3AV7A 1DGDA 4PFFA 4ADCA 1AAMA 1AKAA 3DR7A 3DXWA 3E9KA 2YCPA 3EI8A 2D66A 4ZDPA 2XH1A 2VMPA 2CINA 1GEYA 3E2ZB 3LVLB 4K2IA 1D7VA 2JJGA 3ASBA 2D7YA 2VMSA 3ACZA 1W7LA 4UQVA 4DGTA 3RBFA 5HDMA 1AMSA 1DJEA 4L0OA 1CZCA 5FT5A 2QBTA 3MC6C 4N0WA 2QLRA 1IJIA 2VMXA 1B9IA 1WYVA 4F5LA 1O62A 1GBNA 4JF0A 3EIAA 4LW4A 3W1IA 1ASMA 1YNUA 2BIEA 2BI1A 2WK9A 4Q75A 2YCNA 3AOWA 3K7YA 4UOYA 1JG8A 2D63A 3PAAA 4K2MA 2Z9WA 1AJSA 2YKUA 2R5CA 2ZJGA 2GQNA 1PMMA 3FZ6A 2DKBA 3HDOA 3N0LA 3NRAA 4MY5A 3DZZA 4LNLA 1T3IA 1N31A 4RJYA 3HL2A 1QITA 3FRKA 4EB7A 1B5PA 2EH6A 2OGEA 3WKSA 4F5JA 1OHWA 3A9ZA 3BWNC 4GSAA 1W7MA 2Z1ZA 1FG7A 1CQ8A 5E3KA 4ZLVA 1VP4A 2DGMA 3COGA 3QI6A 3RUYA 2AY7A 3EZSA 2CH1A 3PDXA 3VOMA 3FSLA 1DJ9A 4BMKA 4XAUA 3RI6A 3GJUA 2WK8A 2BIGA 2Q7WA 2GMSA 2JGTA 1CJ0A 3UWCA 5G2PA 2Z20A 3NTJA 2C0RA 4WP0A 2ZSLA 1BJOB 4P7YA 3AEOA 5D95A 4EB5A 1H0CA 1UU1A 4XK1A 4MKKA 3FDBA 3GBXA 4A0GA 1OATA 4JE5D 2D5YA 1MDXA 4ZDLA 1IX6A 1C7OA 1WYTA 1DKAA 1X0MA 3ZRQA 4ZM3A 2ZY4A 3NX3A 4MGRA 2W7HA 1N2TA 1FG3A 3FQ8A 3FFRA 2HORA 1BKGA 2VI9A 1ELQA 3MEBA 4BHDA 1TOGA 3AENA 4WXFA 2C7TA 2CJHA 3PDBA 1SPAA 4CBSA 1M0QA 1MLZA 4NOGA 1D7RA 1SZSA 3GSBA 5C6UA 3JWBA 3MAUA 3HBXA 4JF1A 5J8QA 4BQ0A 2JJHA 3EI9A 3H7FA 4TN4A 3CQ5A 1BQAA 4A0HA 2HOXA 1QJ3A 1ARGA 1I48A 5M49A 4E1OA 5E5IA 3AELA 3LV2A 4EMYA 4Y0DA 2VYCA 3DODA 2X8UA 1AHYA 1RV3A 4AO9A 2VMQA 3DR4A 4IYOA 3BCXA 3M5UA 1AHEA 1V2EA 4K2BA 1ARIA 3WGCA 4F5KA 2NMPA 5EIGB 2HZPA 1S07A 2C81A 2O0RA 3D6KA 7AATA 2EPJA 1KL2A 1TARA 1GD9A 3OP7A 4Y0HA 4A0RA 3BC8A 4ADDA 4AO4A 4AH3A 1ASCA 1D2FA 4B9BA 1X28A 1IAYA 1AIBA 2VIBA 1ZOBA 2FQ6A 2R0TA 3ASAA 1EG5A 1RV4A 2CSTA 2BWOA 1KMJA 3NYTA 4GRXA 1W23A 3T32A 4M2KA 3GZDA 1ARHA 4WYGA 4ATQA 1ORDA 2OATA 3K40A 4IXOA 1BQDA 2E7JA 4J5UA 4ZDOA 3L8AA 5EUDA 2ZP7A 3PA9A 4MQPA 4RLGA 1ASGA 3CQ4A 3G0TA 1YJYA 3EZ1A 4H51A 3MADA 5EAAA 1D7SA 1C7NA 1C7GA 4TV7A 1M0NA 2VGWA 1J32A 4MKJA 1EQBA 1I29A 5IWQA 1LK9A 1YIZA 3EI6A 2ZSMA 3JTXA 4LNJA 4Q76A 1Z3ZA 2VGVA 1X29A 1OHVA 3E2ZA 4ATPA 1H1CA 2BWNA 3HLMA 4XEWA 3WCNA 4IXZA 1B8GA 1IUGA 4P3MA 3CAIA 1ARSA 3ATHA 1AHFA 4R2NA 2CTZA 3VAXA 3NUBA 2HUUA 3BCBA 4LNMA 1M4NA 3LG0A 5DX5A 2HUIA 4ISYA 4FL0A 5TF5A 3Q8NA 1O61A 1YJSA 3F6TA 2ZY3A 1LC8A 1SVVA 3NU7A 3QN6A 1B5OA 1J04A 2BYLA 3UE8A 1UU2A 2YKVA 4ZWVA 4M2JA 3RCHB 5LH9A 4I8AA 2C44A 2VMNA 3E2YA 4JEWA 3B1EA 1ARTA 4WD2A 4JE5A 1E5EA 3G8MA 3VK2A 2ZYJA 4W8IA 3WGBA 3NDNA 2OGAA 1B4XA 1AY4A 3PPLA 4EU1A 1DFOA 3E6GA 1S0AA 4FFCA 3AATA 3LVKA 4ITGA 1GDEA 1ASLA 3PGYA 5HHYA 3KKIA 2E7UA 2VMUA 1AIAA 2Z9VA 4IXSA 4WYCA 2EZ1A 1OXOA 1WKHA 3FD0A 2F8JA 4WYEA 1JS6A 4W5KA 2AY5A 2W7MA 3PJ0A 2Z1YA 5HXXA 2HP1A 1TASA 3LY1A 3FKDA 5G4JA 1AJSB 3ECDA 3PIUA 1M6SA 1WYUB 1ZC9A 2G6WA 3N5MA 2EO5A 2VLFA 2D65A 1GEWA 3ISLA 4Q31A 1BW0A 3FZ8A 2CJGA 1Y4IA 3TQXA 4MSOA 2CFBA 2Z9XA 2YRIA 1IAXA 2PO3A 1IVRA 3QM2A 2V0YA 5I92A 1BJOA 2BI9A 3TFTA 2AY6A 3B8XA 4DQ6A 1TOJA 2BYJA 1MLYA 3I5TA 2W7IA 4EFFA 1Z7DA 2PB2A 4OBUA 2OKKA 3BCAA 4KYOA 3R4TA 2PB0A 1O69A 3ELPA 1C4KA 1LC5A 1X2AA 3WCOA 3MC6A 1AKCA 1S06A 3QGUA 4GE4A 4XQ2A 3USFA 4A6UA 4W1VA 2JJEA 3JZLA 1PMOA 2VLHA 3JU7A 3AEJC 1S09A 3I4JA 4BA4A 8AATA 2BHXA 4UHNA 2WKAA 3FVUA 5JAYA 2VMZA 1ZODA 1OHYA 1YAAA 5DJ9A 3AEMC 3PD6B 4F4EA 1QZ9A 3F0HA 2R5EA 4Y0IA 3VP6A 4UHOA 1TATA
chains in the Genus database with same CATH superfamily
3FVXA 2EGYA 4ZSWA 1ASFA 4XJMA 5G4IA 1GC2A 4ZAHA 2WK7A 3MAFB 4J8LA 1KMKA 2OKJA 1EJIA 3E2FA 2CANA 4WB0B 1DGEA 3BWNA 1RVYA 4A6TA 1IX8A 5EUEA 3WZFA 2CB1A 4MQRA 3QHXA 2VI8A 4QGRA 3W1JA 2W7JA 1TOKA 4CVQA 2W8VA 3DXVA 3EI7A 3FZ7A 1OXPA 2FYFA 1AJRA 3DRDA 1M32A 4RAEA 5K8BA 2VGZA 4RKDA 1PFFA 4F5MA 1BJNA 4W91A 2ZY2A 5BJ4A 1MDOA 3L44A 1AMAA 1KL1A 2AY2A 5M46A 2DR1A 2CH2A 3ELEA 4RKCA 4BA5A 5G0AA 4JEXA 5E4ZA 1IX7A 3R9AA 4OTLA 1YIYA 3GETA 3I16A 4KAMA 5EQCA 4GDYA 4R5ZA 4ITXA 2AEUA 1CL2A 3BN1A 4GE7A 4IX8A 3BWOA 3G7QA 4R5FA 4DBCA 1MGVA 1CL1A 4WYFA 1CS1A 1VEFA 1JF9A 1AHXA 1TPLA 3WLXA 3CBFA 3E77A 5EAVA 1GEXA 1W7NA 2GSAA 4O6ZA 4A00A 4N0BA 1ECXA 2VGSA 2ZY5A 1WSTA 3MBBA 1BT4A 3HQTA 2EYQA 2BI2A 2GMUA 3FFHA 1ASAA 3AOVA 2G7JA 2RFVA 3B1DA 3ZZJA 5D5SA 1LW4A 3MKJA 3ZZKA 2YRRA 4GE9A 2YOBA 3FVSA 3LWSA 2FN6A 2R2NA 4TMRA 5G09A 4A72A 2AY4A 2Z61A 2D64A 2W7FA 4E77A 3KGXA 4LC3A 2VMRA 2VMVA 2BWPA 1SF2A 1U08A 2QMAA 1AICA 1MDZA 3IHJA 1G7XA 1V2DA 4XJOA 1SFFA 1ASDA 1IBJA 3A9YA 2ZC0A 1PG8A 2JG2A 3LVJA 4WYDA 3RCHA 1YJZA 4RM1A 1AY5A 3ZRRA 1LKCA 4U1TA 2VMYA 3QPGA 1M0OA 1LW5A 1G4VA 3GZCA 3GR9A 3QBOA 1BS0A 3OKSA 1BJWA 4Q6RA 1WYVB 4MQQA 4UHMA 2GB3A 5DJ1A 4AOAA 3N7NA 1W3UA 1QJ5A 3W1HA 3N75A 1GCKA 3NYSA 1I41A 3EI5A 3JW9A 4ZSYA 3A8UX 1QIRA 4WYAA 1TOIA 4A0FA 1BJ4A 2BIAA 1GC4A 1JS3A 1GC3A 2W7GA 3K28A 3LVMA 3FDDA 3KGWA 3WKRA 4E3QA 3A2BA 2R5CB 1O4SA 4OT8A 2YKYA 3VK3A 4F5FA 4OYTA 2W7LA 1ASBA 5FT6A 1FC4A 1AY8A 1QISA 1WYUA 5EUNA 1CQ7A 1AX4A 1WKGA 4AZKA 4CXQA 1DTYA 2D7ZA 2QB2A 3JWAA 3FQAA 3BB8A 5DB5A 4CXRA 3CQ6A 3TCMA 3BS8A 1AKBA 4K05A 4GEBA 2VMWA 2W8UA 1C9CA 2W8WA 1B9HA 3B1CA 1CZEA 1AMRA 3FQ7A 5FT4A 2VMTA 1RVUA 4XJPA 2V1PA 5BJ3A 2QB3A 3HMUA 4JEYA 4ADBA 4IW7A 1SZKA 1LS3A 4U2HA 2X5FA 3EIBA 3WX9A 4RITA 4OMAA 1AMQA 1CQ6A 3GWPA 4ZWMA 2HUFA 2AY9A 2DKJA 2E54A 2W8JA 2YKXA 3HVYA 1KKJA 2FNUA 1P3WA 2YCTA 4JEZA 3VK4A 3N4RA 2AY8A 5KTBA 3GZDC 4OCAA 1S08A 2CJDA 1UKJA 3RBLA 2E7IA 2JJFA 1M0PA 1TOEA 2DGLA 2Z9UA 1WYTB 3IF2A 4PFNA 2X3LA 2W7DA 2TPLA 3TATA 2EZ2A 2HP2A 3PD6A 4PIWA 1E5FA 2DOUA 1DJUA 2JISA 3NYUA 1D7UA 5LHAA 2VGUA 3H14A 3AENB 2BKWA 3BV0A 2FM1A 2O1BA 4R8DA 4F5HA 5M4DA 1GC0A 3MAFA 3PDBB 4JEVA 2AY1A 5F8VA 4WB0A 2CY8A 3AEPA 4OBVA 1V72A 4WLJA 4PVFA 5EIGA 5G2QA 2Z67A 2AY3A 3NNKA 3NU8A 4RJ0A 3NUIA 4WXGA 3ZRPA 4WXBA 2BI3A 3RQ1A 2X5DA 2DGKA 2HOZA 3B46A 4W1XA 5F9SA 2ZUKA 4OC9A 2VIAA 1AHGA 1XI9A 4XJLA 5FT8A 4F5IA 4ZASA 4WBTA 2OQXA 3WY7A 2W7EA 2AEVA 2W8TA 4E3RA 2VGTA 3HT4A 2O7CA 2BI5A 4IYOB 1AAWA 3A9XA 4RIZA 1XEYA 2AATA 1QGNA 5AX8A 1M7YA 1N8PA 4IY7A 4WLHA 2YHKA 3F9TA 1SZUA 3FTBA 3P6KA 2VMOA 2QA3A 3DC1A 1KKPA 4HF8A 4M2MA 9AATA 1MAQA 4CBRA 1ASEA 1MAPA 2FNIA 1LC7A 1C0NA 4B98A 3AEJA 5M4BA 4KXKA 2W7KA 2XBNA 4LW2A 1G7WA 3DU4A 3DYDA 1ELUA 1VJOA 1I43A 2ORDA 4W1WA 4A6RA 1ASNA 1G4XA 2D61A 3EUCA 3II0A 3UAKA 4ADEA 4AZJA 1V2FA 1YOOA 2HOYA 3TFUA 4ZM4A 5EFSA 3AEMA 1UU0A 3FCRA 3KE3A 4HVKA 3P1TA 4F5GA 3AV7A 1DGDA 4PFFA 4ADCA 1AAMA 1AKAA 3DR7A 3DXWA 3E9KA 2YCPA 3EI8A 2D66A 4ZDPA 2XH1A 2VMPA 2CINA 1GEYA 3E2ZB 3LVLB 4K2IA 1D7VA 2JJGA 3ASBA 2D7YA 2VMSA 3ACZA 1W7LA 4UQVA 4DGTA 3RBFA 5HDMA 1AMSA 1DJEA 4L0OA 1CZCA 5FT5A 2QBTA 3MC6C 4N0WA 2QLRA 1IJIA 2VMXA 1B9IA 1WYVA 4F5LA 1O62A 1GBNA 4JF0A 3EIAA 4LW4A 2QSRA 3W1IA 1ASMA 1YNUA 2BIEA 2BI1A 2WK9A 4Q75A 2YCNA 3AOWA 3K7YA 4UOYA 1JG8A 2D63A 3PAAA 4K2MA 2Z9WA 1AJSA 2YKUA 2R5CA 2ZJGA 2GQNA 1PMMA 3FZ6A 2DKBA 3HDOA 3N0LA 3NRAA 4MY5A 3DZZA 4LNLA 1T3IA 1N31A 4RJYA 3HL2A 1QITA 3FRKA 4EB7A 1B5PA 2EH6A 2OGEA 3WKSA 4F5JA 1OHWA 3A9ZA 3BWNC 4GSAA 1W7MA 2Z1ZA 1FG7A 1CQ8A 5E3KA 4ZLVA 1VP4A 2DGMA 3COGA 3QI6A 3RUYA 2AY7A 3EZSA 2CH1A 3PDXA 3VOMA 3FSLA 1DJ9A 4BMKA 4XAUA 3RI6A 3GJUA 2WK8A 2BIGA 2Q7WA 2GMSA 2JGTA 1CJ0A 3UWCA 5G2PA 2Z20A 3NTJA 2C0RA 4WP0A 2ZSLA 1BJOB 4P7YA 3AEOA 5D95A 4EB5A 1H0CA 1UU1A 4XK1A 4MKKA 3N4XA 3FDBA 3GBXA 4A0GA 1OATA 4JE5D 2D5YA 1MDXA 4ZDLA 1IX6A 1C7OA 1WYTA 1DKAA 1X0MA 3ZRQA 4ZM3A 2ZY4A 3NX3A 4MGRA 2W7HA 1N2TA 1FG3A 3FQ8A 3FFRA 2HORA 1BKGA 2VI9A 1ELQA 3MEBA 4BHDA 1TOGA 3AENA 4WXFA 2C7TA 2CJHA 3PDBA 1SPAA 4CBSA 1M0QA 1MLZA 3H9XA 4NOGA 1D7RA 1SZSA 3GSBA 5C6UA 3JWBA 3MAUA 3HBXA 4JF1A 5J8QA 4BQ0A 2JJHA 3EI9A 3H7FA 4TN4A 3CQ5A 1BQAA 4A0HA 2HOXA 1QJ3A 1ARGA 1I48A 5M49A 4E1OA 5E5IA 3AELA 3LV2A 4EMYA 4Y0DA 2VYCA 3DODA 2X8UA 1AHYA 1RV3A 4AO9A 2VMQA 3DR4A 4IYOA 3BCXA 3M5UA 1AHEA 1V2EA 4K2BA 1ARIA 3WGCA 4F5KA 2NMPA 5EIGB 2HZPA 1S07A 2C81A 2O0RA 3D6KA 7AATA 2EPJA 1KL2A 1TARA 1GD9A 3OP7A 4Y0HA 4A0RA 3BC8A 4ADDA 4AO4A 4AH3A 1ASCA 1D2FA 4B9BA 1X28A 1IAYA 1AIBA 2VIBA 1ZOBA 1KAFA 2FQ6A 2R0TA 3ASAA 1EG5A 1RV4A 2CSTA 2BWOA 1KMJA 3NYTA 4GRXA 1W23A 3T32A 4M2KA 3GZDA 1ARHA 4WYGA 4ATQA 1ORDA 2OATA 3K40A 4IXOA 1BQDA 2E7JA 4J5UA 4ZDOA 3L8AA 5EUDA 2ZP7A 3PA9A 4MQPA 4RLGA 1ASGA 3CQ4A 3G0TA 1YJYA 3EZ1A 4H51A 3MADA 5EAAA 1D7SA 1C7NA 1C7GA 4TV7A 1M0NA 2VGWA 1J32A 4MKJA 1EQBA 1I29A 5IWQA 1LK9A 1YIZA 3EI6A 2ZSMA 3JTXA 4LNJA 4Q76A 1Z3ZA 2VGVA 1X29A 1OHVA 3E2ZA 4ATPA 1H1CA 2BWNA 3HLMA 4XEWA 3WCNA 2FKIA 4IXZA 1B8GA 1IUGA 4P3MA 3CAIA 1ARSA 3ATHA 1AHFA 4R2NA 2CTZA 3VAXA 3NUBA 2HUUA 3BCBA 4LNMA 1M4NA 3LG0A 5DX5A 2HUIA 2WB6A 4ISYA 4FL0A 5TF5A 3Q8NA 1O61A 1YJSA 3F6TA 2ZY3A 1LC8A 1SVVA 3NU7A 3QN6A 1B5OA 1J04A 2BYLA 3UE8A 1UU2A 2YKVA 4ZWVA 4M2JA 3RCHB 5LH9A 2KFPA 4I8AA 2C44A 2VMNA 3E2YA 4JEWA 3B1EA 1ARTA 4WD2A 4JE5A 1E5EA 3G8MA 3VK2A 2ZYJA 4W8IA 3WGBA 3NDNA 2OGAA 1B4XA 1AY4A 3PPLA 4EU1A 1DFOA 3E6GA 1S0AA 4FFCA 3AATA 3LVKA 4ITGA 1GDEA 4H63Q 1ASLA 3PGYA 5HHYA 3KKIA 2E7UA 2VMUA 1AIAA 2Z9VA 4IXSA 4WYCA 2EZ1A 1OXOA 1WKHA 3FD0A 2F8JA 4WYEA 1JS6A 4W5KA 2AY5A 2W7MA 3PJ0A 2Z1YA 5HXXA 2HP1A 1TASA 3LY1A 3FKDA 5G4JA 1AJSB 3ECDA 3PIUA 1M6SA 1WYUB 1ZC9A 2G6WA 3N5MA 2EO5A 2VLFA 2D65A 1GEWA 3ISLA 4Q31A 1BW0A 3FZ8A 2CJGA 1Y4IA 3TQXA 4MSOA 2CFBA 2Z9XA 2YRIA 1IAXA 2PO3A 1IVRA 3QM2A 2V0YA 5I92A 1BJOA 2BI9A 3TFTA 2AY6A 3B8XA 4DQ6A 1TOJA 2BYJA 1MLYA 3I5TA 2W7IA 4EFFA 1Z7DA 2PB2A 4OBUA 2OKKA 3BCAA 4KYOA 3R4TA 2A1VA 2PB0A 1O69A 3ELPA 1C4KA 1LC5A 1X2AA 3WCOA 3MC6A 1AKCA 1S06A 3QGUA 4GE4A 4XQ2A 3USFA 4A6UA 4W1VA 2JJEA 3JZLA 1PMOA 2VLHA 3JU7A 3AEJC 1S09A 3I4JA 4BA4A 8AATA 2BHXA 4UHNA 2WKAA 3FVUA 5JAYA 2VMZA 3N4SA 1ZODA 1OHYA 1YAAA 5DJ9A 3AEMC 3PD6B 4F4EA 1QZ9A 3F0HA 2R5EA 4Y0IA 3VP6A 4UHOA 1TATA
chains in the Genus database with same CATH topology
3FVXA 2EGYA 4ZSWA 1ASFA 4XJMA 5G4IA 1GC2A 4ZAHA 2WK7A 3MAFB 4J8LA 1KMKA 2OKJA 1EJIA 3E2FA 2CANA 4WB0B 1DGEA 3BWNA 1RVYA 4A6TA 1IX8A 5EUEA 3WZFA 2CB1A 4MQRA 3QHXA 2VI8A 4QGRA 3W1JA 2W7JA 1TOKA 4CVQA 2W8VA 3DXVA 3EI7A 3FZ7A 1OXPA 2FYFA 1AJRA 3DRDA 1M32A 4RAEA 5K8BA 2VGZA 4RKDA 1PFFA 4F5MA 1BJNA 4W91A 2ZY2A 5BJ4A 1MDOA 3L44A 1AMAA 1KL1A 2AY2A 5M46A 2DR1A 2CH2A 3ELEA 4RKCA 4BA5A 5G0AA 4JEXA 5E4ZA 1IX7A 3R9AA 4OTLA 1YIYA 3GETA 3I16A 4KAMA 5EQCA 4GDYA 4R5ZA 4ITXA 2AEUA 1CL2A 3BN1A 4GE7A 4IX8A 3BWOA 3G7QA 4R5FA 4DBCA 1MGVA 1CL1A 4WYFA 1CS1A 1VEFA 1JF9A 1AHXA 1TPLA 3WLXA 3CBFA 3E77A 5EAVA 1GEXA 1W7NA 2GSAA 4O6ZA 4A00A 4N0BA 1ECXA 2VGSA 2ZY5A 1WSTA 3MBBA 1BT4A 3HQTA 2EYQA 2BI2A 2GMUA 3FFHA 1ASAA 3AOVA 2G7JA 2RFVA 3B1DA 3ZZJA 5D5SA 1LW4A 3MKJA 3ZZKA 2YRRA 4GE9A 2YOBA 3FVSA 3LWSA 2FN6A 2R2NA 4TMRA 5G09A 4A72A 2AY4A 2Z61A 2D64A 2W7FA 4E77A 3KGXA 4LC3A 2VMRA 2VMVA 2BWPA 1SF2A 1U08A 2QMAA 1AICA 1MDZA 3IHJA 1G7XA 1V2DA 4XJOA 1SFFA 1ASDA 1IBJA 3A9YA 2ZC0A 1PG8A 2JG2A 3LVJA 4WYDA 3RCHA 1YJZA 4RM1A 1AY5A 3ZRRA 1LKCA 4U1TA 2VMYA 3QPGA 1M0OA 1LW5A 1G4VA 3GZCA 3GR9A 3QBOA 1BS0A 3OKSA 1BJWA 4Q6RA 1WYVB 4MQQA 4UHMA 2GB3A 5DJ1A 4AOAA 3N7NA 1W3UA 1QJ5A 3W1HA 3N75A 1GCKA 3NYSA 1I41A 3EI5A 3JW9A 4ZSYA 3A8UX 1QIRA 4WYAA 1TOIA 4A0FA 1BJ4A 2BIAA 1GC4A 1JS3A 1GC3A 2W7GA 3K28A 3LVMA 3FDDA 3KGWA 3WKRA 4E3QA 3A2BA 2R5CB 1O4SA 4OT8A 2YKYA 3VK3A 4F5FA 4OYTA 2W7LA 1ASBA 5FT6A 1FC4A 1AY8A 1QISA 1WYUA 5EUNA 1CQ7A 1AX4A 1WKGA 4AZKA 4CXQA 1DTYA 2D7ZA 2QB2A 3JWAA 3FQAA 3BB8A 5DB5A 4CXRA 3CQ6A 3TCMA 3BS8A 1AKBA 4K05A 4GEBA 2VMWA 2W8UA 1C9CA 2W8WA 1B9HA 3B1CA 1CZEA 1AMRA 3FQ7A 5FT4A 2VMTA 1RVUA 4XJPA 2V1PA 5BJ3A 2QB3A 3HMUA 4JEYA 4ADBA 4IW7A 1SZKA 1LS3A 4U2HA 2X5FA 3EIBA 3WX9A 4RITA 4OMAA 1AMQA 1CQ6A 3GWPA 4ZWMA 2HUFA 2AY9A 2DKJA 2E54A 2W8JA 2YKXA 3HVYA 1KKJA 2FNUA 1P3WA 2YCTA 4JEZA 3VK4A 3N4RA 2AY8A 5KTBA 3GZDC 4OCAA 1S08A 2CJDA 1UKJA 3RBLA 2E7IA 2JJFA 1M0PA 1TOEA 2DGLA 2Z9UA 1WYTB 3IF2A 4PFNA 2X3LA 2W7DA 2TPLA 3TATA 2EZ2A 2HP2A 3PD6A 4PIWA 1E5FA 2DOUA 1DJUA 2JISA 3NYUA 1D7UA 5LHAA 2VGUA 3H14A 3AENB 2BKWA 3BV0A 2FM1A 2O1BA 4R8DA 4F5HA 5M4DA 1GC0A 3MAFA 3PDBB 4JEVA 2AY1A 5F8VA 4WB0A 2CY8A 3AEPA 4OBVA 1V72A 4WLJA 4PVFA 5EIGA 5G2QA 2Z67A 2AY3A 3NNKA 3NU8A 4RJ0A 3NUIA 4WXGA 3ZRPA 4WXBA 2BI3A 3RQ1A 2X5DA 2DGKA 2HOZA 3B46A 4W1XA 5F9SA 2ZUKA 4OC9A 2VIAA 1AHGA 1XI9A 4XJLA 5FT8A 4F5IA 4ZASA 4WBTA 2OQXA 3WY7A 2W7EA 2AEVA 2W8TA 4E3RA 2VGTA 3HT4A 2O7CA 2BI5A 4IYOB 1AAWA 3A9XA 4RIZA 1XEYA 2AATA 1QGNA 5AX8A 1M7YA 1N8PA 4IY7A 4WLHA 2YHKA 3F9TA 1SZUA 3FTBA 3P6KA 2VMOA 2QA3A 3DC1A 1KKPA 4HF8A 4M2MA 9AATA 1MAQA 4CBRA 1ASEA 1MAPA 2FNIA 1LC7A 1C0NA 4B98A 3AEJA 5M4BA 4KXKA 2W7KA 2XBNA 4LW2A 1G7WA 3DU4A 3DYDA 1ELUA 1VJOA 1I43A 2ORDA 4W1WA 4A6RA 1ASNA 1G4XA 2D61A 3EUCA 3II0A 3UAKA 4ADEA 4AZJA 1V2FA 1YOOA 2HOYA 3TFUA 4ZM4A 5EFSA 3AEMA 1UU0A 3FCRA 3KE3A 4HVKA 3P1TA 4F5GA 3AV7A 1DGDA 4PFFA 4ADCA 1AAMA 1AKAA 3DR7A 3DXWA 3E9KA 2YCPA 3EI8A 2D66A 4ZDPA 2XH1A 2VMPA 2CINA 1GEYA 3E2ZB 3LVLB 4K2IA 1D7VA 2JJGA 3ASBA 2D7YA 2VMSA 3ACZA 1W7LA 4UQVA 4DGTA 3RBFA 5HDMA 1AMSA 1DJEA 4L0OA 1CZCA 5FT5A 2QBTA 3MC6C 4N0WA 2QLRA 1IJIA 2VMXA 1B9IA 1WYVA 4F5LA 1O62A 1GBNA 4JF0A 3EIAA 4LW4A 2QSRA 3W1IA 1ASMA 1YNUA 2BIEA 2BI1A 2WK9A 4Q75A 2YCNA 3AOWA 3K7YA 4UOYA 1JG8A 2D63A 3PAAA 4K2MA 2Z9WA 1AJSA 2YKUA 2R5CA 2ZJGA 2GQNA 1PMMA 3FZ6A 2DKBA 3HDOA 3N0LA 3NRAA 4MY5A 3DZZA 4LNLA 1T3IA 1N31A 4RJYA 3HL2A 1QITA 3FRKA 4EB7A 1B5PA 2EH6A 2OGEA 3WKSA 4F5JA 1OHWA 3A9ZA 3BWNC 4GSAA 1W7MA 2Z1ZA 1FG7A 1CQ8A 5E3KA 4ZLVA 1VP4A 2DGMA 3COGA 3QI6A 3RUYA 2AY7A 3EZSA 2CH1A 3PDXA 3VOMA 3FSLA 1DJ9A 4BMKA 4XAUA 3RI6A 3GJUA 2WK8A 2BIGA 2Q7WA 2GMSA 2JGTA 1CJ0A 3UWCA 5G2PA 2Z20A 3NTJA 2C0RA 4WP0A 2ZSLA 1BJOB 4P7YA 3AEOA 5D95A 4EB5A 1H0CA 1UU1A 4XK1A 4MKKA 3N4XA 3FDBA 3GBXA 4A0GA 1OATA 4JE5D 2D5YA 1MDXA 4ZDLA 1IX6A 1C7OA 1WYTA 1DKAA 1X0MA 3ZRQA 4ZM3A 2ZY4A 3NX3A 4MGRA 2W7HA 1N2TA 1FG3A 3FQ8A 3FFRA 2HORA 1BKGA 2VI9A 1ELQA 3MEBA 4BHDA 1TOGA 3AENA 4WXFA 2C7TA 2CJHA 3PDBA 1SPAA 4CBSA 1M0QA 1MLZA 3H9XA 4NOGA 1D7RA 1SZSA 3GSBA 5C6UA 3JWBA 3MAUA 3HBXA 4JF1A 5J8QA 4BQ0A 2JJHA 3EI9A 3H7FA 4TN4A 3CQ5A 1BQAA 4A0HA 2HOXA 1QJ3A 1ARGA 1I48A 5M49A 4E1OA 5E5IA 3AELA 3LV2A 4EMYA 4Y0DA 2VYCA 3DODA 2X8UA 1AHYA 1RV3A 4AO9A 2VMQA 3DR4A 4IYOA 3BCXA 3M5UA 1AHEA 1V2EA 4K2BA 1ARIA 3WGCA 4F5KA 2NMPA 5EIGB 2HZPA 1S07A 2C81A 2O0RA 3D6KA 7AATA 2EPJA 1KL2A 1TARA 1GD9A 3OP7A 4Y0HA 4A0RA 3BC8A 4ADDA 4AO4A 4AH3A 1ASCA 1D2FA 4B9BA 1X28A 1IAYA 1AIBA 2VIBA 1ZOBA 2FQ6A 2R0TA 3ASAA 1EG5A 1RV4A 2CSTA 2BWOA 1KMJA 3NYTA 4GRXA 1W23A 3T32A 4M2KA 3GZDA 1ARHA 4WYGA 4ATQA 1ORDA 2OATA 3K40A 4IXOA 1BQDA 2E7JA 4J5UA 4ZDOA 3L8AA 5EUDA 2ZP7A 3PA9A 4MQPA 4RLGA 1ASGA 3CQ4A 3G0TA 1YJYA 3EZ1A 4H51A 3MADA 5EAAA 1D7SA 1C7NA 1C7GA 4TV7A 1M0NA 2VGWA 1J32A 4MKJA 1EQBA 1I29A 5IWQA 1LK9A 1YIZA 3EI6A 2ZSMA 3JTXA 4LNJA 4Q76A 1Z3ZA 2VGVA 1X29A 1OHVA 3E2ZA 4ATPA 1H1CA 2BWNA 3HLMA 4XEWA 3WCNA 2FKIA 4IXZA 1B8GA 1IUGA 4P3MA 3CAIA 1ARSA 3ATHA 1AHFA 4R2NA 2CTZA 3VAXA 3NUBA 2HUUA 3BCBA 4LNMA 1M4NA 3LG0A 5DX5A 2HUIA 2WB6A 4ISYA 4FL0A 5TF5A 3Q8NA 1O61A 1YJSA 3F6TA 2ZY3A 1LC8A 1SVVA 3NU7A 3QN6A 1B5OA 1J04A 2BYLA 3UE8A 1UU2A 2YKVA 4ZWVA 4M2JA 3RCHB 5LH9A 2KFPA 4I8AA 2C44A 2VMNA 3E2YA 4JEWA 3B1EA 1ARTA 4WD2A 4JE5A 1E5EA 3G8MA 3VK2A 2ZYJA 4W8IA 3WGBA 3NDNA 2OGAA 1B4XA 1AY4A 3PPLA 4EU1A 1DFOA 3E6GA 1S0AA 4FFCA 3AATA 3LVKA 4ITGA 1GDEA 4H63Q 1ASLA 3PGYA 5HHYA 3KKIA 2E7UA 2VMUA 1AIAA 2Z9VA 4IXSA 4WYCA 2EZ1A 1OXOA 1WKHA 3FD0A 2F8JA 4WYEA 1JS6A 4W5KA 2AY5A 2W7MA 3PJ0A 2Z1YA 5HXXA 2HP1A 1TASA 3LY1A 3FKDA 5G4JA 1AJSB 3ECDA 3PIUA 1M6SA 1WYUB 1ZC9A 2G6WA 3N5MA 2EO5A 2VLFA 2D65A 1GEWA 3ISLA 4Q31A 1BW0A 3FZ8A 2CJGA 1Y4IA 3TQXA 4MSOA 2CFBA 2Z9XA 2YRIA 1IAXA 2PO3A 1IVRA 3QM2A 2V0YA 5I92A 1BJOA 2BI9A 3TFTA 2AY6A 3B8XA 4DQ6A 1TOJA 2BYJA 1MLYA 3I5TA 2W7IA 4EFFA 1Z7DA 2PB2A 4OBUA 2OKKA 3BCAA 4KYOA 3R4TA 2A1VA 2PB0A 1O69A 3ELPA 1C4KA 1LC5A 1X2AA 3WCOA 3MC6A 1AKCA 1S06A 3QGUA 4GE4A 4XQ2A 3USFA 4A6UA 4W1VA 2JJEA 3JZLA 1PMOA 2VLHA 3JU7A 3AEJC 1S09A 3I4JA 4BA4A 8AATA 2BHXA 4UHNA 2WKAA 3FVUA 5JAYA 2VMZA 3N4SA 1ZODA 1OHYA 1YAAA 5DJ9A 3AEMC 3PD6B 4F4EA 1QZ9A 3F0HA 2R5EA 4Y0IA 3VP6A 4UHOA 1TATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVX A;  2EGY A;  4ZSW A;  1ASF A;  4XJM A;  5G4I A;  1GC2 A;  4ZAH A;  2WK7 A;  3MAF B;  4J8L A;  1KMK A;  2OKJ A;  1EJI A;  3E2F A;  2CAN A;  4WB0 B;  1DGE A;  3BWN A;  1RVY A;  4A6T A;  1IX8 A;  5EUE A;  3WZF A;  2CB1 A;  4MQR A;  3QHX A;  2VI8 A;  4QGR A;  3W1J A;  2W7J A;  1TOK A;  4CVQ A;  2W8V A;  3DXV A;  3EI7 A;  3FZ7 A;  1OXP A;  2FYF A;  1AJR A;  3DRD A;  1M32 A;  4RAE A;  5K8B A;  2VGZ A;  4RKD A;  1PFF A;  4F5M A;  1BJN A;  4W91 A;  2ZY2 A;  5BJ4 A;  1MDO A;  3L44 A;  1AMA A;  1KL1 A;  2AY2 A;  5M46 A;  2DR1 A;  2CH2 A;  3ELE A;  4RKC A;  4BA5 A;  5G0A A;  4JEX A;  5E4Z A;  1IX7 A;  3R9A A;  4OTL A;  1YIY A;  3GET A;  3I16 A;  4KAM A;  5EQC A;  4GDY A;  4R5Z A;  4ITX A;  2AEU A;  1CL2 A;  3BN1 A;  4GE7 A;  4IX8 A;  3BWO A;  3G7Q A;  4R5F A;  4DBC A;  1MGV A;  1CL1 A;  4WYF A;  1CS1 A;  1VEF A;  1JF9 A;  1AHX A;  1TPL A;  3WLX A;  3CBF A;  3E77 A;  5EAV A;  1GEX A;  1W7N A;  2GSA A;  4O6Z A;  4A00 A;  4N0B A;  1ECX A;  2VGS A;  2ZY5 A;  1WST A;  3MBB A;  1BT4 A;  3HQT A;  2BI2 A;  2GMU A;  3FFH A;  1ASA A;  3AOV A;  2RFV A;  3B1D A;  3ZZJ A;  5D5S A;  1LW4 A;  3MKJ A;  3ZZK A;  2YRR A;  4GE9 A;  2YOB A;  3FVS A;  3LWS A;  2FN6 A;  2R2N A;  4TMR A;  5G09 A;  4A72 A;  2AY4 A;  2Z61 A;  2D64 A;  2W7F A;  4E77 A;  3KGX A;  4LC3 A;  2VMR A;  2VMV A;  2BWP A;  1SF2 A;  1U08 A;  2QMA A;  1AIC A;  1MDZ A;  3IHJ A;  1G7X A;  1V2D A;  4XJO A;  1SFF A;  1ASD A;  1IBJ A;  3A9Y A;  2ZC0 A;  1PG8 A;  2JG2 A;  3LVJ A;  4WYD A;  3RCH A;  1YJZ A;  4RM1 A;  1AY5 A;  3ZRR A;  1LKC A;  4U1T A;  2VMY A;  3QPG A;  1M0O A;  1LW5 A;  1G4V A;  3GZC A;  3GR9 A;  3QBO A;  1BS0 A;  3OKS A;  1BJW A;  4Q6R A;  1WYV B;  4MQQ A;  4UHM A;  2GB3 A;  5DJ1 A;  4AOA A;  1W3U A;  1QJ5 A;  3W1H A;  3N75 A;  1GCK A;  3NYS A;  1I41 A;  3EI5 A;  3JW9 A;  4ZSY A;  3A8U X;  1QIR A;  4WYA A;  1TOI A;  4A0F A;  1BJ4 A;  2BIA A;  1GC4 A;  1JS3 A;  1GC3 A;  2W7G A;  3K28 A;  3LVM A;  3FDD A;  3KGW A;  3WKR A;  4E3Q A;  3A2B A;  2R5C B;  1O4S A;  4OT8 A;  2YKY A;  3VK3 A;  4F5F A;  4OYT A;  2W7L A;  1ASB A;  5FT6 A;  1FC4 A;  1AY8 A;  1QIS A;  1WYU A;  5EUN A;  1CQ7 A;  1AX4 A;  1WKG A;  4AZK A;  4CXQ A;  1DTY A;  2D7Z A;  2QB2 A;  3JWA A;  3FQA A;  3BB8 A;  5DB5 A;  4CXR A;  3CQ6 A;  3TCM A;  3BS8 A;  1AKB A;  4GEB A;  2VMW A;  2W8U A;  1C9C A;  2W8W A;  1B9H A;  3B1C A;  1CZE A;  1AMR A;  3FQ7 A;  5FT4 A;  2VMT A;  1RVU A;  4XJP A;  2V1P A;  5BJ3 A;  2QB3 A;  3HMU A;  4JEY A;  4ADB A;  4IW7 A;  1SZK A;  1LS3 A;  4U2H A;  2X5F A;  3EIB A;  3WX9 A;  4RIT A;  4OMA A;  1AMQ A;  1CQ6 A;  3GWP A;  4ZWM A;  2HUF A;  2AY9 A;  2DKJ A;  2E54 A;  2W8J A;  2YKX A;  3HVY A;  1KKJ A;  2FNU A;  1P3W A;  2YCT A;  4JEZ A;  3VK4 A;  2AY8 A;  3GZD C;  4OCA A;  1S08 A;  2CJD A;  1UKJ A;  3RBL A;  2E7I A;  2JJF A;  1M0P A;  1TOE A;  2DGL A;  2Z9U A;  1WYT B;  3IF2 A;  4PFN A;  2X3L A;  2W7D A;  2TPL A;  3TAT A;  2EZ2 A;  2HP2 A;  3PD6 A;  4PIW A;  1E5F A;  2DOU A;  1DJU A;  2JIS A;  3NYU A;  1D7U A;  5LHA A;  2VGU A;  3H14 A;  3AEN B;  2BKW A;  3BV0 A;  2FM1 A;  2O1B A;  4R8D A;  4F5H A;  5M4D A;  1GC0 A;  3MAF A;  3PDB B;  4JEV A;  2AY1 A;  5F8V A;  4WB0 A;  2CY8 A;  3AEP A;  4OBV A;  1V72 A;  4WLJ A;  4PVF A;  5EIG A;  5G2Q A;  2Z67 A;  2AY3 A;  3NNK A;  3NU8 A;  4RJ0 A;  3NUI A;  4WXG A;  3ZRP A;  4WXB A;  2BI3 A;  3RQ1 A;  2X5D A;  2DGK A;  2HOZ A;  3B46 A;  4W1X A;  5F9S A;  2ZUK A;  4OC9 A;  2VIA A;  1AHG A;  1XI9 A;  4XJL A;  5FT8 A;  4F5I A;  4ZAS A;  4WBT A;  2OQX A;  3WY7 A;  2W7E A;  2AEV A;  2W8T A;  4E3R A;  2VGT A;  3HT4 A;  2O7C A;  2BI5 A;  4IYO B;  1AAW A;  3A9X A;  4RIZ A;  1XEY A;  2AAT A;  1QGN A;  5AX8 A;  1M7Y A;  1N8P A;  4IY7 A;  4WLH A;  2YHK A;  3F9T A;  1SZU A;  3FTB A;  3P6K A;  2VMO A;  2QA3 A;  3DC1 A;  1KKP A;  4HF8 A;  4M2M A;  9AAT A;  1MAQ A;  4CBR A;  1ASE A;  1MAP A;  2FNI A;  1LC7 A;  1C0N A;  4B98 A;  3AEJ A;  5M4B A;  4KXK A;  2W7K A;  2XBN A;  4LW2 A;  1G7W A;  3DU4 A;  3DYD A;  1ELU A;  1VJO A;  1I43 A;  2ORD A;  4W1W A;  4A6R A;  1ASN A;  1G4X A;  2D61 A;  3EUC A;  3II0 A;  3UAK A;  4ADE A;  4AZJ A;  1V2F A;  1YOO A;  2HOY A;  3TFU A;  4ZM4 A;  5EFS A;  3AEM A;  1UU0 A;  3FCR A;  3KE3 A;  4HVK A;  3P1T A;  4F5G A;  3AV7 A;  1DGD A;  4PFF A;  4ADC A;  1AAM A;  1AKA A;  3DR7 A;  3DXW A;  3E9K A;  2YCP A;  3EI8 A;  2D66 A;  4ZDP A;  2XH1 A;  2VMP A;  2CIN A;  1GEY A;  3E2Z B;  3LVL B;  4K2I A;  1D7V A;  2JJG A;  3ASB A;  2D7Y A;  2VMS A;  3ACZ A;  1W7L A;  4UQV A;  4DGT A;  3RBF A;  5HDM A;  1AMS A;  1DJE A;  4L0O A;  1CZC A;  5FT5 A;  2QBT A;  3MC6 C;  4N0W A;  2QLR A;  1IJI A;  2VMX A;  1B9I A;  1WYV A;  4F5L A;  1O62 A;  1GBN A;  4JF0 A;  3EIA A;  4LW4 A;  3W1I A;  1ASM A;  1YNU A;  2BIE A;  2BI1 A;  2WK9 A;  4Q75 A;  2YCN A;  3AOW A;  3K7Y A;  4UOY A;  1JG8 A;  2D63 A;  3PAA A;  4K2M A;  2Z9W A;  1AJS A;  2YKU A;  2R5C A;  2ZJG A;  2GQN A;  1PMM A;  3FZ6 A;  2DKB A;  3HDO A;  3N0L A;  3NRA A;  4MY5 A;  3DZZ A;  4LNL A;  1T3I A;  1N31 A;  4RJY A;  3HL2 A;  1QIT A;  3FRK A;  4EB7 A;  1B5P A;  2EH6 A;  2OGE A;  3WKS A;  4F5J A;  1OHW A;  3A9Z A;  3BWN C;  4GSA A;  1W7M A;  2Z1Z A;  1FG7 A;  1CQ8 A;  5E3K A;  4ZLV A;  1VP4 A;  2DGM A;  3COG A;  3QI6 A;  3RUY A;  2AY7 A;  3EZS A;  2CH1 A;  3PDX A;  3VOM A;  3FSL A;  1DJ9 A;  4BMK A;  4XAU A;  3RI6 A;  3GJU A;  2WK8 A;  2BIG A;  2Q7W A;  2GMS A;  2JGT A;  1CJ0 A;  3UWC A;  5G2P A;  2Z20 A;  3NTJ A;  2C0R A;  4WP0 A;  2ZSL A;  1BJO B;  4P7Y A;  3AEO A;  5D95 A;  4EB5 A;  1H0C A;  1UU1 A;  4XK1 A;  4MKK A;  3FDB A;  3GBX A;  4A0G A;  1OAT A;  4JE5 D;  2D5Y A;  1MDX A;  4ZDL A;  1IX6 A;  1C7O A;  1WYT A;  1DKA A;  1X0M A;  3ZRQ A;  4ZM3 A;  2ZY4 A;  3NX3 A;  4MGR A;  2W7H A;  1N2T A;  1FG3 A;  3FQ8 A;  3FFR A;  2HOR A;  1BKG A;  2VI9 A;  1ELQ A;  3MEB A;  4BHD A;  1TOG A;  3AEN A;  4WXF A;  2C7T A;  2CJH A;  3PDB A;  1SPA A;  4CBS A;  1M0Q A;  1MLZ A;  4NOG A;  1D7R A;  1SZS A;  3GSB A;  5C6U A;  3JWB A;  3MAU A;  3HBX A;  4JF1 A;  5J8Q A;  4BQ0 A;  2JJH A;  3EI9 A;  3H7F A;  4TN4 A;  3CQ5 A;  1BQA A;  4A0H A;  2HOX A;  1QJ3 A;  1ARG A;  1I48 A;  5M49 A;  4E1O A;  5E5I A;  3AEL A;  3LV2 A;  4EMY A;  4Y0D A;  2VYC A;  3DOD A;  2X8U A;  1AHY A;  1RV3 A;  4AO9 A;  2VMQ A;  3DR4 A;  4IYO A;  3BCX A;  3M5U A;  1AHE A;  1V2E A;  4K2B A;  1ARI A;  3WGC A;  4F5K A;  2NMP A;  5EIG B;  2HZP A;  1S07 A;  2C81 A;  2O0R A;  3D6K A;  7AAT A;  2EPJ A;  1KL2 A;  1TAR A;  1GD9 A;  3OP7 A;  4Y0H A;  4A0R A;  3BC8 A;  4ADD A;  4AO4 A;  4AH3 A;  1ASC A;  1D2F A;  4B9B A;  1X28 A;  1IAY A;  1AIB A;  2VIB A;  1ZOB A;  2FQ6 A;  2R0T A;  3ASA A;  1EG5 A;  1RV4 A;  2CST A;  2BWO A;  1KMJ A;  3NYT A;  4GRX A;  1W23 A;  3T32 A;  4M2K A;  3GZD A;  1ARH A;  4WYG A;  4ATQ A;  1ORD A;  2OAT A;  3K40 A;  4IXO A;  1BQD A;  2E7J A;  4J5U A;  4ZDO A;  3L8A A;  5EUD A;  2ZP7 A;  3PA9 A;  4MQP A;  4RLG A;  1ASG A;  3CQ4 A;  3G0T A;  1YJY A;  3EZ1 A;  4H51 A;  3MAD A;  5EAA A;  1D7S A;  1C7N A;  1C7G A;  4TV7 A;  1M0N A;  2VGW A;  1J32 A;  4MKJ A;  1EQB A;  1I29 A;  5IWQ A;  1LK9 A;  1YIZ A;  3EI6 A;  2ZSM A;  3JTX A;  4LNJ A;  4Q76 A;  1Z3Z A;  2VGV A;  1X29 A;  1OHV A;  3E2Z A;  4ATP A;  1H1C A;  2BWN A;  3HLM A;  4XEW A;  3WCN A;  4IXZ A;  1B8G A;  1IUG A;  4P3M A;  3CAI A;  1ARS A;  3ATH A;  1AHF A;  4R2N A;  2CTZ A;  3VAX A;  3NUB A;  2HUU A;  3BCB A;  4LNM A;  1M4N A;  3LG0 A;  5DX5 A;  2HUI A;  4ISY A;  4FL0 A;  5TF5 A;  3Q8N A;  1O61 A;  1YJS A;  3F6T A;  2ZY3 A;  1LC8 A;  1SVV A;  3NU7 A;  3QN6 A;  1B5O A;  1J04 A;  2BYL A;  3UE8 A;  1UU2 A;  2YKV A;  4ZWV A;  4M2J A;  3RCH B;  5LH9 A;  4I8A A;  2C44 A;  2VMN A;  3E2Y A;  4JEW A;  3B1E A;  1ART A;  4WD2 A;  4JE5 A;  1E5E A;  3G8M A;  3VK2 A;  2ZYJ A;  4W8I A;  3WGB A;  3NDN A;  2OGA A;  1B4X A;  1AY4 A;  3PPL A;  4EU1 A;  1DFO A;  3E6G A;  1S0A A;  4FFC A;  3AAT A;  3LVK A;  4ITG A;  1GDE A;  1ASL A;  3PGY A;  5HHY A;  3KKI A;  2E7U A;  2VMU A;  1AIA A;  2Z9V A;  4IXS A;  4WYC A;  2EZ1 A;  1OXO A;  1WKH A;  3FD0 A;  2F8J A;  4WYE A;  1JS6 A;  4W5K A;  2AY5 A;  2W7M A;  3PJ0 A;  2Z1Y A;  5HXX A;  2HP1 A;  1TAS A;  3LY1 A;  3FKD A;  5G4J A;  1AJS B;  3ECD A;  3PIU A;  1M6S A;  1WYU B;  1ZC9 A;  2G6W A;  3N5M A;  2EO5 A;  2VLF A;  2D65 A;  1GEW A;  3ISL A;  4Q31 A;  1BW0 A;  3FZ8 A;  2CJG A;  1Y4I A;  3TQX A;  4MSO A;  2CFB A;  2Z9X A;  2YRI A;  1IAX A;  2PO3 A;  1IVR A;  3QM2 A;  2V0Y A;  5I92 A;  1BJO A;  2BI9 A;  3TFT A;  2AY6 A;  3B8X A;  4DQ6 A;  1TOJ A;  2BYJ A;  1MLY A;  3I5T A;  2W7I A;  4EFF A;  1Z7D A;  2PB2 A;  4OBU A;  2OKK A;  3BCA A;  4KYO A;  3R4T A;  2PB0 A;  1O69 A;  3ELP A;  1C4K A;  1LC5 A;  1X2A A;  3WCO A;  3MC6 A;  1AKC A;  1S06 A;  3QGU A;  4GE4 A;  4XQ2 A;  3USF A;  4A6U A;  4W1V A;  2JJE A;  3JZL A;  1PMO A;  2VLH A;  3JU7 A;  3AEJ C;  1S09 A;  3I4J A;  4BA4 A;  8AAT A;  2BHX A;  4UHN A;  2WKA A;  3FVU A;  5JAY A;  2VMZ A;  1ZOD A;  1OHY A;  1YAA A;  5DJ9 A;  3AEM C;  3PD6 B;  4F4E A;  1QZ9 A;  3F0H A;  2R5E A;  4Y0I A;  3VP6 A;  4UHO A;  1TAT A; 
#chains in the Genus database with same CATH topology
 3FVX A;  2EGY A;  4ZSW A;  1ASF A;  4XJM A;  5G4I A;  1GC2 A;  4ZAH A;  2WK7 A;  3MAF B;  4J8L A;  1KMK A;  2OKJ A;  1EJI A;  3E2F A;  2CAN A;  4WB0 B;  1DGE A;  3BWN A;  1RVY A;  4A6T A;  1IX8 A;  5EUE A;  3WZF A;  2CB1 A;  4MQR A;  3QHX A;  2VI8 A;  4QGR A;  3W1J A;  2W7J A;  1TOK A;  4CVQ A;  2W8V A;  3DXV A;  3EI7 A;  3FZ7 A;  1OXP A;  2FYF A;  1AJR A;  3DRD A;  1M32 A;  4RAE A;  5K8B A;  2VGZ A;  4RKD A;  1PFF A;  4F5M A;  1BJN A;  4W91 A;  2ZY2 A;  5BJ4 A;  1MDO A;  3L44 A;  1AMA A;  1KL1 A;  2AY2 A;  5M46 A;  2DR1 A;  2CH2 A;  3ELE A;  4RKC A;  4BA5 A;  5G0A A;  4JEX A;  5E4Z A;  1IX7 A;  3R9A A;  4OTL A;  1YIY A;  3GET A;  3I16 A;  4KAM A;  5EQC A;  4GDY A;  4R5Z A;  4ITX A;  2AEU A;  1CL2 A;  3BN1 A;  4GE7 A;  4IX8 A;  3BWO A;  3G7Q A;  4R5F A;  4DBC A;  1MGV A;  1CL1 A;  4WYF A;  1CS1 A;  1VEF A;  1JF9 A;  1AHX A;  1TPL A;  3WLX A;  3CBF A;  3E77 A;  5EAV A;  1GEX A;  1W7N A;  2GSA A;  4O6Z A;  4A00 A;  4N0B A;  1ECX A;  2VGS A;  2ZY5 A;  1WST A;  3MBB A;  1BT4 A;  3HQT A;  2EYQ A;  2BI2 A;  2GMU A;  3FFH A;  1ASA A;  3AOV A;  2G7J A;  2RFV A;  3B1D A;  3ZZJ A;  5D5S A;  1LW4 A;  3MKJ A;  3ZZK A;  2YRR A;  4GE9 A;  2YOB A;  3FVS A;  3LWS A;  2FN6 A;  2R2N A;  4TMR A;  5G09 A;  4A72 A;  2AY4 A;  2Z61 A;  2D64 A;  2W7F A;  4E77 A;  3KGX A;  4LC3 A;  2VMR A;  2VMV A;  2BWP A;  1SF2 A;  1U08 A;  2QMA A;  1AIC A;  1MDZ A;  3IHJ A;  1G7X A;  1V2D A;  4XJO A;  1SFF A;  1ASD A;  1IBJ A;  3A9Y A;  2ZC0 A;  1PG8 A;  2JG2 A;  3LVJ A;  4WYD A;  3RCH A;  1YJZ A;  4RM1 A;  1AY5 A;  3ZRR A;  1LKC A;  4U1T A;  2VMY A;  3QPG A;  1M0O A;  1LW5 A;  1G4V A;  3GZC A;  3GR9 A;  3QBO A;  1BS0 A;  3OKS A;  1BJW A;  4Q6R A;  1WYV B;  4MQQ A;  4UHM A;  2GB3 A;  5DJ1 A;  4AOA A;  3N7N A;  1W3U A;  1QJ5 A;  3W1H A;  3N75 A;  1GCK A;  3NYS A;  1I41 A;  3EI5 A;  3JW9 A;  4ZSY A;  3A8U X;  1QIR A;  4WYA A;  1TOI A;  4A0F A;  1BJ4 A;  2BIA A;  1GC4 A;  1JS3 A;  1GC3 A;  2W7G A;  3K28 A;  3LVM A;  3FDD A;  3KGW A;  3WKR A;  4E3Q A;  3A2B A;  2R5C B;  1O4S A;  4OT8 A;  2YKY A;  3VK3 A;  4F5F A;  4OYT A;  2W7L A;  1ASB A;  5FT6 A;  1FC4 A;  1AY8 A;  1QIS A;  1WYU A;  5EUN A;  1CQ7 A;  1AX4 A;  1WKG A;  4AZK A;  4CXQ A;  1DTY A;  2D7Z A;  2QB2 A;  3JWA A;  3FQA A;  3BB8 A;  5DB5 A;  4CXR A;  3CQ6 A;  3TCM A;  3BS8 A;  1AKB A;  4K05 A;  4GEB A;  2VMW A;  2W8U A;  1C9C A;  2W8W A;  1B9H A;  3B1C A;  1CZE A;  1AMR A;  3FQ7 A;  5FT4 A;  2VMT A;  1RVU A;  4XJP A;  2V1P A;  5BJ3 A;  2QB3 A;  3HMU A;  4JEY A;  4ADB A;  4IW7 A;  1SZK A;  1LS3 A;  4U2H A;  2X5F A;  3EIB A;  3WX9 A;  4RIT A;  4OMA A;  1AMQ A;  1CQ6 A;  3GWP A;  4ZWM A;  2HUF A;  2AY9 A;  2DKJ A;  2E54 A;  2W8J A;  2YKX A;  3HVY A;  1KKJ A;  2FNU A;  1P3W A;  2YCT A;  4JEZ A;  3VK4 A;  3N4R A;  2AY8 A;  5KTB A;  3GZD C;  4OCA A;  1S08 A;  2CJD A;  1UKJ A;  3RBL A;  2E7I A;  2JJF A;  1M0P A;  1TOE A;  2DGL A;  2Z9U A;  1WYT B;  3IF2 A;  4PFN A;  2X3L A;  2W7D A;  2TPL A;  3TAT A;  2EZ2 A;  2HP2 A;  3PD6 A;  4PIW A;  1E5F A;  2DOU A;  1DJU A;  2JIS A;  3NYU A;  1D7U A;  5LHA A;  2VGU A;  3H14 A;  3AEN B;  2BKW A;  3BV0 A;  2FM1 A;  2O1B A;  4R8D A;  4F5H A;  5M4D A;  1GC0 A;  3MAF A;  3PDB B;  4JEV A;  2AY1 A;  5F8V A;  4WB0 A;  2CY8 A;  3AEP A;  4OBV A;  1V72 A;  4WLJ A;  4PVF A;  5EIG A;  5G2Q A;  2Z67 A;  2AY3 A;  3NNK A;  3NU8 A;  4RJ0 A;  3NUI A;  4WXG A;  3ZRP A;  4WXB A;  2BI3 A;  3RQ1 A;  2X5D A;  2DGK A;  2HOZ A;  3B46 A;  4W1X A;  5F9S A;  2ZUK A;  4OC9 A;  2VIA A;  1AHG A;  1XI9 A;  4XJL A;  5FT8 A;  4F5I A;  4ZAS A;  4WBT A;  2OQX A;  3WY7 A;  2W7E A;  2AEV A;  2W8T A;  4E3R A;  2VGT A;  3HT4 A;  2O7C A;  2BI5 A;  4IYO B;  1AAW A;  3A9X A;  4RIZ A;  1XEY A;  2AAT A;  1QGN A;  5AX8 A;  1M7Y A;  1N8P A;  4IY7 A;  4WLH A;  2YHK A;  3F9T A;  1SZU A;  3FTB A;  3P6K A;  2VMO A;  2QA3 A;  3DC1 A;  1KKP A;  4HF8 A;  4M2M A;  9AAT A;  1MAQ A;  4CBR A;  1ASE A;  1MAP A;  2FNI A;  1LC7 A;  1C0N A;  4B98 A;  3AEJ A;  5M4B A;  4KXK A;  2W7K A;  2XBN A;  4LW2 A;  1G7W A;  3DU4 A;  3DYD A;  1ELU A;  1VJO A;  1I43 A;  2ORD A;  4W1W A;  4A6R A;  1ASN A;  1G4X A;  2D61 A;  3EUC A;  3II0 A;  3UAK A;  4ADE A;  4AZJ A;  1V2F A;  1YOO A;  2HOY A;  3TFU A;  4ZM4 A;  5EFS A;  3AEM A;  1UU0 A;  3FCR A;  3KE3 A;  4HVK A;  3P1T A;  4F5G A;  3AV7 A;  1DGD A;  4PFF A;  4ADC A;  1AAM A;  1AKA A;  3DR7 A;  3DXW A;  3E9K A;  2YCP A;  3EI8 A;  2D66 A;  4ZDP A;  2XH1 A;  2VMP A;  2CIN A;  1GEY A;  3E2Z B;  3LVL B;  4K2I A;  1D7V A;  2JJG A;  3ASB A;  2D7Y A;  2VMS A;  3ACZ A;  1W7L A;  4UQV A;  4DGT A;  3RBF A;  5HDM A;  1AMS A;  1DJE A;  4L0O A;  1CZC A;  5FT5 A;  2QBT A;  3MC6 C;  4N0W A;  2QLR A;  1IJI A;  2VMX A;  1B9I A;  1WYV A;  4F5L A;  1O62 A;  1GBN A;  4JF0 A;  3EIA A;  4LW4 A;  2QSR A;  3W1I A;  1ASM A;  1YNU A;  2BIE A;  2BI1 A;  2WK9 A;  4Q75 A;  2YCN A;  3AOW A;  3K7Y A;  4UOY A;  1JG8 A;  2D63 A;  3PAA A;  4K2M A;  2Z9W A;  1AJS A;  2YKU A;  2R5C A;  2ZJG A;  2GQN A;  1PMM A;  3FZ6 A;  2DKB A;  3HDO A;  3N0L A;  3NRA A;  4MY5 A;  3DZZ A;  4LNL A;  1T3I A;  1N31 A;  4RJY A;  3HL2 A;  1QIT A;  3FRK A;  4EB7 A;  1B5P A;  2EH6 A;  2OGE A;  3WKS A;  4F5J A;  1OHW A;  3A9Z A;  3BWN C;  4GSA A;  1W7M A;  2Z1Z A;  1FG7 A;  1CQ8 A;  5E3K A;  4ZLV A;  1VP4 A;  2DGM A;  3COG A;  3QI6 A;  3RUY A;  2AY7 A;  3EZS A;  2CH1 A;  3PDX A;  3VOM A;  3FSL A;  1DJ9 A;  4BMK A;  4XAU A;  3RI6 A;  3GJU A;  2WK8 A;  2BIG A;  2Q7W A;  2GMS A;  2JGT A;  1CJ0 A;  3UWC A;  5G2P A;  2Z20 A;  3NTJ A;  2C0R A;  4WP0 A;  2ZSL A;  1BJO B;  4P7Y A;  3AEO A;  5D95 A;  4EB5 A;  1H0C A;  1UU1 A;  4XK1 A;  4MKK A;  3N4X A;  3FDB A;  3GBX A;  4A0G A;  1OAT A;  4JE5 D;  2D5Y A;  1MDX A;  4ZDL A;  1IX6 A;  1C7O A;  1WYT A;  1DKA A;  1X0M A;  3ZRQ A;  4ZM3 A;  2ZY4 A;  3NX3 A;  4MGR A;  2W7H A;  1N2T A;  1FG3 A;  3FQ8 A;  3FFR A;  2HOR A;  1BKG A;  2VI9 A;  1ELQ A;  3MEB A;  4BHD A;  1TOG A;  3AEN A;  4WXF A;  2C7T A;  2CJH A;  3PDB A;  1SPA A;  4CBS A;  1M0Q A;  1MLZ A;  3H9X A;  4NOG A;  1D7R A;  1SZS A;  3GSB A;  5C6U A;  3JWB A;  3MAU A;  3HBX A;  4JF1 A;  5J8Q A;  4BQ0 A;  2JJH A;  3EI9 A;  3H7F A;  4TN4 A;  3CQ5 A;  1BQA A;  4A0H A;  2HOX A;  1QJ3 A;  1ARG A;  1I48 A;  5M49 A;  4E1O A;  5E5I A;  3AEL A;  3LV2 A;  4EMY A;  4Y0D A;  2VYC A;  3DOD A;  2X8U A;  1AHY A;  1RV3 A;  4AO9 A;  2VMQ A;  3DR4 A;  4IYO A;  3BCX A;  3M5U A;  1AHE A;  1V2E A;  4K2B A;  1ARI A;  3WGC A;  4F5K A;  2NMP A;  5EIG B;  2HZP A;  1S07 A;  2C81 A;  2O0R A;  3D6K A;  7AAT A;  2EPJ A;  1KL2 A;  1TAR A;  1GD9 A;  3OP7 A;  4Y0H A;  4A0R A;  3BC8 A;  4ADD A;  4AO4 A;  4AH3 A;  1ASC A;  1D2F A;  4B9B A;  1X28 A;  1IAY A;  1AIB A;  2VIB A;  1ZOB A;  1KAF A;  2FQ6 A;  2R0T A;  3ASA A;  1EG5 A;  1RV4 A;  2CST A;  2BWO A;  1KMJ A;  3NYT A;  4GRX A;  1W23 A;  3T32 A;  4M2K A;  3GZD A;  1ARH A;  4WYG A;  4ATQ A;  1ORD A;  2OAT A;  3K40 A;  4IXO A;  1BQD A;  2E7J A;  4J5U A;  4ZDO A;  3L8A A;  5EUD A;  2ZP7 A;  3PA9 A;  4MQP A;  4RLG A;  1ASG A;  3CQ4 A;  3G0T A;  1YJY A;  3EZ1 A;  4H51 A;  3MAD A;  5EAA A;  1D7S A;  1C7N A;  1C7G A;  4TV7 A;  1M0N A;  2VGW A;  1J32 A;  4MKJ A;  1EQB A;  1I29 A;  5IWQ A;  1LK9 A;  1YIZ A;  3EI6 A;  2ZSM A;  3JTX A;  4LNJ A;  4Q76 A;  1Z3Z A;  2VGV A;  1X29 A;  1OHV A;  3E2Z A;  4ATP A;  1H1C A;  2BWN A;  3HLM A;  4XEW A;  3WCN A;  2FKI A;  4IXZ A;  1B8G A;  1IUG A;  4P3M A;  3CAI A;  1ARS A;  3ATH A;  1AHF A;  4R2N A;  2CTZ A;  3VAX A;  3NUB A;  2HUU A;  3BCB A;  4LNM A;  1M4N A;  3LG0 A;  5DX5 A;  2HUI A;  2WB6 A;  4ISY A;  4FL0 A;  5TF5 A;  3Q8N A;  1O61 A;  1YJS A;  3F6T A;  2ZY3 A;  1LC8 A;  1SVV A;  3NU7 A;  3QN6 A;  1B5O A;  1J04 A;  2BYL A;  3UE8 A;  1UU2 A;  2YKV A;  4ZWV A;  4M2J A;  3RCH B;  5LH9 A;  2KFP A;  4I8A A;  2C44 A;  2VMN A;  3E2Y A;  4JEW A;  3B1E A;  1ART A;  4WD2 A;  4JE5 A;  1E5E A;  3G8M A;  3VK2 A;  2ZYJ A;  4W8I A;  3WGB A;  3NDN A;  2OGA A;  1B4X A;  1AY4 A;  3PPL A;  4EU1 A;  1DFO A;  3E6G A;  1S0A A;  4FFC A;  3AAT A;  3LVK A;  4ITG A;  1GDE A;  4H63 Q;  1ASL A;  3PGY A;  5HHY A;  3KKI A;  2E7U A;  2VMU A;  1AIA A;  2Z9V A;  4IXS A;  4WYC A;  2EZ1 A;  1OXO A;  1WKH A;  3FD0 A;  2F8J A;  4WYE A;  1JS6 A;  4W5K A;  2AY5 A;  2W7M A;  3PJ0 A;  2Z1Y A;  5HXX A;  2HP1 A;  1TAS A;  3LY1 A;  3FKD A;  5G4J A;  1AJS B;  3ECD A;  3PIU A;  1M6S A;  1WYU B;  1ZC9 A;  2G6W A;  3N5M A;  2EO5 A;  2VLF A;  2D65 A;  1GEW A;  3ISL A;  4Q31 A;  1BW0 A;  3FZ8 A;  2CJG A;  1Y4I A;  3TQX A;  4MSO A;  2CFB A;  2Z9X A;  2YRI A;  1IAX A;  2PO3 A;  1IVR A;  3QM2 A;  2V0Y A;  5I92 A;  1BJO A;  2BI9 A;  3TFT A;  2AY6 A;  3B8X A;  4DQ6 A;  1TOJ A;  2BYJ A;  1MLY A;  3I5T A;  2W7I A;  4EFF A;  1Z7D A;  2PB2 A;  4OBU A;  2OKK A;  3BCA A;  4KYO A;  3R4T A;  2A1V A;  2PB0 A;  1O69 A;  3ELP A;  1C4K A;  1LC5 A;  1X2A A;  3WCO A;  3MC6 A;  1AKC A;  1S06 A;  3QGU A;  4GE4 A;  4XQ2 A;  3USF A;  4A6U A;  4W1V A;  2JJE A;  3JZL A;  1PMO A;  2VLH A;  3JU7 A;  3AEJ C;  1S09 A;  3I4J A;  4BA4 A;  8AAT A;  2BHX A;  4UHN A;  2WKA A;  3FVU A;  5JAY A;  2VMZ A;  3N4S A;  1ZOD A;  1OHY A;  1YAA A;  5DJ9 A;  3AEM C;  3PD6 B;  4F4E A;  1QZ9 A;  3F0H A;  2R5E A;  4Y0I A;  3VP6 A;  4UHO A;  1TAT A; 
#chains in the Genus database with same CATH homology
 3FVX A;  2EGY A;  4ZSW A;  1ASF A;  4XJM A;  5G4I A;  1GC2 A;  4ZAH A;  2WK7 A;  3MAF B;  4J8L A;  1KMK A;  2OKJ A;  1EJI A;  3E2F A;  2CAN A;  4WB0 B;  1DGE A;  3BWN A;  1RVY A;  4A6T A;  1IX8 A;  5EUE A;  3WZF A;  2CB1 A;  4MQR A;  3QHX A;  2VI8 A;  4QGR A;  3W1J A;  2W7J A;  1TOK A;  4CVQ A;  2W8V A;  3DXV A;  3EI7 A;  3FZ7 A;  1OXP A;  2FYF A;  1AJR A;  3DRD A;  1M32 A;  4RAE A;  5K8B A;  2VGZ A;  4RKD A;  1PFF A;  4F5M A;  1BJN A;  4W91 A;  2ZY2 A;  5BJ4 A;  1MDO A;  3L44 A;  1AMA A;  1KL1 A;  2AY2 A;  5M46 A;  2DR1 A;  2CH2 A;  3ELE A;  4RKC A;  4BA5 A;  5G0A A;  4JEX A;  5E4Z A;  1IX7 A;  3R9A A;  4OTL A;  1YIY A;  3GET A;  3I16 A;  4KAM A;  5EQC A;  4GDY A;  4R5Z A;  4ITX A;  2AEU A;  1CL2 A;  3BN1 A;  4GE7 A;  4IX8 A;  3BWO A;  3G7Q A;  4R5F A;  4DBC A;  1MGV A;  1CL1 A;  4WYF A;  1CS1 A;  1VEF A;  1JF9 A;  1AHX A;  1TPL A;  3WLX A;  3CBF A;  3E77 A;  5EAV A;  1GEX A;  1W7N A;  2GSA A;  4O6Z A;  4A00 A;  4N0B A;  1ECX A;  2VGS A;  2ZY5 A;  1WST A;  3MBB A;  1BT4 A;  3HQT A;  2EYQ A;  2BI2 A;  2GMU A;  3FFH A;  1ASA A;  3AOV A;  2G7J A;  2RFV A;  3B1D A;  3ZZJ A;  5D5S A;  1LW4 A;  3MKJ A;  3ZZK A;  2YRR A;  4GE9 A;  2YOB A;  3FVS A;  3LWS A;  2FN6 A;  2R2N A;  4TMR A;  5G09 A;  4A72 A;  2AY4 A;  2Z61 A;  2D64 A;  2W7F A;  4E77 A;  3KGX A;  4LC3 A;  2VMR A;  2VMV A;  2BWP A;  1SF2 A;  1U08 A;  2QMA A;  1AIC A;  1MDZ A;  3IHJ A;  1G7X A;  1V2D A;  4XJO A;  1SFF A;  1ASD A;  1IBJ A;  3A9Y A;  2ZC0 A;  1PG8 A;  2JG2 A;  3LVJ A;  4WYD A;  3RCH A;  1YJZ A;  4RM1 A;  1AY5 A;  3ZRR A;  1LKC A;  4U1T A;  2VMY A;  3QPG A;  1M0O A;  1LW5 A;  1G4V A;  3GZC A;  3GR9 A;  3QBO A;  1BS0 A;  3OKS A;  1BJW A;  4Q6R A;  1WYV B;  4MQQ A;  4UHM A;  2GB3 A;  5DJ1 A;  4AOA A;  3N7N A;  1W3U A;  1QJ5 A;  3W1H A;  3N75 A;  1GCK A;  3NYS A;  1I41 A;  3EI5 A;  3JW9 A;  4ZSY A;  3A8U X;  1QIR A;  4WYA A;  1TOI A;  4A0F A;  1BJ4 A;  2BIA A;  1GC4 A;  1JS3 A;  1GC3 A;  2W7G A;  3K28 A;  3LVM A;  3FDD A;  3KGW A;  3WKR A;  4E3Q A;  3A2B A;  2R5C B;  1O4S A;  4OT8 A;  2YKY A;  3VK3 A;  4F5F A;  4OYT A;  2W7L A;  1ASB A;  5FT6 A;  1FC4 A;  1AY8 A;  1QIS A;  1WYU A;  5EUN A;  1CQ7 A;  1AX4 A;  1WKG A;  4AZK A;  4CXQ A;  1DTY A;  2D7Z A;  2QB2 A;  3JWA A;  3FQA A;  3BB8 A;  5DB5 A;  4CXR A;  3CQ6 A;  3TCM A;  3BS8 A;  1AKB A;  4K05 A;  4GEB A;  2VMW A;  2W8U A;  1C9C A;  2W8W A;  1B9H A;  3B1C A;  1CZE A;  1AMR A;  3FQ7 A;  5FT4 A;  2VMT A;  1RVU A;  4XJP A;  2V1P A;  5BJ3 A;  2QB3 A;  3HMU A;  4JEY A;  4ADB A;  4IW7 A;  1SZK A;  1LS3 A;  4U2H A;  2X5F A;  3EIB A;  3WX9 A;  4RIT A;  4OMA A;  1AMQ A;  1CQ6 A;  3GWP A;  4ZWM A;  2HUF A;  2AY9 A;  2DKJ A;  2E54 A;  2W8J A;  2YKX A;  3HVY A;  1KKJ A;  2FNU A;  1P3W A;  2YCT A;  4JEZ A;  3VK4 A;  3N4R A;  2AY8 A;  5KTB A;  3GZD C;  4OCA A;  1S08 A;  2CJD A;  1UKJ A;  3RBL A;  2E7I A;  2JJF A;  1M0P A;  1TOE A;  2DGL A;  2Z9U A;  1WYT B;  3IF2 A;  4PFN A;  2X3L A;  2W7D A;  2TPL A;  3TAT A;  2EZ2 A;  2HP2 A;  3PD6 A;  4PIW A;  1E5F A;  2DOU A;  1DJU A;  2JIS A;  3NYU A;  1D7U A;  5LHA A;  2VGU A;  3H14 A;  3AEN B;  2BKW A;  3BV0 A;  2FM1 A;  2O1B A;  4R8D A;  4F5H A;  5M4D A;  1GC0 A;  3MAF A;  3PDB B;  4JEV A;  2AY1 A;  5F8V A;  4WB0 A;  2CY8 A;  3AEP A;  4OBV A;  1V72 A;  4WLJ A;  4PVF A;  5EIG A;  5G2Q A;  2Z67 A;  2AY3 A;  3NNK A;  3NU8 A;  4RJ0 A;  3NUI A;  4WXG A;  3ZRP A;  4WXB A;  2BI3 A;  3RQ1 A;  2X5D A;  2DGK A;  2HOZ A;  3B46 A;  4W1X A;  5F9S A;  2ZUK A;  4OC9 A;  2VIA A;  1AHG A;  1XI9 A;  4XJL A;  5FT8 A;  4F5I A;  4ZAS A;  4WBT A;  2OQX A;  3WY7 A;  2W7E A;  2AEV A;  2W8T A;  4E3R A;  2VGT A;  3HT4 A;  2O7C A;  2BI5 A;  4IYO B;  1AAW A;  3A9X A;  4RIZ A;  1XEY A;  2AAT A;  1QGN A;  5AX8 A;  1M7Y A;  1N8P A;  4IY7 A;  4WLH A;  2YHK A;  3F9T A;  1SZU A;  3FTB A;  3P6K A;  2VMO A;  2QA3 A;  3DC1 A;  1KKP A;  4HF8 A;  4M2M A;  9AAT A;  1MAQ A;  4CBR A;  1ASE A;  1MAP A;  2FNI A;  1LC7 A;  1C0N A;  4B98 A;  3AEJ A;  5M4B A;  4KXK A;  2W7K A;  2XBN A;  4LW2 A;  1G7W A;  3DU4 A;  3DYD A;  1ELU A;  1VJO A;  1I43 A;  2ORD A;  4W1W A;  4A6R A;  1ASN A;  1G4X A;  2D61 A;  3EUC A;  3II0 A;  3UAK A;  4ADE A;  4AZJ A;  1V2F A;  1YOO A;  2HOY A;  3TFU A;  4ZM4 A;  5EFS A;  3AEM A;  1UU0 A;  3FCR A;  3KE3 A;  4HVK A;  3P1T A;  4F5G A;  3AV7 A;  1DGD A;  4PFF A;  4ADC A;  1AAM A;  1AKA A;  3DR7 A;  3DXW A;  3E9K A;  2YCP A;  3EI8 A;  2D66 A;  4ZDP A;  2XH1 A;  2VMP A;  2CIN A;  1GEY A;  3E2Z B;  3LVL B;  4K2I A;  1D7V A;  2JJG A;  3ASB A;  2D7Y A;  2VMS A;  3ACZ A;  1W7L A;  4UQV A;  4DGT A;  3RBF A;  5HDM A;  1AMS A;  1DJE A;  4L0O A;  1CZC A;  5FT5 A;  2QBT A;  3MC6 C;  4N0W A;  2QLR A;  1IJI A;  2VMX A;  1B9I A;  1WYV A;  4F5L A;  1O62 A;  1GBN A;  4JF0 A;  3EIA A;  4LW4 A;  2QSR A;  3W1I A;  1ASM A;  1YNU A;  2BIE A;  2BI1 A;  2WK9 A;  4Q75 A;  2YCN A;  3AOW A;  3K7Y A;  4UOY A;  1JG8 A;  2D63 A;  3PAA A;  4K2M A;  2Z9W A;  1AJS A;  2YKU A;  2R5C A;  2ZJG A;  2GQN A;  1PMM A;  3FZ6 A;  2DKB A;  3HDO A;  3N0L A;  3NRA A;  4MY5 A;  3DZZ A;  4LNL A;  1T3I A;  1N31 A;  4RJY A;  3HL2 A;  1QIT A;  3FRK A;  4EB7 A;  1B5P A;  2EH6 A;  2OGE A;  3WKS A;  4F5J A;  1OHW A;  3A9Z A;  3BWN C;  4GSA A;  1W7M A;  2Z1Z A;  1FG7 A;  1CQ8 A;  5E3K A;  4ZLV A;  1VP4 A;  2DGM A;  3COG A;  3QI6 A;  3RUY A;  2AY7 A;  3EZS A;  2CH1 A;  3PDX A;  3VOM A;  3FSL A;  1DJ9 A;  4BMK A;  4XAU A;  3RI6 A;  3GJU A;  2WK8 A;  2BIG A;  2Q7W A;  2GMS A;  2JGT A;  1CJ0 A;  3UWC A;  5G2P A;  2Z20 A;  3NTJ A;  2C0R A;  4WP0 A;  2ZSL A;  1BJO B;  4P7Y A;  3AEO A;  5D95 A;  4EB5 A;  1H0C A;  1UU1 A;  4XK1 A;  4MKK A;  3N4X A;  3FDB A;  3GBX A;  4A0G A;  1OAT A;  4JE5 D;  2D5Y A;  1MDX A;  4ZDL A;  1IX6 A;  1C7O A;  1WYT A;  1DKA A;  1X0M A;  3ZRQ A;  4ZM3 A;  2ZY4 A;  3NX3 A;  4MGR A;  2W7H A;  1N2T A;  1FG3 A;  3FQ8 A;  3FFR A;  2HOR A;  1BKG A;  2VI9 A;  1ELQ A;  3MEB A;  4BHD A;  1TOG A;  3AEN A;  4WXF A;  2C7T A;  2CJH A;  3PDB A;  1SPA A;  4CBS A;  1M0Q A;  1MLZ A;  3H9X A;  4NOG A;  1D7R A;  1SZS A;  3GSB A;  5C6U A;  3JWB A;  3MAU A;  3HBX A;  4JF1 A;  5J8Q A;  4BQ0 A;  2JJH A;  3EI9 A;  3H7F A;  4TN4 A;  3CQ5 A;  1BQA A;  4A0H A;  2HOX A;  1QJ3 A;  1ARG A;  1I48 A;  5M49 A;  4E1O A;  5E5I A;  3AEL A;  3LV2 A;  4EMY A;  4Y0D A;  2VYC A;  3DOD A;  2X8U A;  1AHY A;  1RV3 A;  4AO9 A;  2VMQ A;  3DR4 A;  4IYO A;  3BCX A;  3M5U A;  1AHE A;  1V2E A;  4K2B A;  1ARI A;  3WGC A;  4F5K A;  2NMP A;  5EIG B;  2HZP A;  1S07 A;  2C81 A;  2O0R A;  3D6K A;  7AAT A;  2EPJ A;  1KL2 A;  1TAR A;  1GD9 A;  3OP7 A;  4Y0H A;  4A0R A;  3BC8 A;  4ADD A;  4AO4 A;  4AH3 A;  1ASC A;  1D2F A;  4B9B A;  1X28 A;  1IAY A;  1AIB A;  2VIB A;  1ZOB A;  2FQ6 A;  2R0T A;  3ASA A;  1EG5 A;  1RV4 A;  2CST A;  2BWO A;  1KMJ A;  3NYT A;  4GRX A;  1W23 A;  3T32 A;  4M2K A;  3GZD A;  1ARH A;  4WYG A;  4ATQ A;  1ORD A;  2OAT A;  3K40 A;  4IXO A;  1BQD A;  2E7J A;  4J5U A;  4ZDO A;  3L8A A;  5EUD A;  2ZP7 A;  3PA9 A;  4MQP A;  4RLG A;  1ASG A;  3CQ4 A;  3G0T A;  1YJY A;  3EZ1 A;  4H51 A;  3MAD A;  5EAA A;  1D7S A;  1C7N A;  1C7G A;  4TV7 A;  1M0N A;  2VGW A;  1J32 A;  4MKJ A;  1EQB A;  1I29 A;  5IWQ A;  1LK9 A;  1YIZ A;  3EI6 A;  2ZSM A;  3JTX A;  4LNJ A;  4Q76 A;  1Z3Z A;  2VGV A;  1X29 A;  1OHV A;  3E2Z A;  4ATP A;  1H1C A;  2BWN A;  3HLM A;  4XEW A;  3WCN A;  2FKI A;  4IXZ A;  1B8G A;  1IUG A;  4P3M A;  3CAI A;  1ARS A;  3ATH A;  1AHF A;  4R2N A;  2CTZ A;  3VAX A;  3NUB A;  2HUU A;  3BCB A;  4LNM A;  1M4N A;  3LG0 A;  5DX5 A;  2HUI A;  2WB6 A;  4ISY A;  4FL0 A;  5TF5 A;  3Q8N A;  1O61 A;  1YJS A;  3F6T A;  2ZY3 A;  1LC8 A;  1SVV A;  3NU7 A;  3QN6 A;  1B5O A;  1J04 A;  2BYL A;  3UE8 A;  1UU2 A;  2YKV A;  4ZWV A;  4M2J A;  3RCH B;  5LH9 A;  2KFP A;  4I8A A;  2C44 A;  2VMN A;  3E2Y A;  4JEW A;  3B1E A;  1ART A;  4WD2 A;  4JE5 A;  1E5E A;  3G8M A;  3VK2 A;  2ZYJ A;  4W8I A;  3WGB A;  3NDN A;  2OGA A;  1B4X A;  1AY4 A;  3PPL A;  4EU1 A;  1DFO A;  3E6G A;  1S0A A;  4FFC A;  3AAT A;  3LVK A;  4ITG A;  1GDE A;  4H63 Q;  1ASL A;  3PGY A;  5HHY A;  3KKI A;  2E7U A;  2VMU A;  1AIA A;  2Z9V A;  4IXS A;  4WYC A;  2EZ1 A;  1OXO A;  1WKH A;  3FD0 A;  2F8J A;  4WYE A;  1JS6 A;  4W5K A;  2AY5 A;  2W7M A;  3PJ0 A;  2Z1Y A;  5HXX A;  2HP1 A;  1TAS A;  3LY1 A;  3FKD A;  5G4J A;  1AJS B;  3ECD A;  3PIU A;  1M6S A;  1WYU B;  1ZC9 A;  2G6W A;  3N5M A;  2EO5 A;  2VLF A;  2D65 A;  1GEW A;  3ISL A;  4Q31 A;  1BW0 A;  3FZ8 A;  2CJG A;  1Y4I A;  3TQX A;  4MSO A;  2CFB A;  2Z9X A;  2YRI A;  1IAX A;  2PO3 A;  1IVR A;  3QM2 A;  2V0Y A;  5I92 A;  1BJO A;  2BI9 A;  3TFT A;  2AY6 A;  3B8X A;  4DQ6 A;  1TOJ A;  2BYJ A;  1MLY A;  3I5T A;  2W7I A;  4EFF A;  1Z7D A;  2PB2 A;  4OBU A;  2OKK A;  3BCA A;  4KYO A;  3R4T A;  2A1V A;  2PB0 A;  1O69 A;  3ELP A;  1C4K A;  1LC5 A;  1X2A A;  3WCO A;  3MC6 A;  1AKC A;  1S06 A;  3QGU A;  4GE4 A;  4XQ2 A;  3USF A;  4A6U A;  4W1V A;  2JJE A;  3JZL A;  1PMO A;  2VLH A;  3JU7 A;  3AEJ C;  1S09 A;  3I4J A;  4BA4 A;  8AAT A;  2BHX A;  4UHN A;  2WKA A;  3FVU A;  5JAY A;  2VMZ A;  3N4S A;  1ZOD A;  1OHY A;  1YAA A;  5DJ9 A;  3AEM C;  3PD6 B;  4F4E A;  1QZ9 A;  3F0H A;  2R5E A;  4Y0I A;  3VP6 A;  4UHO A;  1TAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...