4GE7A

Kynurenine aminotransferase ii inhibitors
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
427
Chain Sequence
b'MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNSGRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 140
structure length 427
sequence length 428
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ge7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ge7A03
2OKJA 1O61A 3DU4A 3PDBA 1AHFA 3E2ZB 2BI5A 3E9KA 1BJOB 2W7HA 4WXGA 5G0AA 1UKJA 2D5YA 4M2MA 4R5FA 3H7FA 3NUBA 3RQ1A 4UQVA 3AOVA 4ZDLA 3EIAA 1GC3A 3H14A 4GEBA 4XEWA 8AATA 1AMSA 1V72A 1CS1A 4XJLA 3OKSA 3COGA 4K2IA 2JJHA 3BWNC 4AO9A 2QLRA 1AMRA 5G2QA 3RBLA 5BJ3A 1ZC9A 2VLHA 1AY5A 2CFBA 2YKUA 1AKCA 4F5MA 1SZSA 5D5SA 3AENB 4DBCA 1TPLA 2BI3A 1KKPA 1ORDA 5EUEA 4F5HA 1C7NA 2NMPA 5AX8A 3FQAA 4UHOA 5E3KA 1LW4A 3D6KA 3PIUA 2X5FA 3PGYA 5G4JA 4PFFA 1ASCA 1ASMA 2BYLA 1EG5A 3UE8A 1AHGA 1ARHA 3Q8NA 3WCOA 5C6UA 3FQ7A 2JJEA 4JEVA 1H1CA 4WP0A 1U08A 1S06A 1Z3ZA 2W8VA 2WKAA 5IWQA 4ZDOA 2C7TA 1FG7A 2ZY2A 2D65A 5DJ9A 1B5PA 3W1JA 2HUUA 4DQ6A 3EI6A 3GZCA 4R2NA 4ADCA 3JWBA 3N5MA 1CJ0A 3NYSA 3TQXA 4LNJA 4WXFA 3FD0A 4ZM3A 2W8JA 1IAYA 2YKXA 1BS0A 1ZOBA 4RJ0A 1TOGA 3GZDA 1M7YA 4PIWA 1ARGA 2O0RA 4P3MA 1X0MA 3HLMA 1LK9A 3I16A 1QJ3A 4OCAA 1AHXA 1V2EA 2VMYA 2WK8A 1EQBA 4MSOA 2ZUKA 1GEXA 1TOEA 2EO5A 2VGSA 3LY1A 4RM1A 2DGLA 2D7ZA 1VP4A 3MC6A 3GJUA 4LNMA 2W7EA 3JZLA 3RI6A 2Z61A 2ZYJA 1SFFA 3FKDA 3GETA 3HMUA 4GRXA 4P7YA 4RJYA 1N8PA 2PB0A 4WB0B 2YCTA 2O7CA 3WZFA 2AEVA 1H0CA 2BWOA 2VIAA 3QGUA 1YAAA 3QM2A 4WYAA 1DJEA 3MKJA 1TARA 4GE7A 1V2FA 3TCMA 1GCKA 3AATA 3VK2A 3UWCA 4AOAA 2QB3A 3ELEA 2BIEA 4WBTA 1RV4A 1ELUA 3NYUA 2C0RA 3B1CA 4LW4A 3ZRRA 3NDNA 2GQNA 3PPLA 2FNUA 2BI2A 3K28A 5EAVA 3RBFA 1M0NA 4XAUA 4EMYA 1GC4A 4A0FA 1UU1A 4PFNA 3BC8A 3KGWA 4UHNA 1AY4A 2CSTA 1YJYA 3B1DA 1CQ6A 4QGRA 5JAYA 1ELQA 1PMMA 2VGZA 1LKCA 2OGAA 1ARIA 2CANA 3RUYA 4Q31A 4A0GA 2CINA 1M6SA 1XI9A 1MDXA 1AAWA 3R4TA 2CJDA 2W8WA 1M4NA 4OBVA 3E6GA 1BT4A 4BA4A 2E7IA 1ARTA 1SF2A 4GDYA 2ZC0A 4MQQA 3MADA 4R5ZA 2W7FA 1G7WA 3AEMA 5HHYA 4W91A 1QITA 3GSBA 2ZSMA 5M49A 1EJIA 1IX7A 2CY8A 3GBXA 3QI6A 4NOGA 4U2HA 1WYTA 2HOZA 2R5CA 3CQ6A 3JU7A 5K8BA 1RVUA 2YCPA 2D64A 2VMNA 2VGTA 4CXRA 3GWPA 2W8TA 1D7RA 2VMXA 3MAUA 5EUDA 1BJNA 1N31A 3T32A 4CBRA 4ZWVA 5LH9A 1AJRA 3P1TA 3VAXA 4WYEA 4A00A 1D7UA 1AJSA 3VP6A 1AHYA 3AEPA 2HOYA 5F9SA 1C7OA 4H51A 3JW9A 4FFCA 4OYTA 5TF5A 3DXVA 1ASFA 1MLZA 2WK7A 5M4BA 4CXQA 3WKRA 4UHMA 4XJPA 1G7XA 2AY2A 1GDEA 3F9TA 3FZ8A 4W1XA 3E2ZA 4F5JA 2YKYA 1OHVA 3N75A 4E3RA 1AAMA 4WLJA 2DGMA 3A9ZA 3KGXA 2EPJA 3ZRPA 3GZDC 5E5IA 3LVKA 2FN6A 1LC8A 1BKGA 2EZ2A 2R0TA 3W1HA 1B8GA 3CQ5A 2JISA 4BA5A 4IY7A 2AY8A 4OC9A 2CJHA 2GMUA 4JF0A 2X3LA 3OP7A 1AIAA 4RKCA 2AY1A 1TOKA 1CZEA 4WLHA 3HBXA 3ATHA 2FQ6A 5FT5A 4ISYA 3FZ6A 3ZZJA 1UU2A 3A9YA 1X28A 3F0HA 4WD2A 1AY8A 1IX6A 3NU8A 3TFUA 1BJ4A 1AIBA 2D61A 4W1VA 1GC2A 2G6WA 1JS6A 5EUNA 2D66A 1C4KA 2YRIA 1IJIA 3EZ1A 3AEJC 1S09A 3FVSA 2HUFA 2Z9VA 4ATQA 1WYVA 4RITA 4GSAA 1SPAA 2OQXA 5FT6A 5M4DA 4L0OA 2BIGA 1Y4IA 4OTLA 3B1EA 4BMKA 3CAIA 3FDDA 2ZY3A 3QPGA 5G2PA 2HUIA 3II0A 2BWPA 3FDBA 3NNKA 2W7MA 1W3UA 4N0BA 1O69A 1SVVA 1I48A 3VOMA 3WX9A 4B98A 2AY9A 2BHXA 4ATPA 1DGDA 2YKVA 2W8UA 1ASAA 2CH2A 4K2BA 1JG8A 2VMVA 2VMOA 2HORA 1DGEA 3KKIA 2BWNA 2Z1YA 5F8VA 2VMSA 1DKAA 3RCHA 2ZY4A 1JF9A 4W5KA 1TOIA 3VK3A 5M46A 1OXPA 4ITGA 1DFOA 1SZKA 3FFRA 3LWSA 4J8LA 1C0NA 4Y0DA 3WKSA 2QMAA 3LVJA 2HP1A 4IW7A 4MKKA 2W7GA 1FC4A 4IYOA 4WB0A 2VI9A 2VYCA 4MQPA 2AY3A 2BKWA 1X2AA 3DR4A 5G4IA 4O6ZA 4OMAA 1WYUA 1BQAA 4ADEA 2Q7WA 3ELPA 1Z7DA 2FM1A 3BWOA 4Y0HA 1AKAA 2YRRA 2D63A 1G4XA 1VJOA 5J8QA 4ZASA 3FCRA 1D7SA 4XQ2A 2GMSA 2R2NA 4AZJA 1QIRA 2DKBA 2VMQA 2Z9WA 4MY5A 1KMKA 4K2MA 3NUIA 2Z1ZA 4CBSA 3LV2A 3AOWA 1DTYA 1OHYA 1OXOA 1CQ8A 5EIGA 4TMRA 3WGCA 3ASBA 4MQRA 1CZCA 1XEYA 3K40A 1AMQA 3P6KA 4JEYA 4WYFA 2OGEA 5HXXA 3ISLA 1IAXA 4M2JA 3BN1A 5LHAA 2CH1A 2VMPA 4F5IA 1LW5A 3DRDA 1GEWA 4EB5A 1O4SA 1O62A 5BJ4A 4LC3A 3F6TA 3L8AA 1RVYA 1TASA 1JS3A 3PAAA 1UU0A 2VGWA 3MAFB 1AICA 7AATA 3AELA 1QJ5A 3N0LA 1TOJA 2JJGA 2YCNA 2BI9A 4Q6RA 5DB5A 4BQ0A 2VIBA 4ZSWA 2O1BA 1YIYA 3BB8A 1B9HA 2X8UA 2W7JA 3B46A 1S07A 4EB7A 4RKDA 3W1IA 2XBNA 4IXOA 1GC0A 2C81A 1M0PA 2C44A 4XJMA 1DJ9A 2ORDA 2JJFA 2E7JA 3EI9A 4PVFA 1T3IA 1ZODA 4B9BA 1ASBA 1IUGA 5E4ZA 3I4JA 1GEYA 3FFHA 2AY5A 1S0AA 3JWAA 2DR1A 9AATA 1MGVA 4JEZA 2X5DA 4MGRA 4IXZA 5HDMA 5DJ1A 4ZWMA 3NRAA 1WSTA 4XK1A 4A6TA 2TPLA 3M5UA 4XJOA 4A72A 2QBTA 1X29A 3FVXA 1BJOA 3PD6B 1D2FA 4A6RA 1E5EA 1M0QA 3G8MA 1GBNA 4ZSYA 1WKHA 1YJSA 4KXKA 1B5OA 1KMJA 3BV0A 1I41A 1CL1A 3NU7A 4WYDA 3PDXA 4LNLA 3MBBA 1AJSB 1WKGA 4FL0A 2RFVA 3HVYA 2V0YA 3ACZA 2JG2A 2EGYA 2VGVA 1C9CA 3AENA 4JE5A 1P3WA 3MC6C 3PDBB 1IBJA 4N0WA 1YOOA 4F5LA 3LVMA 1FG3A 3DZZA 3FRKA 1QZ9A 3E2FA 3PA9A 4TN4A 5I92A 2XH1A 2HOXA 3PJ0A 4ADBA 1MAPA 3NX3A 3NYTA 2W7KA 3USFA 2PB2A 1W23A 1ASGA 4GE4A 3IF2A 4OBUA 5FT4A 2W7IA 2Z9UA 3CQ4A 1W7LA 2DKJA 1RV3A 3QHXA 4Y0IA 2R5EA 3UAKA 3FVUA 4IX8A 1M32A 2CJGA 2FNIA 1ASEA 2Z67A 2GSAA 1ARSA 1CQ7A 1YIZA 1W7MA 3FSLA 4BHDA 2E54A 3FZ7A 3ZRQA 3NTJA 1LC7A 1J04A 3L44A 1LC5A 1MDOA 3JTXA 2VGUA 3ASAA 1QGNA 2GB3A 1ASLA 4LW2A 1IVRA 1AKBA 3DXWA 2VI8A 2CB1A 2E7UA 3EI8A 1B4XA 3WGBA 1BJWA 3QBOA 3WCNA 3TFTA 4U1TA 1WYVB 2VMUA 2BIAA 2VMTA 3FQ8A 1OATA 1S08A 3HL2A 1KL2A 2QA3A 3BCBA 2HZPA 3EUCA 2W7DA 4A0RA 2VMRA 1ASDA 3AEMC 1KL1A 3EIBA 4UOYA 2CTZA 3BWNA 4RLGA 4JE5D 4AH3A 2D7YA 4RAEA 4ZDPA 4A6UA 4ZM4A 3EI5A 3A2BA 1G4VA 2VMZA 4ITXA 3RCHB 3EI7A 1YJZA 3HDOA 2BI1A 3HQTA 4F5GA 3IHJA 1VEFA 1B9IA 1ECXA 1I43A 4IYOB 4ZAHA 3WLXA 4ZLVA 4A0HA 1DJUA 4Q75A 1J32A 1WYUB 4ADDA 4F4EA 2AATA 2AY6A 1OHWA 3AEJA 4J5UA 4R8DA 4DGTA 4JEXA 2DOUA 3MEBA 4F5FA 1KKJA 3FTBA 2ZY5A 5DX5A 2V1PA 2FYFA 3ZZKA 3MAFA 2QB2A 2AEUA 5FT8A 1IX8A 1CL2A 5EQCA 2JGTA 4Q76A 1ASNA 4RIZA 3DYDA 3E2YA 4AO4A 4HVKA 1MAQA 1MLYA 3DODA 3BCAA 5EIGB 2AY4A 3K7YA 4W8IA 1QISA 3G7QA 2HP2A 4TV7A 4W1WA 1V2DA 2EH6A 3B8XA 3VK4A 1AHEA 2OATA 3KE3A 4OT8A 1N2TA 4IXSA 1D7VA 4KYOA 4E3QA 1E5FA 1TATA 3LG0A 4F5KA 4AZKA 1AMAA 4KAMA 2OKKA 5D95A 1SZUA 1AX4A 4GE9A 1MDZA 3DC1A 3LVLB 2ZSLA 3WY7A 1GD9A 3EZSA 3HT4A 4MKJA 1M0OA 2Z9XA 3BS8A 1W7NA 3A8UX 4JEWA 2W7LA 3QN6A 5EFSA 2VMWA 1BQDA 1PMOA 3ECDA 1LS3A 2DGKA 4HF8A 3BCXA 3AV7A 2VLFA 3R9AA 4I8AA 1WYTB 1PFFA 2F8JA 2PO3A 2R5CB 2YOBA 3G0TA 2Z20A 4JF1A 4EFFA 4WXBA 3DR7A 3PD6A 4EU1A 1PG8A 1I29A 2BYJA 2EZ1A 2WK9A 3A9XA 4CVQA 2AY7A 5G09A 3CBFA 1C7GA 1BW0A 2ZP7A 3E77A 1YNUA 2ZJGA 3AEOA 3GR9A 4E77A 5EAAA 2YHKA 4M2KA 4E1OA 4WYCA 3I5TA 3TATA 4WYGA
chains in the Genus database with same CATH superfamily
2OKJA 1O61A 3DU4A 3PDBA 1AHFA 3E2ZB 2BI5A 3E9KA 1BJOB 2W7HA 4WXGA 5G0AA 1UKJA 2D5YA 4M2MA 4R5FA 3H7FA 3NUBA 3RQ1A 4UQVA 3AOVA 4ZDLA 3EIAA 1GC3A 3H14A 4GEBA 4XEWA 8AATA 1AMSA 1V72A 1CS1A 4XJLA 3OKSA 3COGA 4K2IA 2JJHA 3BWNC 4AO9A 2QLRA 1AMRA 5G2QA 3RBLA 5BJ3A 1ZC9A 2VLHA 1AY5A 2CFBA 2YKUA 1AKCA 4F5MA 1SZSA 5D5SA 3AENB 4DBCA 1TPLA 2BI3A 1KKPA 1ORDA 5EUEA 4F5HA 1C7NA 2NMPA 5AX8A 3FQAA 4UHOA 5E3KA 3N7NA 1LW4A 3D6KA 3PIUA 2X5FA 3PGYA 5G4JA 4PFFA 1ASCA 1ASMA 2BYLA 1EG5A 3UE8A 1AHGA 1ARHA 3Q8NA 3WCOA 5C6UA 3FQ7A 2JJEA 4JEVA 1H1CA 4WP0A 1U08A 3N4XA 1S06A 1Z3ZA 2W8VA 2WKAA 5IWQA 4ZDOA 3N4RA 2C7TA 1FG7A 2ZY2A 2D65A 5DJ9A 1B5PA 3W1JA 2HUUA 4DQ6A 3EI6A 3GZCA 4R2NA 4ADCA 3JWBA 3N5MA 1CJ0A 3NYSA 3TQXA 4LNJA 4WXFA 3FD0A 4ZM3A 2W8JA 1IAYA 2YKXA 1BS0A 1ZOBA 4RJ0A 1TOGA 3GZDA 1M7YA 4PIWA 1ARGA 2O0RA 4P3MA 1X0MA 3HLMA 1LK9A 3I16A 1QJ3A 4OCAA 1AHXA 1V2EA 2VMYA 2WK8A 1EQBA 4MSOA 2ZUKA 1GEXA 1TOEA 2EO5A 2VGSA 3LY1A 4RM1A 2DGLA 2D7ZA 1VP4A 3MC6A 3GJUA 4H63Q 4LNMA 2W7EA 3JZLA 3RI6A 2Z61A 2ZYJA 1SFFA 3FKDA 3GETA 3HMUA 4GRXA 4P7YA 4RJYA 1N8PA 2PB0A 4WB0B 2YCTA 2O7CA 3WZFA 2AEVA 1H0CA 2BWOA 2VIAA 3QGUA 1YAAA 3QM2A 4WYAA 1DJEA 3MKJA 1TARA 4GE7A 1V2FA 3TCMA 1GCKA 3AATA 3VK2A 3UWCA 4AOAA 2QB3A 3ELEA 2BIEA 4WBTA 1RV4A 1ELUA 3NYUA 2C0RA 3B1CA 4LW4A 3ZRRA 3NDNA 2GQNA 3PPLA 2FNUA 2BI2A 3K28A 5EAVA 3RBFA 1M0NA 4XAUA 4EMYA 1GC4A 4A0FA 1UU1A 4PFNA 2G7JA 3BC8A 3KGWA 4UHNA 1AY4A 2CSTA 1YJYA 3B1DA 1CQ6A 4QGRA 5JAYA 1ELQA 1PMMA 2VGZA 1LKCA 2OGAA 1ARIA 2CANA 3RUYA 4Q31A 4A0GA 2CINA 1M6SA 2EYQA 1XI9A 1MDXA 1AAWA 3R4TA 2KFPA 2CJDA 2W8WA 1M4NA 4OBVA 3E6GA 1BT4A 4BA4A 2E7IA 1ARTA 1SF2A 4GDYA 2ZC0A 4MQQA 3MADA 4R5ZA 2W7FA 1G7WA 3AEMA 5HHYA 4W91A 1QITA 3GSBA 2ZSMA 5M49A 1EJIA 1IX7A 2CY8A 3GBXA 3QI6A 4NOGA 4U2HA 1WYTA 2HOZA 2R5CA 2A1VA 3CQ6A 3JU7A 5K8BA 1RVUA 2YCPA 2D64A 2VMNA 2VGTA 4CXRA 3GWPA 2W8TA 1D7RA 2VMXA 3MAUA 5EUDA 1BJNA 1N31A 3T32A 4CBRA 4ZWVA 5LH9A 1AJRA 3P1TA 3VAXA 2QSRA 4WYEA 4A00A 1D7UA 1AJSA 3VP6A 1AHYA 3AEPA 2HOYA 5F9SA 1C7OA 4H51A 3JW9A 4FFCA 4OYTA 5TF5A 3DXVA 1ASFA 1MLZA 2WK7A 5M4BA 4CXQA 3WKRA 4UHMA 4XJPA 1G7XA 2AY2A 1GDEA 3F9TA 3FZ8A 4W1XA 3E2ZA 4F5JA 2YKYA 1OHVA 3N75A 4E3RA 1AAMA 4WLJA 2DGMA 3A9ZA 3KGXA 2EPJA 3ZRPA 3GZDC 5E5IA 3LVKA 2FN6A 1LC8A 3N4SA 1BKGA 2EZ2A 2R0TA 3W1HA 1B8GA 3CQ5A 2JISA 4BA5A 4IY7A 2AY8A 4OC9A 2CJHA 2GMUA 4JF0A 2X3LA 3OP7A 1AIAA 4RKCA 2AY1A 1TOKA 1CZEA 4WLHA 3HBXA 3ATHA 2FQ6A 5FT5A 4ISYA 3FZ6A 3ZZJA 1UU2A 3A9YA 1X28A 3F0HA 4WD2A 1AY8A 1IX6A 3NU8A 3TFUA 1BJ4A 1AIBA 2D61A 4W1VA 4K05A 1GC2A 2G6WA 1JS6A 5EUNA 2D66A 1C4KA 2YRIA 1IJIA 3EZ1A 3AEJC 1S09A 3FVSA 2HUFA 5KTBA 2Z9VA 4ATQA 1WYVA 4RITA 4GSAA 1SPAA 2OQXA 5FT6A 5M4DA 4L0OA 2BIGA 1Y4IA 4OTLA 3B1EA 4BMKA 3CAIA 3FDDA 2ZY3A 3QPGA 5G2PA 2HUIA 3II0A 2BWPA 3FDBA 3NNKA 2W7MA 2WB6A 1W3UA 4N0BA 1O69A 1SVVA 1I48A 3VOMA 3WX9A 4B98A 2AY9A 2BHXA 4ATPA 1DGDA 2YKVA 2W8UA 1ASAA 2CH2A 4K2BA 1JG8A 2VMVA 2VMOA 2HORA 1DGEA 3KKIA 2BWNA 2Z1YA 5F8VA 2VMSA 1DKAA 3RCHA 1KAFA 2ZY4A 1JF9A 4W5KA 1TOIA 3VK3A 5M46A 1OXPA 4ITGA 1DFOA 1SZKA 3FFRA 3LWSA 4J8LA 1C0NA 4Y0DA 3WKSA 2QMAA 3LVJA 2HP1A 4IW7A 4MKKA 2W7GA 1FC4A 4IYOA 4WB0A 2VI9A 2VYCA 4MQPA 2AY3A 2BKWA 1X2AA 3DR4A 5G4IA 4O6ZA 4OMAA 1WYUA 1BQAA 4ADEA 2Q7WA 3ELPA 1Z7DA 2FM1A 3BWOA 4Y0HA 1AKAA 2YRRA 2D63A 1G4XA 1VJOA 5J8QA 4ZASA 3FCRA 1D7SA 4XQ2A 2GMSA 2R2NA 4AZJA 1QIRA 2DKBA 2VMQA 2Z9WA 4MY5A 1KMKA 4K2MA 3NUIA 2Z1ZA 4CBSA 3LV2A 3AOWA 1DTYA 1OHYA 1OXOA 1CQ8A 5EIGA 4TMRA 3WGCA 3ASBA 4MQRA 1CZCA 1XEYA 3K40A 1AMQA 3P6KA 4JEYA 4WYFA 2OGEA 5HXXA 3ISLA 1IAXA 4M2JA 3BN1A 5LHAA 2CH1A 2VMPA 4F5IA 1LW5A 3DRDA 1GEWA 4EB5A 1O4SA 1O62A 5BJ4A 4LC3A 3F6TA 3L8AA 1RVYA 1TASA 1JS3A 3PAAA 1UU0A 2VGWA 3MAFB 1AICA 7AATA 3AELA 1QJ5A 3N0LA 1TOJA 2JJGA 2YCNA 2BI9A 4Q6RA 5DB5A 4BQ0A 2VIBA 4ZSWA 2O1BA 1YIYA 3BB8A 1B9HA 2X8UA 2W7JA 3B46A 1S07A 4EB7A 4RKDA 3W1IA 2XBNA 4IXOA 1GC0A 2C81A 1M0PA 2C44A 4XJMA 1DJ9A 2ORDA 2JJFA 2E7JA 3EI9A 4PVFA 1T3IA 1ZODA 4B9BA 1ASBA 1IUGA 5E4ZA 3I4JA 1GEYA 3FFHA 2AY5A 1S0AA 3JWAA 2DR1A 9AATA 1MGVA 4JEZA 2X5DA 4MGRA 4IXZA 5HDMA 5DJ1A 4ZWMA 3NRAA 1WSTA 4XK1A 4A6TA 2TPLA 3M5UA 4XJOA 4A72A 2QBTA 1X29A 3FVXA 1BJOA 3PD6B 1D2FA 4A6RA 1E5EA 1M0QA 3G8MA 1GBNA 4ZSYA 1WKHA 1YJSA 4KXKA 1B5OA 1KMJA 3BV0A 1I41A 1CL1A 3NU7A 4WYDA 3PDXA 4LNLA 3MBBA 1AJSB 1WKGA 4FL0A 2RFVA 3HVYA 2V0YA 3ACZA 2JG2A 2EGYA 2VGVA 1C9CA 3AENA 4JE5A 1P3WA 3MC6C 3PDBB 1IBJA 4N0WA 1YOOA 4F5LA 3LVMA 1FG3A 3DZZA 3FRKA 1QZ9A 3E2FA 3PA9A 4TN4A 5I92A 2XH1A 2HOXA 3PJ0A 4ADBA 1MAPA 3NX3A 3NYTA 2W7KA 3USFA 2PB2A 1W23A 1ASGA 4GE4A 3IF2A 4OBUA 5FT4A 2W7IA 2Z9UA 3CQ4A 1W7LA 2DKJA 1RV3A 3QHXA 4Y0IA 2R5EA 3UAKA 3FVUA 4IX8A 1M32A 2CJGA 2FNIA 1ASEA 2Z67A 2GSAA 1ARSA 1CQ7A 1YIZA 1W7MA 3FSLA 4BHDA 2E54A 3FZ7A 3ZRQA 3NTJA 1LC7A 1J04A 3L44A 1LC5A 1MDOA 3JTXA 2VGUA 3ASAA 1QGNA 2GB3A 1ASLA 4LW2A 1IVRA 1AKBA 3DXWA 2VI8A 2CB1A 2E7UA 3EI8A 1B4XA 3WGBA 1BJWA 3QBOA 3WCNA 3TFTA 4U1TA 1WYVB 2VMUA 2BIAA 2VMTA 3FQ8A 1OATA 1S08A 3HL2A 1KL2A 2QA3A 3BCBA 2HZPA 3H9XA 3EUCA 2W7DA 4A0RA 2VMRA 1ASDA 3AEMC 1KL1A 3EIBA 4UOYA 2CTZA 3BWNA 4RLGA 4JE5D 4AH3A 2D7YA 4RAEA 4ZDPA 4A6UA 4ZM4A 3EI5A 3A2BA 1G4VA 2VMZA 4ITXA 3RCHB 3EI7A 1YJZA 3HDOA 2BI1A 3HQTA 4F5GA 3IHJA 1VEFA 1B9IA 1ECXA 1I43A 4IYOB 4ZAHA 3WLXA 4ZLVA 4A0HA 1DJUA 4Q75A 1J32A 1WYUB 4ADDA 4F4EA 2AATA 2AY6A 1OHWA 3AEJA 4J5UA 4R8DA 4DGTA 4JEXA 2DOUA 3MEBA 4F5FA 1KKJA 3FTBA 2ZY5A 5DX5A 2V1PA 2FYFA 3ZZKA 3MAFA 2QB2A 2AEUA 5FT8A 1IX8A 1CL2A 5EQCA 2JGTA 4Q76A 1ASNA 4RIZA 3DYDA 3E2YA 4AO4A 4HVKA 1MAQA 1MLYA 3DODA 3BCAA 5EIGB 2AY4A 3K7YA 4W8IA 1QISA 3G7QA 2HP2A 4TV7A 4W1WA 1V2DA 2EH6A 3B8XA 3VK4A 1AHEA 2OATA 3KE3A 4OT8A 1N2TA 2FKIA 4IXSA 1D7VA 4KYOA 4E3QA 1E5FA 1TATA 3LG0A 4F5KA 4AZKA 1AMAA 4KAMA 2OKKA 5D95A 1SZUA 1AX4A 4GE9A 1MDZA 3DC1A 3LVLB 2ZSLA 3WY7A 1GD9A 3EZSA 3HT4A 4MKJA 1M0OA 2Z9XA 3BS8A 1W7NA 3A8UX 4JEWA 2W7LA 3QN6A 5EFSA 2VMWA 1BQDA 1PMOA 3ECDA 1LS3A 2DGKA 4HF8A 3BCXA 3AV7A 2VLFA 3R9AA 4I8AA 1WYTB 1PFFA 2F8JA 2PO3A 2R5CB 2YOBA 3G0TA 2Z20A 4JF1A 4EFFA 4WXBA 3DR7A 3PD6A 4EU1A 1PG8A 1I29A 2BYJA 2EZ1A 2WK9A 3A9XA 4CVQA 2AY7A 5G09A 3CBFA 1C7GA 1BW0A 2ZP7A 3E77A 1YNUA 2ZJGA 3AEOA 3GR9A 4E77A 5EAAA 2YHKA 4M2KA 4E1OA 4WYCA 3I5TA 3TATA 4WYGA
chains in the Genus database with same CATH topology
2OKJA 1O61A 3DU4A 3PDBA 1AHFA 3E2ZB 2BI5A 3E9KA 1BJOB 2W7HA 4WXGA 5G0AA 1UKJA 2D5YA 4M2MA 4R5FA 3H7FA 3NUBA 3RQ1A 4UQVA 3AOVA 4ZDLA 3EIAA 1GC3A 3H14A 4GEBA 4XEWA 8AATA 1AMSA 1V72A 1CS1A 4XJLA 3OKSA 3COGA 4K2IA 2JJHA 3BWNC 4AO9A 2QLRA 1AMRA 5G2QA 3RBLA 5BJ3A 1ZC9A 2VLHA 1AY5A 2CFBA 2YKUA 1AKCA 4F5MA 1SZSA 5D5SA 3AENB 4DBCA 1TPLA 2BI3A 1KKPA 1ORDA 5EUEA 4F5HA 1C7NA 2NMPA 5AX8A 3FQAA 4UHOA 5E3KA 3N7NA 1LW4A 3D6KA 3PIUA 2X5FA 3PGYA 5G4JA 4PFFA 1ASCA 1ASMA 2BYLA 1EG5A 3UE8A 1AHGA 1ARHA 3Q8NA 3WCOA 5C6UA 3FQ7A 2JJEA 4JEVA 1H1CA 4WP0A 1U08A 3N4XA 1S06A 1Z3ZA 2W8VA 2WKAA 5IWQA 4ZDOA 3N4RA 2C7TA 1FG7A 2ZY2A 2D65A 5DJ9A 1B5PA 3W1JA 2HUUA 4DQ6A 3EI6A 3GZCA 4R2NA 4ADCA 3JWBA 3N5MA 1CJ0A 3NYSA 3TQXA 4LNJA 4WXFA 3FD0A 4ZM3A 2W8JA 1IAYA 2YKXA 1BS0A 1ZOBA 4RJ0A 1TOGA 3GZDA 1M7YA 4PIWA 1ARGA 2O0RA 4P3MA 1X0MA 3HLMA 1LK9A 3I16A 1QJ3A 4OCAA 1AHXA 1V2EA 2VMYA 2WK8A 1EQBA 4MSOA 2ZUKA 1GEXA 1TOEA 2EO5A 2VGSA 3LY1A 4RM1A 2DGLA 2D7ZA 1VP4A 3MC6A 3GJUA 4H63Q 4LNMA 2W7EA 3JZLA 3RI6A 2Z61A 2ZYJA 1SFFA 3FKDA 3GETA 3HMUA 4GRXA 4P7YA 4RJYA 1N8PA 2PB0A 4WB0B 2YCTA 2O7CA 3WZFA 2AEVA 1H0CA 2BWOA 2VIAA 3QGUA 1YAAA 3QM2A 4WYAA 1DJEA 3MKJA 1TARA 4GE7A 1V2FA 3TCMA 1GCKA 3AATA 3VK2A 3UWCA 4AOAA 2QB3A 3ELEA 2BIEA 4WBTA 1RV4A 1ELUA 3NYUA 2C0RA 3B1CA 4LW4A 3ZRRA 3NDNA 2GQNA 3PPLA 2FNUA 2BI2A 3K28A 5EAVA 3RBFA 1M0NA 4XAUA 4EMYA 1GC4A 4A0FA 1UU1A 4PFNA 2G7JA 3BC8A 3KGWA 4UHNA 1AY4A 2CSTA 1YJYA 3B1DA 1CQ6A 4QGRA 5JAYA 1ELQA 1PMMA 2VGZA 1LKCA 2OGAA 1ARIA 2CANA 3RUYA 4Q31A 4A0GA 2CINA 1M6SA 2EYQA 1XI9A 1MDXA 1AAWA 3R4TA 2KFPA 2CJDA 2W8WA 1M4NA 4OBVA 3E6GA 1BT4A 4BA4A 2E7IA 1ARTA 1SF2A 4GDYA 2ZC0A 4MQQA 3MADA 4R5ZA 2W7FA 1G7WA 3AEMA 5HHYA 4W91A 1QITA 3GSBA 2ZSMA 5M49A 1EJIA 1IX7A 2CY8A 3GBXA 3QI6A 4NOGA 4U2HA 1WYTA 2HOZA 2R5CA 2A1VA 3CQ6A 3JU7A 5K8BA 1RVUA 2YCPA 2D64A 2VMNA 2VGTA 4CXRA 3GWPA 2W8TA 1D7RA 2VMXA 3MAUA 5EUDA 1BJNA 1N31A 3T32A 4CBRA 4ZWVA 5LH9A 1AJRA 3P1TA 3VAXA 2QSRA 4WYEA 4A00A 1D7UA 1AJSA 3VP6A 1AHYA 3AEPA 2HOYA 5F9SA 1C7OA 4H51A 3JW9A 4FFCA 4OYTA 5TF5A 3DXVA 1ASFA 1MLZA 2WK7A 5M4BA 4CXQA 3WKRA 4UHMA 4XJPA 1G7XA 2AY2A 1GDEA 3F9TA 3FZ8A 4W1XA 3E2ZA 4F5JA 2YKYA 1OHVA 3N75A 4E3RA 1AAMA 4WLJA 2DGMA 3A9ZA 3KGXA 2EPJA 3ZRPA 3GZDC 5E5IA 3LVKA 2FN6A 1LC8A 3N4SA 1BKGA 2EZ2A 2R0TA 3W1HA 1B8GA 3CQ5A 2JISA 4BA5A 4IY7A 2AY8A 4OC9A 2CJHA 2GMUA 4JF0A 2X3LA 3OP7A 1AIAA 4RKCA 2AY1A 1TOKA 1CZEA 4WLHA 3HBXA 3ATHA 2FQ6A 5FT5A 4ISYA 3FZ6A 3ZZJA 1UU2A 3A9YA 1X28A 3F0HA 4WD2A 1AY8A 1IX6A 3NU8A 3TFUA 1BJ4A 1AIBA 2D61A 4W1VA 4K05A 1GC2A 2G6WA 1JS6A 5EUNA 2D66A 1C4KA 2YRIA 1IJIA 3EZ1A 3AEJC 1S09A 3FVSA 2HUFA 5KTBA 2Z9VA 4ATQA 1WYVA 4RITA 4GSAA 1SPAA 2OQXA 5FT6A 5M4DA 4L0OA 2BIGA 1Y4IA 4OTLA 3B1EA 4BMKA 3CAIA 3FDDA 2ZY3A 3QPGA 5G2PA 2HUIA 3II0A 2BWPA 3FDBA 3NNKA 2W7MA 2WB6A 1W3UA 4N0BA 1O69A 1SVVA 1I48A 3VOMA 3WX9A 4B98A 2AY9A 2BHXA 4ATPA 1DGDA 2YKVA 2W8UA 1ASAA 2CH2A 4K2BA 1JG8A 2VMVA 2VMOA 2HORA 1DGEA 3KKIA 2BWNA 2Z1YA 5F8VA 2VMSA 1DKAA 3RCHA 2ZY4A 1JF9A 4W5KA 1TOIA 3VK3A 5M46A 1OXPA 4ITGA 1DFOA 1SZKA 3FFRA 3LWSA 4J8LA 1C0NA 4Y0DA 3WKSA 2QMAA 3LVJA 2HP1A 4IW7A 4MKKA 2W7GA 1FC4A 4IYOA 4WB0A 2VI9A 2VYCA 4MQPA 2AY3A 2BKWA 1X2AA 3DR4A 5G4IA 4O6ZA 4OMAA 1WYUA 1BQAA 4ADEA 2Q7WA 3ELPA 1Z7DA 2FM1A 3BWOA 4Y0HA 1AKAA 2YRRA 2D63A 1G4XA 1VJOA 5J8QA 4ZASA 3FCRA 1D7SA 4XQ2A 2GMSA 2R2NA 4AZJA 1QIRA 2DKBA 2VMQA 2Z9WA 4MY5A 1KMKA 4K2MA 3NUIA 2Z1ZA 4CBSA 3LV2A 3AOWA 1DTYA 1OHYA 1OXOA 1CQ8A 5EIGA 4TMRA 3WGCA 3ASBA 4MQRA 1CZCA 1XEYA 3K40A 1AMQA 3P6KA 4JEYA 4WYFA 2OGEA 5HXXA 3ISLA 1IAXA 4M2JA 3BN1A 5LHAA 2CH1A 2VMPA 4F5IA 1LW5A 3DRDA 1GEWA 4EB5A 1O4SA 1O62A 5BJ4A 4LC3A 3F6TA 3L8AA 1RVYA 1TASA 1JS3A 3PAAA 1UU0A 2VGWA 3MAFB 1AICA 7AATA 3AELA 1QJ5A 3N0LA 1TOJA 2JJGA 2YCNA 2BI9A 4Q6RA 5DB5A 4BQ0A 2VIBA 4ZSWA 2O1BA 1YIYA 3BB8A 1B9HA 2X8UA 2W7JA 3B46A 1S07A 4EB7A 4RKDA 3W1IA 2XBNA 4IXOA 1GC0A 2C81A 1M0PA 2C44A 4XJMA 1DJ9A 2ORDA 2JJFA 2E7JA 3EI9A 4PVFA 1T3IA 1ZODA 4B9BA 1ASBA 1IUGA 5E4ZA 3I4JA 1GEYA 3FFHA 2AY5A 1S0AA 3JWAA 2DR1A 9AATA 1MGVA 4JEZA 2X5DA 4MGRA 4IXZA 5HDMA 5DJ1A 4ZWMA 3NRAA 1WSTA 4XK1A 4A6TA 2TPLA 3M5UA 4XJOA 4A72A 2QBTA 1X29A 3FVXA 1BJOA 3PD6B 1D2FA 4A6RA 1E5EA 1M0QA 3G8MA 1GBNA 4ZSYA 1WKHA 1YJSA 4KXKA 1B5OA 1KMJA 3BV0A 1I41A 1CL1A 3NU7A 4WYDA 3PDXA 4LNLA 3MBBA 1AJSB 1WKGA 4FL0A 2RFVA 3HVYA 2V0YA 3ACZA 2JG2A 2EGYA 2VGVA 1C9CA 3AENA 4JE5A 1P3WA 3MC6C 3PDBB 1IBJA 4N0WA 1YOOA 4F5LA 3LVMA 1FG3A 3DZZA 3FRKA 1QZ9A 3E2FA 3PA9A 4TN4A 5I92A 2XH1A 2HOXA 3PJ0A 4ADBA 1MAPA 3NX3A 3NYTA 2W7KA 3USFA 2PB2A 1W23A 1ASGA 4GE4A 3IF2A 4OBUA 5FT4A 2W7IA 2Z9UA 3CQ4A 1W7LA 2DKJA 1RV3A 3QHXA 4Y0IA 2R5EA 3UAKA 3FVUA 4IX8A 1M32A 2CJGA 2FNIA 1ASEA 2Z67A 2GSAA 1ARSA 1CQ7A 1YIZA 1W7MA 3FSLA 4BHDA 2E54A 3FZ7A 3ZRQA 3NTJA 1LC7A 1J04A 3L44A 1LC5A 1MDOA 3JTXA 2VGUA 3ASAA 1QGNA 2GB3A 1ASLA 4LW2A 1IVRA 1AKBA 3DXWA 2VI8A 2CB1A 2E7UA 3EI8A 1B4XA 3WGBA 1BJWA 3QBOA 3WCNA 3TFTA 4U1TA 1WYVB 2VMUA 2BIAA 2VMTA 3FQ8A 1OATA 1S08A 3HL2A 1KL2A 2QA3A 3BCBA 2HZPA 3H9XA 3EUCA 2W7DA 4A0RA 2VMRA 1ASDA 3AEMC 1KL1A 3EIBA 4UOYA 2CTZA 3BWNA 4RLGA 4JE5D 4AH3A 2D7YA 4RAEA 4ZDPA 4A6UA 4ZM4A 3EI5A 3A2BA 1G4VA 2VMZA 4ITXA 3RCHB 3EI7A 1YJZA 3HDOA 2BI1A 3HQTA 4F5GA 3IHJA 1VEFA 1B9IA 1ECXA 1I43A 4IYOB 4ZAHA 3WLXA 4ZLVA 4A0HA 1DJUA 4Q75A 1J32A 1WYUB 4ADDA 4F4EA 2AATA 2AY6A 1OHWA 3AEJA 4J5UA 4R8DA 4DGTA 4JEXA 2DOUA 3MEBA 4F5FA 1KKJA 3FTBA 2ZY5A 5DX5A 2V1PA 2FYFA 3ZZKA 3MAFA 2QB2A 2AEUA 5FT8A 1IX8A 1CL2A 5EQCA 2JGTA 4Q76A 1ASNA 4RIZA 3DYDA 3E2YA 4AO4A 4HVKA 1MAQA 1MLYA 3DODA 3BCAA 5EIGB 2AY4A 3K7YA 4W8IA 1QISA 3G7QA 2HP2A 4TV7A 4W1WA 1V2DA 2EH6A 3B8XA 3VK4A 1AHEA 2OATA 3KE3A 4OT8A 1N2TA 2FKIA 4IXSA 1D7VA 4KYOA 4E3QA 1E5FA 1TATA 3LG0A 4F5KA 4AZKA 1AMAA 4KAMA 2OKKA 5D95A 1SZUA 1AX4A 4GE9A 1MDZA 3DC1A 3LVLB 2ZSLA 3WY7A 1GD9A 3EZSA 3HT4A 4MKJA 1M0OA 2Z9XA 3BS8A 1W7NA 3A8UX 4JEWA 2W7LA 3QN6A 5EFSA 2VMWA 1BQDA 1PMOA 3ECDA 1LS3A 2DGKA 4HF8A 3BCXA 3AV7A 2VLFA 3R9AA 4I8AA 1WYTB 1PFFA 2F8JA 2PO3A 2R5CB 2YOBA 3G0TA 2Z20A 4JF1A 4EFFA 4WXBA 3DR7A 3PD6A 4EU1A 1PG8A 1I29A 2BYJA 2EZ1A 2WK9A 3A9XA 4CVQA 2AY7A 5G09A 3CBFA 1C7GA 1BW0A 2ZP7A 3E77A 1YNUA 2ZJGA 3AEOA 3GR9A 4E77A 5EAAA 2YHKA 4M2KA 4E1OA 4WYCA 3I5TA 3TATA 4WYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKJ A;  1O61 A;  3DU4 A;  3PDB A;  1AHF A;  3E2Z B;  2BI5 A;  3E9K A;  1BJO B;  2W7H A;  4WXG A;  5G0A A;  1UKJ A;  2D5Y A;  4M2M A;  4R5F A;  3H7F A;  3NUB A;  3RQ1 A;  4UQV A;  3AOV A;  4ZDL A;  3EIA A;  1GC3 A;  3H14 A;  4GEB A;  4XEW A;  8AAT A;  1AMS A;  1V72 A;  1CS1 A;  4XJL A;  3OKS A;  3COG A;  4K2I A;  2JJH A;  3BWN C;  4AO9 A;  2QLR A;  1AMR A;  5G2Q A;  3RBL A;  5BJ3 A;  1ZC9 A;  2VLH A;  1AY5 A;  2CFB A;  2YKU A;  1AKC A;  4F5M A;  1SZS A;  5D5S A;  3AEN B;  4DBC A;  1TPL A;  2BI3 A;  1KKP A;  1ORD A;  5EUE A;  4F5H A;  1C7N A;  2NMP A;  5AX8 A;  3FQA A;  4UHO A;  5E3K A;  1LW4 A;  3D6K A;  3PIU A;  2X5F A;  3PGY A;  5G4J A;  4PFF A;  1ASC A;  1ASM A;  2BYL A;  1EG5 A;  3UE8 A;  1AHG A;  1ARH A;  3Q8N A;  3WCO A;  5C6U A;  3FQ7 A;  2JJE A;  4JEV A;  1H1C A;  4WP0 A;  1U08 A;  1S06 A;  1Z3Z A;  2W8V A;  2WKA A;  5IWQ A;  4ZDO A;  2C7T A;  1FG7 A;  2ZY2 A;  2D65 A;  5DJ9 A;  1B5P A;  3W1J A;  2HUU A;  4DQ6 A;  3EI6 A;  3GZC A;  4R2N A;  4ADC A;  3JWB A;  3N5M A;  1CJ0 A;  3NYS A;  3TQX A;  4LNJ A;  4WXF A;  3FD0 A;  4ZM3 A;  2W8J A;  1IAY A;  2YKX A;  1BS0 A;  1ZOB A;  4RJ0 A;  1TOG A;  3GZD A;  1M7Y A;  4PIW A;  1ARG A;  2O0R A;  4P3M A;  1X0M A;  3HLM A;  1LK9 A;  3I16 A;  1QJ3 A;  4OCA A;  1AHX A;  1V2E A;  2VMY A;  2WK8 A;  1EQB A;  4MSO A;  2ZUK A;  1GEX A;  1TOE A;  2EO5 A;  2VGS A;  3LY1 A;  4RM1 A;  2DGL A;  2D7Z A;  1VP4 A;  3MC6 A;  3GJU A;  4LNM A;  2W7E A;  3JZL A;  3RI6 A;  2Z61 A;  2ZYJ A;  1SFF A;  3FKD A;  3GET A;  3HMU A;  4GRX A;  4P7Y A;  4RJY A;  1N8P A;  2PB0 A;  4WB0 B;  2YCT A;  2O7C A;  3WZF A;  2AEV A;  1H0C A;  2BWO A;  2VIA A;  3QGU A;  1YAA A;  3QM2 A;  4WYA A;  1DJE A;  3MKJ A;  1TAR A;  4GE7 A;  1V2F A;  3TCM A;  1GCK A;  3AAT A;  3VK2 A;  3UWC A;  4AOA A;  2QB3 A;  3ELE A;  2BIE A;  4WBT A;  1RV4 A;  1ELU A;  3NYU A;  2C0R A;  3B1C A;  4LW4 A;  3ZRR A;  3NDN A;  2GQN A;  3PPL A;  2FNU A;  2BI2 A;  3K28 A;  5EAV A;  3RBF A;  1M0N A;  4XAU A;  4EMY A;  1GC4 A;  4A0F A;  1UU1 A;  4PFN A;  3BC8 A;  3KGW A;  4UHN A;  1AY4 A;  2CST A;  1YJY A;  3B1D A;  1CQ6 A;  4QGR A;  5JAY A;  1ELQ A;  1PMM A;  2VGZ A;  1LKC A;  2OGA A;  1ARI A;  2CAN A;  3RUY A;  4Q31 A;  4A0G A;  2CIN A;  1M6S A;  1XI9 A;  1MDX A;  1AAW A;  3R4T A;  2CJD A;  2W8W A;  1M4N A;  4OBV A;  3E6G A;  1BT4 A;  4BA4 A;  2E7I A;  1ART A;  1SF2 A;  4GDY A;  2ZC0 A;  4MQQ A;  3MAD A;  4R5Z A;  2W7F A;  1G7W A;  3AEM A;  5HHY A;  4W91 A;  1QIT A;  3GSB A;  2ZSM A;  5M49 A;  1EJI A;  1IX7 A;  2CY8 A;  3GBX A;  3QI6 A;  4NOG A;  4U2H A;  1WYT A;  2HOZ A;  2R5C A;  3CQ6 A;  3JU7 A;  5K8B A;  1RVU A;  2YCP A;  2D64 A;  2VMN A;  2VGT A;  4CXR A;  3GWP A;  2W8T A;  1D7R A;  2VMX A;  3MAU A;  5EUD A;  1BJN A;  1N31 A;  3T32 A;  4CBR A;  4ZWV A;  5LH9 A;  1AJR A;  3P1T A;  3VAX A;  4WYE A;  4A00 A;  1D7U A;  1AJS A;  3VP6 A;  1AHY A;  3AEP A;  2HOY A;  5F9S A;  1C7O A;  4H51 A;  3JW9 A;  4FFC A;  4OYT A;  5TF5 A;  3DXV A;  1ASF A;  1MLZ A;  2WK7 A;  5M4B A;  4CXQ A;  3WKR A;  4UHM A;  4XJP A;  1G7X A;  2AY2 A;  1GDE A;  3F9T A;  3FZ8 A;  4W1X A;  3E2Z A;  4F5J A;  2YKY A;  1OHV A;  3N75 A;  4E3R A;  1AAM A;  4WLJ A;  2DGM A;  3A9Z A;  3KGX A;  2EPJ A;  3ZRP A;  3GZD C;  5E5I A;  3LVK A;  2FN6 A;  1LC8 A;  1BKG A;  2EZ2 A;  2R0T A;  3W1H A;  1B8G A;  3CQ5 A;  2JIS A;  4BA5 A;  4IY7 A;  2AY8 A;  4OC9 A;  2CJH A;  2GMU A;  4JF0 A;  2X3L A;  3OP7 A;  1AIA A;  4RKC A;  2AY1 A;  1TOK A;  1CZE A;  4WLH A;  3HBX A;  3ATH A;  2FQ6 A;  5FT5 A;  4ISY A;  3FZ6 A;  3ZZJ A;  1UU2 A;  3A9Y A;  1X28 A;  3F0H A;  4WD2 A;  1AY8 A;  1IX6 A;  3NU8 A;  3TFU A;  1BJ4 A;  1AIB A;  2D61 A;  4W1V A;  1GC2 A;  2G6W A;  1JS6 A;  5EUN A;  2D66 A;  1C4K A;  2YRI A;  1IJI A;  3EZ1 A;  3AEJ C;  1S09 A;  3FVS A;  2HUF A;  2Z9V A;  4ATQ A;  1WYV A;  4RIT A;  4GSA A;  1SPA A;  2OQX A;  5FT6 A;  5M4D A;  4L0O A;  2BIG A;  1Y4I A;  4OTL A;  3B1E A;  4BMK A;  3CAI A;  3FDD A;  2ZY3 A;  3QPG A;  5G2P A;  2HUI A;  3II0 A;  2BWP A;  3FDB A;  3NNK A;  2W7M A;  1W3U A;  4N0B A;  1O69 A;  1SVV A;  1I48 A;  3VOM A;  3WX9 A;  4B98 A;  2AY9 A;  2BHX A;  4ATP A;  1DGD A;  2YKV A;  2W8U A;  1ASA A;  2CH2 A;  4K2B A;  1JG8 A;  2VMV A;  2VMO A;  2HOR A;  1DGE A;  3KKI A;  2BWN A;  2Z1Y A;  5F8V A;  2VMS A;  1DKA A;  3RCH A;  2ZY4 A;  1JF9 A;  4W5K A;  1TOI A;  3VK3 A;  5M46 A;  1OXP A;  4ITG A;  1DFO A;  1SZK A;  3FFR A;  3LWS A;  4J8L A;  1C0N A;  4Y0D A;  3WKS A;  2QMA A;  3LVJ A;  2HP1 A;  4IW7 A;  4MKK A;  2W7G A;  1FC4 A;  4IYO A;  4WB0 A;  2VI9 A;  2VYC A;  4MQP A;  2AY3 A;  2BKW A;  1X2A A;  3DR4 A;  5G4I A;  4O6Z A;  4OMA A;  1WYU A;  1BQA A;  4ADE A;  2Q7W A;  3ELP A;  1Z7D A;  2FM1 A;  3BWO A;  4Y0H A;  1AKA A;  2YRR A;  2D63 A;  1G4X A;  1VJO A;  5J8Q A;  4ZAS A;  3FCR A;  1D7S A;  4XQ2 A;  2GMS A;  2R2N A;  4AZJ A;  1QIR A;  2DKB A;  2VMQ A;  2Z9W A;  4MY5 A;  1KMK A;  4K2M A;  3NUI A;  2Z1Z A;  4CBS A;  3LV2 A;  3AOW A;  1DTY A;  1OHY A;  1OXO A;  1CQ8 A;  5EIG A;  4TMR A;  3WGC A;  3ASB A;  4MQR A;  1CZC A;  1XEY A;  3K40 A;  1AMQ A;  3P6K A;  4JEY A;  4WYF A;  2OGE A;  5HXX A;  3ISL A;  1IAX A;  4M2J A;  3BN1 A;  5LHA A;  2CH1 A;  2VMP A;  4F5I A;  1LW5 A;  3DRD A;  1GEW A;  4EB5 A;  1O4S A;  1O62 A;  5BJ4 A;  4LC3 A;  3F6T A;  3L8A A;  1RVY A;  1TAS A;  1JS3 A;  3PAA A;  1UU0 A;  2VGW A;  3MAF B;  1AIC A;  7AAT A;  3AEL A;  1QJ5 A;  3N0L A;  1TOJ A;  2JJG A;  2YCN A;  2BI9 A;  4Q6R A;  5DB5 A;  4BQ0 A;  2VIB A;  4ZSW A;  2O1B A;  1YIY A;  3BB8 A;  1B9H A;  2X8U A;  2W7J A;  3B46 A;  1S07 A;  4EB7 A;  4RKD A;  3W1I A;  2XBN A;  4IXO A;  1GC0 A;  2C81 A;  1M0P A;  2C44 A;  4XJM A;  1DJ9 A;  2ORD A;  2JJF A;  2E7J A;  3EI9 A;  4PVF A;  1T3I A;  1ZOD A;  4B9B A;  1ASB A;  1IUG A;  5E4Z A;  3I4J A;  1GEY A;  3FFH A;  2AY5 A;  1S0A A;  3JWA A;  2DR1 A;  9AAT A;  1MGV A;  4JEZ A;  2X5D A;  4MGR A;  4IXZ A;  5HDM A;  5DJ1 A;  4ZWM A;  3NRA A;  1WST A;  4XK1 A;  4A6T A;  2TPL A;  3M5U A;  4XJO A;  4A72 A;  2QBT A;  1X29 A;  3FVX A;  1BJO A;  3PD6 B;  1D2F A;  4A6R A;  1E5E A;  1M0Q A;  3G8M A;  1GBN A;  4ZSY A;  1WKH A;  1YJS A;  4KXK A;  1B5O A;  1KMJ A;  3BV0 A;  1I41 A;  1CL1 A;  3NU7 A;  4WYD A;  3PDX A;  4LNL A;  3MBB A;  1AJS B;  1WKG A;  4FL0 A;  2RFV A;  3HVY A;  2V0Y A;  3ACZ A;  2JG2 A;  2EGY A;  2VGV A;  1C9C A;  3AEN A;  4JE5 A;  1P3W A;  3MC6 C;  3PDB B;  1IBJ A;  4N0W A;  1YOO A;  4F5L A;  3LVM A;  1FG3 A;  3DZZ A;  3FRK A;  1QZ9 A;  3E2F A;  3PA9 A;  4TN4 A;  5I92 A;  2XH1 A;  2HOX A;  3PJ0 A;  4ADB A;  1MAP A;  3NX3 A;  3NYT A;  2W7K A;  3USF A;  2PB2 A;  1W23 A;  1ASG A;  4GE4 A;  3IF2 A;  4OBU A;  5FT4 A;  2W7I A;  2Z9U A;  3CQ4 A;  1W7L A;  2DKJ A;  1RV3 A;  3QHX A;  4Y0I A;  2R5E A;  3UAK A;  3FVU A;  4IX8 A;  1M32 A;  2CJG A;  2FNI A;  1ASE A;  2Z67 A;  2GSA A;  1ARS A;  1CQ7 A;  1YIZ A;  1W7M A;  3FSL A;  4BHD A;  2E54 A;  3FZ7 A;  3ZRQ A;  3NTJ A;  1LC7 A;  1J04 A;  3L44 A;  1LC5 A;  1MDO A;  3JTX A;  2VGU A;  3ASA A;  1QGN A;  2GB3 A;  1ASL A;  4LW2 A;  1IVR A;  1AKB A;  3DXW A;  2VI8 A;  2CB1 A;  2E7U A;  3EI8 A;  1B4X A;  3WGB A;  1BJW A;  3QBO A;  3WCN A;  3TFT A;  4U1T A;  1WYV B;  2VMU A;  2BIA A;  2VMT A;  3FQ8 A;  1OAT A;  1S08 A;  3HL2 A;  1KL2 A;  2QA3 A;  3BCB A;  2HZP A;  3EUC A;  2W7D A;  4A0R A;  2VMR A;  1ASD A;  3AEM C;  1KL1 A;  3EIB A;  4UOY A;  2CTZ A;  3BWN A;  4RLG A;  4JE5 D;  4AH3 A;  2D7Y A;  4RAE A;  4ZDP A;  4A6U A;  4ZM4 A;  3EI5 A;  3A2B A;  1G4V A;  2VMZ A;  4ITX A;  3RCH B;  3EI7 A;  1YJZ A;  3HDO A;  2BI1 A;  3HQT A;  4F5G A;  3IHJ A;  1VEF A;  1B9I A;  1ECX A;  1I43 A;  4IYO B;  4ZAH A;  3WLX A;  4ZLV A;  4A0H A;  1DJU A;  4Q75 A;  1J32 A;  1WYU B;  4ADD A;  4F4E A;  2AAT A;  2AY6 A;  1OHW A;  3AEJ A;  4J5U A;  4R8D A;  4DGT A;  4JEX A;  2DOU A;  3MEB A;  4F5F A;  1KKJ A;  3FTB A;  2ZY5 A;  5DX5 A;  2V1P A;  2FYF A;  3ZZK A;  3MAF A;  2QB2 A;  2AEU A;  5FT8 A;  1IX8 A;  1CL2 A;  5EQC A;  2JGT A;  4Q76 A;  1ASN A;  4RIZ A;  3DYD A;  3E2Y A;  4AO4 A;  4HVK A;  1MAQ A;  1MLY A;  3DOD A;  3BCA A;  5EIG B;  2AY4 A;  3K7Y A;  4W8I A;  1QIS A;  3G7Q A;  2HP2 A;  4TV7 A;  4W1W A;  1V2D A;  2EH6 A;  3B8X A;  3VK4 A;  1AHE A;  2OAT A;  3KE3 A;  4OT8 A;  1N2T A;  4IXS A;  1D7V A;  4KYO A;  4E3Q A;  1E5F A;  1TAT A;  3LG0 A;  4F5K A;  4AZK A;  1AMA A;  4KAM A;  2OKK A;  5D95 A;  1SZU A;  1AX4 A;  4GE9 A;  1MDZ A;  3DC1 A;  3LVL B;  2ZSL A;  3WY7 A;  1GD9 A;  3EZS A;  3HT4 A;  4MKJ A;  1M0O A;  2Z9X A;  3BS8 A;  1W7N A;  3A8U X;  4JEW A;  2W7L A;  3QN6 A;  5EFS A;  2VMW A;  1BQD A;  1PMO A;  3ECD A;  1LS3 A;  2DGK A;  4HF8 A;  3BCX A;  3AV7 A;  2VLF A;  3R9A A;  4I8A A;  1WYT B;  1PFF A;  2F8J A;  2PO3 A;  2R5C B;  2YOB A;  3G0T A;  2Z20 A;  4JF1 A;  4EFF A;  4WXB A;  3DR7 A;  3PD6 A;  4EU1 A;  1PG8 A;  1I29 A;  2BYJ A;  2EZ1 A;  2WK9 A;  3A9X A;  4CVQ A;  2AY7 A;  5G09 A;  3CBF A;  1C7G A;  1BW0 A;  2ZP7 A;  3E77 A;  1YNU A;  2ZJG A;  3AEO A;  3GR9 A;  4E77 A;  5EAA A;  2YHK A;  4M2K A;  4E1O A;  4WYC A;  3I5T A;  3TAT A;  4WYG A; 
#chains in the Genus database with same CATH topology
 2OKJ A;  1O61 A;  3DU4 A;  3PDB A;  1AHF A;  3E2Z B;  2BI5 A;  3E9K A;  1BJO B;  2W7H A;  4WXG A;  5G0A A;  1UKJ A;  2D5Y A;  4M2M A;  4R5F A;  3H7F A;  3NUB A;  3RQ1 A;  4UQV A;  3AOV A;  4ZDL A;  3EIA A;  1GC3 A;  3H14 A;  4GEB A;  4XEW A;  8AAT A;  1AMS A;  1V72 A;  1CS1 A;  4XJL A;  3OKS A;  3COG A;  4K2I A;  2JJH A;  3BWN C;  4AO9 A;  2QLR A;  1AMR A;  5G2Q A;  3RBL A;  5BJ3 A;  1ZC9 A;  2VLH A;  1AY5 A;  2CFB A;  2YKU A;  1AKC A;  4F5M A;  1SZS A;  5D5S A;  3AEN B;  4DBC A;  1TPL A;  2BI3 A;  1KKP A;  1ORD A;  5EUE A;  4F5H A;  1C7N A;  2NMP A;  5AX8 A;  3FQA A;  4UHO A;  5E3K A;  3N7N A;  1LW4 A;  3D6K A;  3PIU A;  2X5F A;  3PGY A;  5G4J A;  4PFF A;  1ASC A;  1ASM A;  2BYL A;  1EG5 A;  3UE8 A;  1AHG A;  1ARH A;  3Q8N A;  3WCO A;  5C6U A;  3FQ7 A;  2JJE A;  4JEV A;  1H1C A;  4WP0 A;  1U08 A;  3N4X A;  1S06 A;  1Z3Z A;  2W8V A;  2WKA A;  5IWQ A;  4ZDO A;  3N4R A;  2C7T A;  1FG7 A;  2ZY2 A;  2D65 A;  5DJ9 A;  1B5P A;  3W1J A;  2HUU A;  4DQ6 A;  3EI6 A;  3GZC A;  4R2N A;  4ADC A;  3JWB A;  3N5M A;  1CJ0 A;  3NYS A;  3TQX A;  4LNJ A;  4WXF A;  3FD0 A;  4ZM3 A;  2W8J A;  1IAY A;  2YKX A;  1BS0 A;  1ZOB A;  4RJ0 A;  1TOG A;  3GZD A;  1M7Y A;  4PIW A;  1ARG A;  2O0R A;  4P3M A;  1X0M A;  3HLM A;  1LK9 A;  3I16 A;  1QJ3 A;  4OCA A;  1AHX A;  1V2E A;  2VMY A;  2WK8 A;  1EQB A;  4MSO A;  2ZUK A;  1GEX A;  1TOE A;  2EO5 A;  2VGS A;  3LY1 A;  4RM1 A;  2DGL A;  2D7Z A;  1VP4 A;  3MC6 A;  3GJU A;  4H63 Q;  4LNM A;  2W7E A;  3JZL A;  3RI6 A;  2Z61 A;  2ZYJ A;  1SFF A;  3FKD A;  3GET A;  3HMU A;  4GRX A;  4P7Y A;  4RJY A;  1N8P A;  2PB0 A;  4WB0 B;  2YCT A;  2O7C A;  3WZF A;  2AEV A;  1H0C A;  2BWO A;  2VIA A;  3QGU A;  1YAA A;  3QM2 A;  4WYA A;  1DJE A;  3MKJ A;  1TAR A;  4GE7 A;  1V2F A;  3TCM A;  1GCK A;  3AAT A;  3VK2 A;  3UWC A;  4AOA A;  2QB3 A;  3ELE A;  2BIE A;  4WBT A;  1RV4 A;  1ELU A;  3NYU A;  2C0R A;  3B1C A;  4LW4 A;  3ZRR A;  3NDN A;  2GQN A;  3PPL A;  2FNU A;  2BI2 A;  3K28 A;  5EAV A;  3RBF A;  1M0N A;  4XAU A;  4EMY A;  1GC4 A;  4A0F A;  1UU1 A;  4PFN A;  2G7J A;  3BC8 A;  3KGW A;  4UHN A;  1AY4 A;  2CST A;  1YJY A;  3B1D A;  1CQ6 A;  4QGR A;  5JAY A;  1ELQ A;  1PMM A;  2VGZ A;  1LKC A;  2OGA A;  1ARI A;  2CAN A;  3RUY A;  4Q31 A;  4A0G A;  2CIN A;  1M6S A;  2EYQ A;  1XI9 A;  1MDX A;  1AAW A;  3R4T A;  2KFP A;  2CJD A;  2W8W A;  1M4N A;  4OBV A;  3E6G A;  1BT4 A;  4BA4 A;  2E7I A;  1ART A;  1SF2 A;  4GDY A;  2ZC0 A;  4MQQ A;  3MAD A;  4R5Z A;  2W7F A;  1G7W A;  3AEM A;  5HHY A;  4W91 A;  1QIT A;  3GSB A;  2ZSM A;  5M49 A;  1EJI A;  1IX7 A;  2CY8 A;  3GBX A;  3QI6 A;  4NOG A;  4U2H A;  1WYT A;  2HOZ A;  2R5C A;  2A1V A;  3CQ6 A;  3JU7 A;  5K8B A;  1RVU A;  2YCP A;  2D64 A;  2VMN A;  2VGT A;  4CXR A;  3GWP A;  2W8T A;  1D7R A;  2VMX A;  3MAU A;  5EUD A;  1BJN A;  1N31 A;  3T32 A;  4CBR A;  4ZWV A;  5LH9 A;  1AJR A;  3P1T A;  3VAX A;  2QSR A;  4WYE A;  4A00 A;  1D7U A;  1AJS A;  3VP6 A;  1AHY A;  3AEP A;  2HOY A;  5F9S A;  1C7O A;  4H51 A;  3JW9 A;  4FFC A;  4OYT A;  5TF5 A;  3DXV A;  1ASF A;  1MLZ A;  2WK7 A;  5M4B A;  4CXQ A;  3WKR A;  4UHM A;  4XJP A;  1G7X A;  2AY2 A;  1GDE A;  3F9T A;  3FZ8 A;  4W1X A;  3E2Z A;  4F5J A;  2YKY A;  1OHV A;  3N75 A;  4E3R A;  1AAM A;  4WLJ A;  2DGM A;  3A9Z A;  3KGX A;  2EPJ A;  3ZRP A;  3GZD C;  5E5I A;  3LVK A;  2FN6 A;  1LC8 A;  3N4S A;  1BKG A;  2EZ2 A;  2R0T A;  3W1H A;  1B8G A;  3CQ5 A;  2JIS A;  4BA5 A;  4IY7 A;  2AY8 A;  4OC9 A;  2CJH A;  2GMU A;  4JF0 A;  2X3L A;  3OP7 A;  1AIA A;  4RKC A;  2AY1 A;  1TOK A;  1CZE A;  4WLH A;  3HBX A;  3ATH A;  2FQ6 A;  5FT5 A;  4ISY A;  3FZ6 A;  3ZZJ A;  1UU2 A;  3A9Y A;  1X28 A;  3F0H A;  4WD2 A;  1AY8 A;  1IX6 A;  3NU8 A;  3TFU A;  1BJ4 A;  1AIB A;  2D61 A;  4W1V A;  4K05 A;  1GC2 A;  2G6W A;  1JS6 A;  5EUN A;  2D66 A;  1C4K A;  2YRI A;  1IJI A;  3EZ1 A;  3AEJ C;  1S09 A;  3FVS A;  2HUF A;  5KTB A;  2Z9V A;  4ATQ A;  1WYV A;  4RIT A;  4GSA A;  1SPA A;  2OQX A;  5FT6 A;  5M4D A;  4L0O A;  2BIG A;  1Y4I A;  4OTL A;  3B1E A;  4BMK A;  3CAI A;  3FDD A;  2ZY3 A;  3QPG A;  5G2P A;  2HUI A;  3II0 A;  2BWP A;  3FDB A;  3NNK A;  2W7M A;  2WB6 A;  1W3U A;  4N0B A;  1O69 A;  1SVV A;  1I48 A;  3VOM A;  3WX9 A;  4B98 A;  2AY9 A;  2BHX A;  4ATP A;  1DGD A;  2YKV A;  2W8U A;  1ASA A;  2CH2 A;  4K2B A;  1JG8 A;  2VMV A;  2VMO A;  2HOR A;  1DGE A;  3KKI A;  2BWN A;  2Z1Y A;  5F8V A;  2VMS A;  1DKA A;  3RCH A;  1KAF A;  2ZY4 A;  1JF9 A;  4W5K A;  1TOI A;  3VK3 A;  5M46 A;  1OXP A;  4ITG A;  1DFO A;  1SZK A;  3FFR A;  3LWS A;  4J8L A;  1C0N A;  4Y0D A;  3WKS A;  2QMA A;  3LVJ A;  2HP1 A;  4IW7 A;  4MKK A;  2W7G A;  1FC4 A;  4IYO A;  4WB0 A;  2VI9 A;  2VYC A;  4MQP A;  2AY3 A;  2BKW A;  1X2A A;  3DR4 A;  5G4I A;  4O6Z A;  4OMA A;  1WYU A;  1BQA A;  4ADE A;  2Q7W A;  3ELP A;  1Z7D A;  2FM1 A;  3BWO A;  4Y0H A;  1AKA A;  2YRR A;  2D63 A;  1G4X A;  1VJO A;  5J8Q A;  4ZAS A;  3FCR A;  1D7S A;  4XQ2 A;  2GMS A;  2R2N A;  4AZJ A;  1QIR A;  2DKB A;  2VMQ A;  2Z9W A;  4MY5 A;  1KMK A;  4K2M A;  3NUI A;  2Z1Z A;  4CBS A;  3LV2 A;  3AOW A;  1DTY A;  1OHY A;  1OXO A;  1CQ8 A;  5EIG A;  4TMR A;  3WGC A;  3ASB A;  4MQR A;  1CZC A;  1XEY A;  3K40 A;  1AMQ A;  3P6K A;  4JEY A;  4WYF A;  2OGE A;  5HXX A;  3ISL A;  1IAX A;  4M2J A;  3BN1 A;  5LHA A;  2CH1 A;  2VMP A;  4F5I A;  1LW5 A;  3DRD A;  1GEW A;  4EB5 A;  1O4S A;  1O62 A;  5BJ4 A;  4LC3 A;  3F6T A;  3L8A A;  1RVY A;  1TAS A;  1JS3 A;  3PAA A;  1UU0 A;  2VGW A;  3MAF B;  1AIC A;  7AAT A;  3AEL A;  1QJ5 A;  3N0L A;  1TOJ A;  2JJG A;  2YCN A;  2BI9 A;  4Q6R A;  5DB5 A;  4BQ0 A;  2VIB A;  4ZSW A;  2O1B A;  1YIY A;  3BB8 A;  1B9H A;  2X8U A;  2W7J A;  3B46 A;  1S07 A;  4EB7 A;  4RKD A;  3W1I A;  2XBN A;  4IXO A;  1GC0 A;  2C81 A;  1M0P A;  2C44 A;  4XJM A;  1DJ9 A;  2ORD A;  2JJF A;  2E7J A;  3EI9 A;  4PVF A;  1T3I A;  1ZOD A;  4B9B A;  1ASB A;  1IUG A;  5E4Z A;  3I4J A;  1GEY A;  3FFH A;  2AY5 A;  1S0A A;  3JWA A;  2DR1 A;  9AAT A;  1MGV A;  4JEZ A;  2X5D A;  4MGR A;  4IXZ A;  5HDM A;  5DJ1 A;  4ZWM A;  3NRA A;  1WST A;  4XK1 A;  4A6T A;  2TPL A;  3M5U A;  4XJO A;  4A72 A;  2QBT A;  1X29 A;  3FVX A;  1BJO A;  3PD6 B;  1D2F A;  4A6R A;  1E5E A;  1M0Q A;  3G8M A;  1GBN A;  4ZSY A;  1WKH A;  1YJS A;  4KXK A;  1B5O A;  1KMJ A;  3BV0 A;  1I41 A;  1CL1 A;  3NU7 A;  4WYD A;  3PDX A;  4LNL A;  3MBB A;  1AJS B;  1WKG A;  4FL0 A;  2RFV A;  3HVY A;  2V0Y A;  3ACZ A;  2JG2 A;  2EGY A;  2VGV A;  1C9C A;  3AEN A;  4JE5 A;  1P3W A;  3MC6 C;  3PDB B;  1IBJ A;  4N0W A;  1YOO A;  4F5L A;  3LVM A;  1FG3 A;  3DZZ A;  3FRK A;  1QZ9 A;  3E2F A;  3PA9 A;  4TN4 A;  5I92 A;  2XH1 A;  2HOX A;  3PJ0 A;  4ADB A;  1MAP A;  3NX3 A;  3NYT A;  2W7K A;  3USF A;  2PB2 A;  1W23 A;  1ASG A;  4GE4 A;  3IF2 A;  4OBU A;  5FT4 A;  2W7I A;  2Z9U A;  3CQ4 A;  1W7L A;  2DKJ A;  1RV3 A;  3QHX A;  4Y0I A;  2R5E A;  3UAK A;  3FVU A;  4IX8 A;  1M32 A;  2CJG A;  2FNI A;  1ASE A;  2Z67 A;  2GSA A;  1ARS A;  1CQ7 A;  1YIZ A;  1W7M A;  3FSL A;  4BHD A;  2E54 A;  3FZ7 A;  3ZRQ A;  3NTJ A;  1LC7 A;  1J04 A;  3L44 A;  1LC5 A;  1MDO A;  3JTX A;  2VGU A;  3ASA A;  1QGN A;  2GB3 A;  1ASL A;  4LW2 A;  1IVR A;  1AKB A;  3DXW A;  2VI8 A;  2CB1 A;  2E7U A;  3EI8 A;  1B4X A;  3WGB A;  1BJW A;  3QBO A;  3WCN A;  3TFT A;  4U1T A;  1WYV B;  2VMU A;  2BIA A;  2VMT A;  3FQ8 A;  1OAT A;  1S08 A;  3HL2 A;  1KL2 A;  2QA3 A;  3BCB A;  2HZP A;  3H9X A;  3EUC A;  2W7D A;  4A0R A;  2VMR A;  1ASD A;  3AEM C;  1KL1 A;  3EIB A;  4UOY A;  2CTZ A;  3BWN A;  4RLG A;  4JE5 D;  4AH3 A;  2D7Y A;  4RAE A;  4ZDP A;  4A6U A;  4ZM4 A;  3EI5 A;  3A2B A;  1G4V A;  2VMZ A;  4ITX A;  3RCH B;  3EI7 A;  1YJZ A;  3HDO A;  2BI1 A;  3HQT A;  4F5G A;  3IHJ A;  1VEF A;  1B9I A;  1ECX A;  1I43 A;  4IYO B;  4ZAH A;  3WLX A;  4ZLV A;  4A0H A;  1DJU A;  4Q75 A;  1J32 A;  1WYU B;  4ADD A;  4F4E A;  2AAT A;  2AY6 A;  1OHW A;  3AEJ A;  4J5U A;  4R8D A;  4DGT A;  4JEX A;  2DOU A;  3MEB A;  4F5F A;  1KKJ A;  3FTB A;  2ZY5 A;  5DX5 A;  2V1P A;  2FYF A;  3ZZK A;  3MAF A;  2QB2 A;  2AEU A;  5FT8 A;  1IX8 A;  1CL2 A;  5EQC A;  2JGT A;  4Q76 A;  1ASN A;  4RIZ A;  3DYD A;  3E2Y A;  4AO4 A;  4HVK A;  1MAQ A;  1MLY A;  3DOD A;  3BCA A;  5EIG B;  2AY4 A;  3K7Y A;  4W8I A;  1QIS A;  3G7Q A;  2HP2 A;  4TV7 A;  4W1W A;  1V2D A;  2EH6 A;  3B8X A;  3VK4 A;  1AHE A;  2OAT A;  3KE3 A;  4OT8 A;  1N2T A;  2FKI A;  4IXS A;  1D7V A;  4KYO A;  4E3Q A;  1E5F A;  1TAT A;  3LG0 A;  4F5K A;  4AZK A;  1AMA A;  4KAM A;  2OKK A;  5D95 A;  1SZU A;  1AX4 A;  4GE9 A;  1MDZ A;  3DC1 A;  3LVL B;  2ZSL A;  3WY7 A;  1GD9 A;  3EZS A;  3HT4 A;  4MKJ A;  1M0O A;  2Z9X A;  3BS8 A;  1W7N A;  3A8U X;  4JEW A;  2W7L A;  3QN6 A;  5EFS A;  2VMW A;  1BQD A;  1PMO A;  3ECD A;  1LS3 A;  2DGK A;  4HF8 A;  3BCX A;  3AV7 A;  2VLF A;  3R9A A;  4I8A A;  1WYT B;  1PFF A;  2F8J A;  2PO3 A;  2R5C B;  2YOB A;  3G0T A;  2Z20 A;  4JF1 A;  4EFF A;  4WXB A;  3DR7 A;  3PD6 A;  4EU1 A;  1PG8 A;  1I29 A;  2BYJ A;  2EZ1 A;  2WK9 A;  3A9X A;  4CVQ A;  2AY7 A;  5G09 A;  3CBF A;  1C7G A;  1BW0 A;  2ZP7 A;  3E77 A;  1YNU A;  2ZJG A;  3AEO A;  3GR9 A;  4E77 A;  5EAA A;  2YHK A;  4M2K A;  4E1O A;  4WYC A;  3I5T A;  3TAT A;  4WYG A; 
#chains in the Genus database with same CATH homology
 2OKJ A;  1O61 A;  3DU4 A;  3PDB A;  1AHF A;  3E2Z B;  2BI5 A;  3E9K A;  1BJO B;  2W7H A;  4WXG A;  5G0A A;  1UKJ A;  2D5Y A;  4M2M A;  4R5F A;  3H7F A;  3NUB A;  3RQ1 A;  4UQV A;  3AOV A;  4ZDL A;  3EIA A;  1GC3 A;  3H14 A;  4GEB A;  4XEW A;  8AAT A;  1AMS A;  1V72 A;  1CS1 A;  4XJL A;  3OKS A;  3COG A;  4K2I A;  2JJH A;  3BWN C;  4AO9 A;  2QLR A;  1AMR A;  5G2Q A;  3RBL A;  5BJ3 A;  1ZC9 A;  2VLH A;  1AY5 A;  2CFB A;  2YKU A;  1AKC A;  4F5M A;  1SZS A;  5D5S A;  3AEN B;  4DBC A;  1TPL A;  2BI3 A;  1KKP A;  1ORD A;  5EUE A;  4F5H A;  1C7N A;  2NMP A;  5AX8 A;  3FQA A;  4UHO A;  5E3K A;  3N7N A;  1LW4 A;  3D6K A;  3PIU A;  2X5F A;  3PGY A;  5G4J A;  4PFF A;  1ASC A;  1ASM A;  2BYL A;  1EG5 A;  3UE8 A;  1AHG A;  1ARH A;  3Q8N A;  3WCO A;  5C6U A;  3FQ7 A;  2JJE A;  4JEV A;  1H1C A;  4WP0 A;  1U08 A;  3N4X A;  1S06 A;  1Z3Z A;  2W8V A;  2WKA A;  5IWQ A;  4ZDO A;  3N4R A;  2C7T A;  1FG7 A;  2ZY2 A;  2D65 A;  5DJ9 A;  1B5P A;  3W1J A;  2HUU A;  4DQ6 A;  3EI6 A;  3GZC A;  4R2N A;  4ADC A;  3JWB A;  3N5M A;  1CJ0 A;  3NYS A;  3TQX A;  4LNJ A;  4WXF A;  3FD0 A;  4ZM3 A;  2W8J A;  1IAY A;  2YKX A;  1BS0 A;  1ZOB A;  4RJ0 A;  1TOG A;  3GZD A;  1M7Y A;  4PIW A;  1ARG A;  2O0R A;  4P3M A;  1X0M A;  3HLM A;  1LK9 A;  3I16 A;  1QJ3 A;  4OCA A;  1AHX A;  1V2E A;  2VMY A;  2WK8 A;  1EQB A;  4MSO A;  2ZUK A;  1GEX A;  1TOE A;  2EO5 A;  2VGS A;  3LY1 A;  4RM1 A;  2DGL A;  2D7Z A;  1VP4 A;  3MC6 A;  3GJU A;  4H63 Q;  4LNM A;  2W7E A;  3JZL A;  3RI6 A;  2Z61 A;  2ZYJ A;  1SFF A;  3FKD A;  3GET A;  3HMU A;  4GRX A;  4P7Y A;  4RJY A;  1N8P A;  2PB0 A;  4WB0 B;  2YCT A;  2O7C A;  3WZF A;  2AEV A;  1H0C A;  2BWO A;  2VIA A;  3QGU A;  1YAA A;  3QM2 A;  4WYA A;  1DJE A;  3MKJ A;  1TAR A;  4GE7 A;  1V2F A;  3TCM A;  1GCK A;  3AAT A;  3VK2 A;  3UWC A;  4AOA A;  2QB3 A;  3ELE A;  2BIE A;  4WBT A;  1RV4 A;  1ELU A;  3NYU A;  2C0R A;  3B1C A;  4LW4 A;  3ZRR A;  3NDN A;  2GQN A;  3PPL A;  2FNU A;  2BI2 A;  3K28 A;  5EAV A;  3RBF A;  1M0N A;  4XAU A;  4EMY A;  1GC4 A;  4A0F A;  1UU1 A;  4PFN A;  2G7J A;  3BC8 A;  3KGW A;  4UHN A;  1AY4 A;  2CST A;  1YJY A;  3B1D A;  1CQ6 A;  4QGR A;  5JAY A;  1ELQ A;  1PMM A;  2VGZ A;  1LKC A;  2OGA A;  1ARI A;  2CAN A;  3RUY A;  4Q31 A;  4A0G A;  2CIN A;  1M6S A;  2EYQ A;  1XI9 A;  1MDX A;  1AAW A;  3R4T A;  2KFP A;  2CJD A;  2W8W A;  1M4N A;  4OBV A;  3E6G A;  1BT4 A;  4BA4 A;  2E7I A;  1ART A;  1SF2 A;  4GDY A;  2ZC0 A;  4MQQ A;  3MAD A;  4R5Z A;  2W7F A;  1G7W A;  3AEM A;  5HHY A;  4W91 A;  1QIT A;  3GSB A;  2ZSM A;  5M49 A;  1EJI A;  1IX7 A;  2CY8 A;  3GBX A;  3QI6 A;  4NOG A;  4U2H A;  1WYT A;  2HOZ A;  2R5C A;  2A1V A;  3CQ6 A;  3JU7 A;  5K8B A;  1RVU A;  2YCP A;  2D64 A;  2VMN A;  2VGT A;  4CXR A;  3GWP A;  2W8T A;  1D7R A;  2VMX A;  3MAU A;  5EUD A;  1BJN A;  1N31 A;  3T32 A;  4CBR A;  4ZWV A;  5LH9 A;  1AJR A;  3P1T A;  3VAX A;  2QSR A;  4WYE A;  4A00 A;  1D7U A;  1AJS A;  3VP6 A;  1AHY A;  3AEP A;  2HOY A;  5F9S A;  1C7O A;  4H51 A;  3JW9 A;  4FFC A;  4OYT A;  5TF5 A;  3DXV A;  1ASF A;  1MLZ A;  2WK7 A;  5M4B A;  4CXQ A;  3WKR A;  4UHM A;  4XJP A;  1G7X A;  2AY2 A;  1GDE A;  3F9T A;  3FZ8 A;  4W1X A;  3E2Z A;  4F5J A;  2YKY A;  1OHV A;  3N75 A;  4E3R A;  1AAM A;  4WLJ A;  2DGM A;  3A9Z A;  3KGX A;  2EPJ A;  3ZRP A;  3GZD C;  5E5I A;  3LVK A;  2FN6 A;  1LC8 A;  3N4S A;  1BKG A;  2EZ2 A;  2R0T A;  3W1H A;  1B8G A;  3CQ5 A;  2JIS A;  4BA5 A;  4IY7 A;  2AY8 A;  4OC9 A;  2CJH A;  2GMU A;  4JF0 A;  2X3L A;  3OP7 A;  1AIA A;  4RKC A;  2AY1 A;  1TOK A;  1CZE A;  4WLH A;  3HBX A;  3ATH A;  2FQ6 A;  5FT5 A;  4ISY A;  3FZ6 A;  3ZZJ A;  1UU2 A;  3A9Y A;  1X28 A;  3F0H A;  4WD2 A;  1AY8 A;  1IX6 A;  3NU8 A;  3TFU A;  1BJ4 A;  1AIB A;  2D61 A;  4W1V A;  4K05 A;  1GC2 A;  2G6W A;  1JS6 A;  5EUN A;  2D66 A;  1C4K A;  2YRI A;  1IJI A;  3EZ1 A;  3AEJ C;  1S09 A;  3FVS A;  2HUF A;  5KTB A;  2Z9V A;  4ATQ A;  1WYV A;  4RIT A;  4GSA A;  1SPA A;  2OQX A;  5FT6 A;  5M4D A;  4L0O A;  2BIG A;  1Y4I A;  4OTL A;  3B1E A;  4BMK A;  3CAI A;  3FDD A;  2ZY3 A;  3QPG A;  5G2P A;  2HUI A;  3II0 A;  2BWP A;  3FDB A;  3NNK A;  2W7M A;  2WB6 A;  1W3U A;  4N0B A;  1O69 A;  1SVV A;  1I48 A;  3VOM A;  3WX9 A;  4B98 A;  2AY9 A;  2BHX A;  4ATP A;  1DGD A;  2YKV A;  2W8U A;  1ASA A;  2CH2 A;  4K2B A;  1JG8 A;  2VMV A;  2VMO A;  2HOR A;  1DGE A;  3KKI A;  2BWN A;  2Z1Y A;  5F8V A;  2VMS A;  1DKA A;  3RCH A;  2ZY4 A;  1JF9 A;  4W5K A;  1TOI A;  3VK3 A;  5M46 A;  1OXP A;  4ITG A;  1DFO A;  1SZK A;  3FFR A;  3LWS A;  4J8L A;  1C0N A;  4Y0D A;  3WKS A;  2QMA A;  3LVJ A;  2HP1 A;  4IW7 A;  4MKK A;  2W7G A;  1FC4 A;  4IYO A;  4WB0 A;  2VI9 A;  2VYC A;  4MQP A;  2AY3 A;  2BKW A;  1X2A A;  3DR4 A;  5G4I A;  4O6Z A;  4OMA A;  1WYU A;  1BQA A;  4ADE A;  2Q7W A;  3ELP A;  1Z7D A;  2FM1 A;  3BWO A;  4Y0H A;  1AKA A;  2YRR A;  2D63 A;  1G4X A;  1VJO A;  5J8Q A;  4ZAS A;  3FCR A;  1D7S A;  4XQ2 A;  2GMS A;  2R2N A;  4AZJ A;  1QIR A;  2DKB A;  2VMQ A;  2Z9W A;  4MY5 A;  1KMK A;  4K2M A;  3NUI A;  2Z1Z A;  4CBS A;  3LV2 A;  3AOW A;  1DTY A;  1OHY A;  1OXO A;  1CQ8 A;  5EIG A;  4TMR A;  3WGC A;  3ASB A;  4MQR A;  1CZC A;  1XEY A;  3K40 A;  1AMQ A;  3P6K A;  4JEY A;  4WYF A;  2OGE A;  5HXX A;  3ISL A;  1IAX A;  4M2J A;  3BN1 A;  5LHA A;  2CH1 A;  2VMP A;  4F5I A;  1LW5 A;  3DRD A;  1GEW A;  4EB5 A;  1O4S A;  1O62 A;  5BJ4 A;  4LC3 A;  3F6T A;  3L8A A;  1RVY A;  1TAS A;  1JS3 A;  3PAA A;  1UU0 A;  2VGW A;  3MAF B;  1AIC A;  7AAT A;  3AEL A;  1QJ5 A;  3N0L A;  1TOJ A;  2JJG A;  2YCN A;  2BI9 A;  4Q6R A;  5DB5 A;  4BQ0 A;  2VIB A;  4ZSW A;  2O1B A;  1YIY A;  3BB8 A;  1B9H A;  2X8U A;  2W7J A;  3B46 A;  1S07 A;  4EB7 A;  4RKD A;  3W1I A;  2XBN A;  4IXO A;  1GC0 A;  2C81 A;  1M0P A;  2C44 A;  4XJM A;  1DJ9 A;  2ORD A;  2JJF A;  2E7J A;  3EI9 A;  4PVF A;  1T3I A;  1ZOD A;  4B9B A;  1ASB A;  1IUG A;  5E4Z A;  3I4J A;  1GEY A;  3FFH A;  2AY5 A;  1S0A A;  3JWA A;  2DR1 A;  9AAT A;  1MGV A;  4JEZ A;  2X5D A;  4MGR A;  4IXZ A;  5HDM A;  5DJ1 A;  4ZWM A;  3NRA A;  1WST A;  4XK1 A;  4A6T A;  2TPL A;  3M5U A;  4XJO A;  4A72 A;  2QBT A;  1X29 A;  3FVX A;  1BJO A;  3PD6 B;  1D2F A;  4A6R A;  1E5E A;  1M0Q A;  3G8M A;  1GBN A;  4ZSY A;  1WKH A;  1YJS A;  4KXK A;  1B5O A;  1KMJ A;  3BV0 A;  1I41 A;  1CL1 A;  3NU7 A;  4WYD A;  3PDX A;  4LNL A;  3MBB A;  1AJS B;  1WKG A;  4FL0 A;  2RFV A;  3HVY A;  2V0Y A;  3ACZ A;  2JG2 A;  2EGY A;  2VGV A;  1C9C A;  3AEN A;  4JE5 A;  1P3W A;  3MC6 C;  3PDB B;  1IBJ A;  4N0W A;  1YOO A;  4F5L A;  3LVM A;  1FG3 A;  3DZZ A;  3FRK A;  1QZ9 A;  3E2F A;  3PA9 A;  4TN4 A;  5I92 A;  2XH1 A;  2HOX A;  3PJ0 A;  4ADB A;  1MAP A;  3NX3 A;  3NYT A;  2W7K A;  3USF A;  2PB2 A;  1W23 A;  1ASG A;  4GE4 A;  3IF2 A;  4OBU A;  5FT4 A;  2W7I A;  2Z9U A;  3CQ4 A;  1W7L A;  2DKJ A;  1RV3 A;  3QHX A;  4Y0I A;  2R5E A;  3UAK A;  3FVU A;  4IX8 A;  1M32 A;  2CJG A;  2FNI A;  1ASE A;  2Z67 A;  2GSA A;  1ARS A;  1CQ7 A;  1YIZ A;  1W7M A;  3FSL A;  4BHD A;  2E54 A;  3FZ7 A;  3ZRQ A;  3NTJ A;  1LC7 A;  1J04 A;  3L44 A;  1LC5 A;  1MDO A;  3JTX A;  2VGU A;  3ASA A;  1QGN A;  2GB3 A;  1ASL A;  4LW2 A;  1IVR A;  1AKB A;  3DXW A;  2VI8 A;  2CB1 A;  2E7U A;  3EI8 A;  1B4X A;  3WGB A;  1BJW A;  3QBO A;  3WCN A;  3TFT A;  4U1T A;  1WYV B;  2VMU A;  2BIA A;  2VMT A;  3FQ8 A;  1OAT A;  1S08 A;  3HL2 A;  1KL2 A;  2QA3 A;  3BCB A;  2HZP A;  3H9X A;  3EUC A;  2W7D A;  4A0R A;  2VMR A;  1ASD A;  3AEM C;  1KL1 A;  3EIB A;  4UOY A;  2CTZ A;  3BWN A;  4RLG A;  4JE5 D;  4AH3 A;  2D7Y A;  4RAE A;  4ZDP A;  4A6U A;  4ZM4 A;  3EI5 A;  3A2B A;  1G4V A;  2VMZ A;  4ITX A;  3RCH B;  3EI7 A;  1YJZ A;  3HDO A;  2BI1 A;  3HQT A;  4F5G A;  3IHJ A;  1VEF A;  1B9I A;  1ECX A;  1I43 A;  4IYO B;  4ZAH A;  3WLX A;  4ZLV A;  4A0H A;  1DJU A;  4Q75 A;  1J32 A;  1WYU B;  4ADD A;  4F4E A;  2AAT A;  2AY6 A;  1OHW A;  3AEJ A;  4J5U A;  4R8D A;  4DGT A;  4JEX A;  2DOU A;  3MEB A;  4F5F A;  1KKJ A;  3FTB A;  2ZY5 A;  5DX5 A;  2V1P A;  2FYF A;  3ZZK A;  3MAF A;  2QB2 A;  2AEU A;  5FT8 A;  1IX8 A;  1CL2 A;  5EQC A;  2JGT A;  4Q76 A;  1ASN A;  4RIZ A;  3DYD A;  3E2Y A;  4AO4 A;  4HVK A;  1MAQ A;  1MLY A;  3DOD A;  3BCA A;  5EIG B;  2AY4 A;  3K7Y A;  4W8I A;  1QIS A;  3G7Q A;  2HP2 A;  4TV7 A;  4W1W A;  1V2D A;  2EH6 A;  3B8X A;  3VK4 A;  1AHE A;  2OAT A;  3KE3 A;  4OT8 A;  1N2T A;  2FKI A;  4IXS A;  1D7V A;  4KYO A;  4E3Q A;  1E5F A;  1TAT A;  3LG0 A;  4F5K A;  4AZK A;  1AMA A;  4KAM A;  2OKK A;  5D95 A;  1SZU A;  1AX4 A;  4GE9 A;  1MDZ A;  3DC1 A;  3LVL B;  2ZSL A;  3WY7 A;  1GD9 A;  3EZS A;  3HT4 A;  4MKJ A;  1M0O A;  2Z9X A;  3BS8 A;  1W7N A;  3A8U X;  4JEW A;  2W7L A;  3QN6 A;  5EFS A;  2VMW A;  1BQD A;  1PMO A;  3ECD A;  1LS3 A;  2DGK A;  4HF8 A;  3BCX A;  3AV7 A;  2VLF A;  3R9A A;  4I8A A;  1WYT B;  1PFF A;  2F8J A;  2PO3 A;  2R5C B;  2YOB A;  3G0T A;  2Z20 A;  4JF1 A;  4EFF A;  4WXB A;  3DR7 A;  3PD6 A;  4EU1 A;  1PG8 A;  1I29 A;  2BYJ A;  2EZ1 A;  2WK9 A;  3A9X A;  4CVQ A;  2AY7 A;  5G09 A;  3CBF A;  1C7G A;  1BW0 A;  2ZP7 A;  3E77 A;  1YNU A;  2ZJG A;  3AEO A;  3GR9 A;  4E77 A;  5EAA A;  2YHK A;  4M2K A;  4E1O A;  4WYC A;  3I5T A;  3TAT A;  4WYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...