4GE7A

Kynurenine aminotransferase ii inhibitors
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
427
Chain Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNSGRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
total genus 140
structure length 427
sequence length 428
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ge7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ge7A03
2YCNA 1G7XA 1BJOB 3CQ5A 4MKJA 1QIRA 1BS0A 2OKJA 3AV7A 2E7UA 1CQ7A 2EZ1A 1ASEA 3G0TA 3QM2A 2C0RA 3FZ8A 3HT4A 3PD6A 5F9SA 1B4XA 2YRRA 4ZDLA 3ZRQA 4JEWA 1U08A 3E2ZB 5G2QA 1AMAA 1D2FA 4RAEA 1M4NA 2YRIA 2AY2A 1ASMA 2EGYA 3FVXA 5F8VA 1DJEA 3CQ4A 2R2NA 2W7DA 2QB2A 3G7QA 3K40A 4OYTA 4ADDA 3A9YA 4A6UA 1KMKA 1B9IA 2HP2A 3G8MA 3IHJA 4P7YA 4WLHA 5FT8A 4F5IA 2CH1A 1J04A 3EI9A 1QJ3A 3MADA 3Q8NA 4LNMA 3LG0A 4TV7A 2AY9A 1IX7A 1KMJA 2VGZA 4ZWMA 4F5GA 4KYOA 2BYLA 5C6UA 3MC6A 4R2NA 1ARSA 3N5MA 4XAUA 2E7JA 3HBXA 1Z3ZA 2AEVA 2O0RA 3DU4A 1LC7A 4IXZA 4ZM4A 1GEYA 3LVJA 2ZY4A 3BC8A 3T32A 2QBTA 4U2HA 1Z7DA 3BV0A 3B1EA 1BW0A 1G4XA 1V72A 3HVYA 3QPGA 3FQ7A 2VMOA 3CQ6A 3AENB 4HF8A 1S09A 4JF0A 5E4ZA 3NUBA 4R5FA 2E7IA 1IVRA 3H7FA 3MC6C 4RIZA 3A8UX 1H0CA 1V2FA 3JTXA 3MAFA 2BI9A 4RKDA 4A6RA 2JG2A 3PAAA 5JAYA 2VMZA 3KGWA 1MGVA 1O69A 2WK8A 3F6TA 2O1BA 4B98A 1LS3A 2WK7A 2W8TA 1C4KA 3ASBA 3LV2A 1I41A 3JW9A 2VMSA 3M5UA 4GE9A 4N0BA 2VIBA 4F5FA 2BWNA 1Y4IA 4OT8A 4ZLVA 1W7NA 1DJUA 3DZZA 1RV3A 3K7YA 4OMAA 3ZRPA 4XQ2A 4CXRA 2DGMA 1B9HA 4OCAA 4Y0DA 3USFA 4K2BA 1G7WA 5HDMA 3AEMA 5DJ1A 3NTJA 3PGYA 2CH2A 4RM1A 1IX6A 3KE3A 1D7UA 1M0PA 2BIAA 2YKUA 3MBBA 3PDXA 3AOWA 2CJHA 5FT6A 3RUYA 2RFVA 2EH6A 3JZLA 3WKSA 1D7SA 5E3KA 1AHGA 1GC4A 2GMSA 3FSLA 4XEWA 1ASLA 1M0OA 3HMUA 3K28A 5FT5A 3ELPA 2VGVA 1N31A 2W7KA 4RJYA 4W91A 1LW4A 1W3UA 2DKBA 2VI9A 2QLRA 3VK4A 1WYTB 3AEMC 4GE7A 3MAFB 4TN4A 1IJIA 4WYAA 3VOMA 1ECXA 4L0OA 4A6TA 2VIAA 4CBRA 2QMAA 1AHEA 4MKKA 1OXOA 1SZUA 2GQNA 2ZJGA 5EUDA 3BWNA 3EI5A 1S06A 3KKIA 4K2IA 1BQDA 1BJOA 2PO3A 4XJMA 4LNJA 3EIAA 2W7IA 1E5FA 4F5LA 4KXKA 3LVLB 3GSBA 4MQRA 2YKYA 4R8DA 3NYSA 2VMQA 2X5DA 2D61A 5EAAA 3ECDA 4FL0A 3JWAA 3AOVA 3B8XA 1TARA 1WKGA 3VP6A 2GB3A 3WCNA 2BHXA 5M4DA 2FYFA 1BQAA 1ORDA 1TASA 4J5UA 2JISA 4GEBA 1ZODA 2C44A 1XEYA 3EI8A 3I16A 2BIGA 1KKJA 5G4IA 3HQTA 2AY6A 4Q75A 5EUNA 3W1JA 4XJPA 1ASFA 3FDBA 2C81A 1XI9A 4PFNA 1RVYA 4LW2A 5IWQA 2VYCA 1YOOA 5AX8A 3AEJC 4LNLA 4W1VA 3H14A 1T3IA 2VMTA 2WKAA 4OBUA 2ORDA 5HHYA 3CAIA 3UWCA 2BI3A 4Y0IA 3PDBB 4ATPA 3DODA 2BIEA 2VLHA 4EMYA 4F5JA 2EZ2A 4QGRA 1GCKA 1YJSA 2OGEA 3GZDA 3CBFA 1FC4A 3LVKA 3VAXA 3ACZA 1CZEA 3TFTA 4W1XA 1AY8A 2JJEA 4GRXA 1X2AA 1ASDA 2YCTA 3HLMA 4ZDOA 2QB3A 4ZAHA 3W1HA 2ZY5A 2CJDA 3FD0A 4F5KA 5BJ3A 5EQCA 1B8GA 3MKJA 2OQXA 1EG5A 2CINA 3EZ1A 4M2JA 4CVQA 1CS1A 1ASGA 3GZDC 3D6KA 1P3WA 1S0AA 4WBTA 5EIGA 5DB5A 2AY8A 1TPLA 1SZKA 1DGDA 2VMWA 1LC5A 3TATA 2AEUA 4EB5A 1DJ9A 2JJHA 2DOUA 2CB1A 1ASAA 2YCPA 4TMRA 2VLFA 1V2EA 3DR7A 1O61A 1S08A 3MAUA 4EFFA 2YOBA 8AATA 1KKPA 3JU7A 3BCXA 3PPLA 3L8AA 3FRKA 1LK9A 3RI6A 4W8IA 4GSAA 4JEXA 5EFSA 1AJSB 1JS3A 3TCMA 1QJ5A 5EAVA 3FCRA 4ITGA 1JS6A 2W7FA 3AEJA 2G6WA 3TFUA 3E77A 2HUIA 1MLYA 2DGLA 4E3RA 1WYVA 5K8BA 3GR9A 4B9BA 9AATA 3QI6A 1KL1A 2D63A 4UHNA 1GEXA 4WYDA 1AAMA 4RKCA 3DXWA 3PA9A 4A72A 1M7YA 1YJYA 1EJIA 1AMQA 4AO9A 4WLJA 2Z67A 3N0LA 1OHWA 3NU7A 2ZUKA 4U1TA 5I92A 3A9XA 1DTYA 1JF9A 3EI7A 3I4JA 4JEZA 2ZY3A 1QGNA 2CY8A 2EO5A 1N8PA 4AZKA 2YKXA 1E5EA 3HL2A 3PIUA 3BWOA 1TOEA 1AIAA 3BS8A 2JJFA 1UU0A 2JJGA 3ZZKA 1OHVA 4PIWA 4UHMA 1AMRA 2VGWA 5HXXA 1PFFA 4IW7A 2CFBA 3UAKA 3VK2A 4WYCA 1LKCA 4LC3A 3ZRRA 1W7MA 2DR1A 3DRDA 1MDXA 2DKJA 3NNKA 2CJGA 4PVFA 4Q31A 1QITA 2AY1A 2CANA 4H51A 2W7MA 2D7YA 2HP1A 1AHXA 4WYGA 2AY7A 3A2BA 5G0AA 3AEOA 3WZFA 3VK3A 4E1OA 1UU1A 1IAXA 2FN6A 2XH1A 4O6ZA 3W1IA 2AY3A 3B46A 2W8WA 4ADBA 3COGA 1VP4A 1ARTA 2BWPA 2EPJA 1GEWA 2D66A 2Z9VA 2R5CA 1B5OA 1ELQA 2GSAA 3NYTA 1YJZA 2HZPA 2W8JA 5BJ4A 1DFOA 1O4SA 4JE5D 2VMYA 2F8JA 3I5TA 1V2DA 1TOKA 4OBVA 4E77A 2X8UA 2OGAA 3GZCA 1AIBA 1D7RA 3ASAA 2BI1A 3LY1A 2VMPA 4ISYA 1YIYA 2HUUA 3FTBA 1IAYA 2R0TA 3QN6A 4AH3A 1H1CA 1RV4A 2NMPA 2DGKA 4M2KA 1M0NA 1SZSA 3F0HA 4ZDPA 3WLXA 3MEBA 2Z20A 3NU8A 2BKWA 1M0QA 2GMUA 3QHXA 2Z9WA 3EUCA 4A0RA 1QZ9A 2OATA 2R5CB 5FT4A 3E2ZA 2VMUA 3EI6A 3ISLA 2QA3A 2ZP7A 3WGBA 2D65A 4EB7A 3GBXA 3RBLA 1M6SA 2W7JA 3FVSA 2W7GA 4ITXA 4IXOA 4RJ0A 1JG8A 4WYEA 1IUGA 4A0GA 4F5MA 1B5PA 1BJWA 1CJ0A 3HDOA 4BQ0A 4A0FA 4R5ZA 1DGEA 1QISA 3B1DA 4XJLA 5D95A 2W8VA 5EIGB 2X5FA 1M32A 3ELEA 5DX5A 4I8AA 3AATA 4K2MA 3GWPA 4W1WA 1CQ6A 2WK9A 4CXQA 2VMNA 2BWOA 2CSTA 3EZSA 1WYVB 2PB2A 1GC0A 3GETA 1AHFA 2BI5A 2HORA 2VGUA 2VI8A 2ZSMA 2ZC0A 2FNIA 3LVMA 4ZASA 3L44A 3EIBA 5J8QA 3QBOA 1CZCA 4IYOA 4MQQA 2HUFA 1C7GA 1OXPA 1AICA 2BYJA 3DXVA 1BJNA 4J8LA 2BI2A 1ASNA 2CTZA 1TOJA 3AENA 1AY5A 3F9TA 3E9KA 4JF1A 1GC3A 3WX9A 1WYUB 4JEVA 4UOYA 1PMMA 3FFHA 1AMSA 1X28A 1X29A 3N75A 3ATHA 1C0NA 3IF2A 4WXBA 1I48A 4ZSWA 2YHKA 3ZZJA 4IXSA 4RLGA 2ZY2A 5E5IA 3WY7A 3OP7A 1BKGA 3FDDA 3R4TA 1BJ4A 3E2FA 4P3MA 2VMRA 1ELUA 1G4VA 3FZ7A 5G2PA 3DYDA 3DR4A 1S07A 3NX3A 4GDYA 2E54A 2V1PA 2PB0A 4N0WA 1OATA 1C7NA 4XJOA 2AY5A 3PJ0A 4ADEA 1MAPA 1IBJA 4KAMA 4RITA 5G4JA 1FG7A 1CQ8A 2YKVA 1ZC9A 1GBNA 2JGTA 4LW4A 1LC8A 2VMVA 4Q6RA 1W7LA 1YNUA 3JWBA 1UU2A 4BMKA 2C7TA 4AO4A 1WYTA 1YIZA 4OC9A 4UQVA 4WYFA 4WXGA 3NDNA 1D7VA 2W7EA 4DBCA 1ASCA 1OHYA 4WXFA 1C7OA 1WSTA 4MY5A 4CBSA 4ADCA 4MGRA 5DJ9A 2HOYA 1YAAA 1C9CA 4Y0HA 2Z1YA 4WB0A 5M46A 4F4EA 2HOXA 1ASBA 4WB0B 4F5HA 4W5KA 4JE5A 1AAWA 1FG3A 1LW5A 4BHDA 3LWSA 3WGCA 2VGSA 3PDBA 2ZSLA 4PFFA 3OKSA 1CL1A 3FZ6A 4ZSYA 3GJUA 4HVKA 1SFFA 2Z1ZA 1PG8A 3FKDA 4WP0A 1UKJA 2V0YA 3NRAA 5M4BA 1GD9A 2ZYJA 1GC2A 3BCAA 3AEPA 1ARIA 5TF5A 4IYOB 2O7CA 3UE8A 1I43A 1VEFA 1DKAA 3A9ZA 3FVUA 3RBFA 3TQXA 1X0MA 2Z9UA 2XBNA 4BA5A 1I29A 2R5EA 1GDEA 1BT4A 1ZOBA 1TATA 4WD2A 3DC1A 1VJOA 4E3QA 4Q76A 5LHAA 1WKHA 3RQ1A 3E6GA 4BA4A 2VMXA 4M2MA 4AOAA 1SPAA 4DQ6A 7AATA 1AKCA 1AJSA 4A00A 2FM1A 2FNUA 3FFRA 5EUEA 2W7HA 1AY4A 1AX4A 4GE4A 1AHYA 2Z61A 3FQ8A 1IX8A 3R9AA 1PMOA 3NYUA 4AZJA 3QGUA 4MSOA 4ZWVA 3KGXA 4OTLA 3WCOA 4IX8A 1KL2A 5D5SA 4ATQA 1O62A 2AATA 1ARGA 3FQAA 3BN1A 4XK1A 4A0HA 4IY7A 3PD6B 1AKBA 3NUIA 3II0A 2D7ZA 2VGTA 2W8UA 3P1TA 3RCHB 1MLZA 2HOZA 1J32A 1WYUA 1AKAA 3RCHA 3B1CA 2AY4A 1W23A 1EQBA 1AJRA 2W7LA 4MQPA 1CL2A 1TOGA 3E2YA 4DGTA 1MAQA 5G09A 1TOIA 3BWNC 1MDOA 3BB8A 1N2TA 5M49A 2TPLA 1MDZA 5LH9A 1ARHA 2D64A 2X3LA 1SF2A 1SVVA 2Z9XA 3WKRA 3AELA 3P6KA 4UHOA 4JEYA 3BCBA 2D5YA 2Q7WA 4NOGA 4ZM3A 4FFCA 2FQ6A 4EU1A 1RVUA 2OKKA
chains in the Genus database with same CATH superfamily
2YCNA 1G7XA 1BJOB 3CQ5A 4MKJA 1QIRA 1BS0A 2OKJA 3AV7A 2E7UA 1CQ7A 2EZ1A 1ASEA 3G0TA 3QM2A 2C0RA 3FZ8A 3HT4A 3PD6A 5F9SA 1B4XA 2YRRA 4ZDLA 3ZRQA 4JEWA 1U08A 3E2ZB 5G2QA 1AMAA 1D2FA 4RAEA 1M4NA 2YRIA 2AY2A 1ASMA 2EGYA 3FVXA 5F8VA 1DJEA 3CQ4A 2R2NA 2W7DA 2QB2A 3G7QA 3K40A 4OYTA 4ADDA 3N4XA 3A9YA 4A6UA 1KMKA 1B9IA 2HP2A 3N7NA 3G8MA 3IHJA 4P7YA 4WLHA 5FT8A 4F5IA 2CH1A 1J04A 3EI9A 1QJ3A 3MADA 3Q8NA 4LNMA 3LG0A 4TV7A 2AY9A 1IX7A 1KMJA 2VGZA 4ZWMA 4F5GA 4KYOA 2BYLA 5C6UA 3MC6A 4R2NA 1ARSA 3N5MA 4XAUA 2E7JA 3HBXA 1Z3ZA 2AEVA 2O0RA 3DU4A 1LC7A 4IXZA 4ZM4A 4K05A 1GEYA 3LVJA 2ZY4A 3BC8A 3T32A 2QBTA 4U2HA 1Z7DA 3BV0A 3B1EA 1BW0A 1G4XA 1V72A 5KTBA 3HVYA 3QPGA 3FQ7A 2VMOA 3CQ6A 3AENB 4HF8A 1S09A 4JF0A 5E4ZA 3NUBA 4R5FA 2E7IA 1IVRA 3H7FA 3MC6C 4RIZA 3A8UX 1H0CA 1V2FA 3JTXA 3MAFA 2BI9A 4RKDA 4A6RA 2JG2A 3PAAA 5JAYA 2VMZA 3KGWA 1MGVA 1O69A 2WK8A 3F6TA 2O1BA 4B98A 1LS3A 2WK7A 2W8TA 1C4KA 3ASBA 3LV2A 1I41A 3JW9A 2VMSA 3M5UA 4GE9A 4N0BA 2VIBA 4F5FA 2BWNA 1Y4IA 4OT8A 4ZLVA 1W7NA 1DJUA 3DZZA 1RV3A 3K7YA 4OMAA 3ZRPA 4XQ2A 4CXRA 2DGMA 1B9HA 4OCAA 4Y0DA 3USFA 4K2BA 1G7WA 5HDMA 3AEMA 5DJ1A 3NTJA 3PGYA 2CH2A 4RM1A 1IX6A 3KE3A 1D7UA 1M0PA 2BIAA 2YKUA 3MBBA 3PDXA 3AOWA 2CJHA 5FT6A 3RUYA 2RFVA 2EH6A 3JZLA 3WKSA 1D7SA 5E3KA 1AHGA 1GC4A 2GMSA 3FSLA 4XEWA 1ASLA 1M0OA 3HMUA 3K28A 5FT5A 3ELPA 2VGVA 1N31A 2W7KA 4RJYA 4W91A 1LW4A 1W3UA 2DKBA 2VI9A 2QLRA 3VK4A 1WYTB 3AEMC 4GE7A 3MAFB 4TN4A 1IJIA 4WYAA 3VOMA 1ECXA 4L0OA 4A6TA 2VIAA 4CBRA 2QMAA 1AHEA 4MKKA 1OXOA 1SZUA 2GQNA 2ZJGA 5EUDA 3BWNA 3EI5A 1S06A 3KKIA 4K2IA 1BQDA 1BJOA 2PO3A 4XJMA 3N4SA 4LNJA 3EIAA 2W7IA 1E5FA 3H9XA 4F5LA 4KXKA 3LVLB 3GSBA 4MQRA 2YKYA 4R8DA 2A1VA 3NYSA 2VMQA 2X5DA 2D61A 5EAAA 3ECDA 4FL0A 3JWAA 3AOVA 3B8XA 1TARA 1WKGA 3VP6A 2GB3A 3WCNA 2BHXA 5M4DA 2FYFA 1BQAA 1ORDA 1TASA 4J5UA 2JISA 4GEBA 1ZODA 2C44A 1XEYA 3EI8A 3I16A 2BIGA 1KKJA 5G4IA 3HQTA 2AY6A 4Q75A 5EUNA 3W1JA 4XJPA 1ASFA 3FDBA 2C81A 1XI9A 4PFNA 1RVYA 4LW2A 5IWQA 2VYCA 1YOOA 5AX8A 3AEJC 4LNLA 4W1VA 3H14A 1T3IA 2VMTA 2WKAA 4OBUA 2ORDA 5HHYA 3CAIA 3UWCA 2BI3A 4Y0IA 3PDBB 4ATPA 3DODA 2BIEA 2VLHA 4EMYA 4F5JA 2EZ2A 4QGRA 1GCKA 1YJSA 2OGEA 3GZDA 3CBFA 1FC4A 3LVKA 3VAXA 3ACZA 1CZEA 3TFTA 4W1XA 1AY8A 2JJEA 4GRXA 1X2AA 1ASDA 2YCTA 3HLMA 4ZDOA 2QB3A 4ZAHA 3W1HA 2ZY5A 2CJDA 3FD0A 4F5KA 5BJ3A 5EQCA 1B8GA 3MKJA 2OQXA 1EG5A 2CINA 3EZ1A 4M2JA 4CVQA 2FKIA 1CS1A 1ASGA 3GZDC 3D6KA 1P3WA 1S0AA 4WBTA 5EIGA 5DB5A 2AY8A 1TPLA 1SZKA 1DGDA 2VMWA 1LC5A 3TATA 2AEUA 4EB5A 1DJ9A 2JJHA 2DOUA 2CB1A 1ASAA 2YCPA 4TMRA 2VLFA 1V2EA 3DR7A 1O61A 1S08A 3MAUA 4EFFA 2YOBA 8AATA 1KKPA 3JU7A 3BCXA 3PPLA 3L8AA 3FRKA 1LK9A 3RI6A 4W8IA 4GSAA 4JEXA 5EFSA 1AJSB 1JS3A 3TCMA 1QJ5A 5EAVA 3FCRA 4ITGA 1JS6A 2W7FA 3AEJA 2G6WA 3TFUA 3E77A 2HUIA 1MLYA 2DGLA 4E3RA 1WYVA 5K8BA 3GR9A 4B9BA 9AATA 3QI6A 1KL1A 2D63A 4UHNA 1GEXA 4WYDA 1AAMA 4RKCA 3DXWA 3PA9A 4A72A 1M7YA 1YJYA 1EJIA 1AMQA 4AO9A 4WLJA 2Z67A 3N0LA 1OHWA 3NU7A 2ZUKA 4U1TA 5I92A 3A9XA 1DTYA 1JF9A 3EI7A 3I4JA 4JEZA 2ZY3A 1QGNA 2CY8A 2EO5A 1N8PA 4AZKA 2YKXA 1E5EA 3HL2A 3PIUA 3BWOA 1TOEA 1AIAA 3BS8A 2JJFA 1UU0A 2JJGA 3ZZKA 1OHVA 4PIWA 4UHMA 1AMRA 2VGWA 5HXXA 1PFFA 4IW7A 2CFBA 3UAKA 3VK2A 4WYCA 1LKCA 4LC3A 3ZRRA 1W7MA 2DR1A 3DRDA 1MDXA 2DKJA 3NNKA 2CJGA 4PVFA 4Q31A 1QITA 2AY1A 2CANA 4H51A 2W7MA 2D7YA 2HP1A 1AHXA 4WYGA 2AY7A 3A2BA 5G0AA 3N4RA 3AEOA 3WZFA 3VK3A 4E1OA 1KAFA 1UU1A 1IAXA 2FN6A 2XH1A 4O6ZA 3W1IA 2AY3A 3B46A 2W8WA 4ADBA 3COGA 1VP4A 1ARTA 2BWPA 2EPJA 1GEWA 2D66A 2Z9VA 2R5CA 1B5OA 1ELQA 2GSAA 3NYTA 1YJZA 2HZPA 2W8JA 5BJ4A 1DFOA 1O4SA 4JE5D 2VMYA 2F8JA 3I5TA 1V2DA 1TOKA 4OBVA 4E77A 2X8UA 2OGAA 3GZCA 1AIBA 1D7RA 3ASAA 2BI1A 3LY1A 2VMPA 4ISYA 1YIYA 2HUUA 3FTBA 1IAYA 2R0TA 3QN6A 4AH3A 1H1CA 1RV4A 2NMPA 2DGKA 4M2KA 1M0NA 1SZSA 3F0HA 4ZDPA 3WLXA 2KFPA 3MEBA 2Z20A 3NU8A 2BKWA 1M0QA 2GMUA 3QHXA 2Z9WA 3EUCA 4A0RA 1QZ9A 2OATA 2R5CB 5FT4A 3E2ZA 2VMUA 3EI6A 3ISLA 2QA3A 2ZP7A 3WGBA 2D65A 4EB7A 3GBXA 3RBLA 1M6SA 2W7JA 3FVSA 2W7GA 4ITXA 4IXOA 4RJ0A 1JG8A 4WYEA 1IUGA 4A0GA 4F5MA 1B5PA 1BJWA 1CJ0A 3HDOA 4BQ0A 4A0FA 4R5ZA 1DGEA 1QISA 3B1DA 4XJLA 5D95A 2W8VA 5EIGB 2X5FA 1M32A 3ELEA 5DX5A 4I8AA 3AATA 4K2MA 3GWPA 4W1WA 1CQ6A 2WK9A 4CXQA 2VMNA 2BWOA 2CSTA 3EZSA 1WYVB 2PB2A 1GC0A 3GETA 1AHFA 2BI5A 2HORA 2VGUA 2VI8A 2ZSMA 2ZC0A 2FNIA 3LVMA 4ZASA 3L44A 3EIBA 5J8QA 3QBOA 1CZCA 4IYOA 4MQQA 2HUFA 1C7GA 1OXPA 1AICA 2BYJA 3DXVA 1BJNA 4J8LA 2BI2A 1ASNA 2CTZA 1TOJA 3AENA 1AY5A 3F9TA 3E9KA 4JF1A 1GC3A 3WX9A 1WYUB 4JEVA 4UOYA 1PMMA 3FFHA 1AMSA 1X28A 1X29A 3N75A 3ATHA 1C0NA 3IF2A 4WXBA 2QSRA 1I48A 4ZSWA 2YHKA 3ZZJA 4IXSA 4RLGA 2ZY2A 5E5IA 3WY7A 3OP7A 1BKGA 3FDDA 3R4TA 1BJ4A 3E2FA 4P3MA 2VMRA 1ELUA 1G4VA 3FZ7A 5G2PA 3DYDA 3DR4A 1S07A 2EYQA 3NX3A 4GDYA 2E54A 2V1PA 2PB0A 4N0WA 1OATA 1C7NA 4XJOA 2AY5A 3PJ0A 4ADEA 1MAPA 1IBJA 4KAMA 4RITA 5G4JA 1FG7A 1CQ8A 2YKVA 1ZC9A 1GBNA 2JGTA 4LW4A 1LC8A 2VMVA 4Q6RA 1W7LA 1YNUA 3JWBA 1UU2A 4BMKA 2C7TA 4AO4A 1WYTA 1YIZA 4OC9A 4UQVA 4WYFA 4WXGA 3NDNA 1D7VA 2W7EA 4DBCA 1ASCA 1OHYA 4WXFA 1C7OA 1WSTA 4MY5A 4CBSA 4ADCA 4MGRA 5DJ9A 2HOYA 1YAAA 1C9CA 4Y0HA 2Z1YA 4WB0A 5M46A 4F4EA 2HOXA 1ASBA 4WB0B 4F5HA 4W5KA 4JE5A 4H63Q 1AAWA 1FG3A 1LW5A 4BHDA 3LWSA 3WGCA 2VGSA 3PDBA 2ZSLA 4PFFA 3OKSA 1CL1A 3FZ6A 4ZSYA 3GJUA 4HVKA 1SFFA 2Z1ZA 1PG8A 3FKDA 4WP0A 1UKJA 2V0YA 3NRAA 5M4BA 1GD9A 2ZYJA 1GC2A 3BCAA 3AEPA 1ARIA 5TF5A 4IYOB 2O7CA 3UE8A 1I43A 1VEFA 1DKAA 3A9ZA 3FVUA 3RBFA 3TQXA 1X0MA 2Z9UA 2XBNA 4BA5A 1I29A 2R5EA 1GDEA 1BT4A 1ZOBA 1TATA 4WD2A 3DC1A 1VJOA 4E3QA 4Q76A 5LHAA 1WKHA 3RQ1A 3E6GA 4BA4A 2VMXA 4M2MA 4AOAA 1SPAA 4DQ6A 7AATA 1AKCA 1AJSA 4A00A 2FM1A 2FNUA 3FFRA 5EUEA 2W7HA 1AY4A 1AX4A 4GE4A 1AHYA 2Z61A 3FQ8A 1IX8A 3R9AA 1PMOA 3NYUA 4AZJA 3QGUA 4MSOA 4ZWVA 3KGXA 4OTLA 3WCOA 4IX8A 1KL2A 5D5SA 4ATQA 1O62A 2AATA 1ARGA 3FQAA 3BN1A 4XK1A 4A0HA 4IY7A 3PD6B 1AKBA 3NUIA 3II0A 2D7ZA 2VGTA 2W8UA 3P1TA 3RCHB 1MLZA 2HOZA 1J32A 1WYUA 1AKAA 3RCHA 3B1CA 2AY4A 1W23A 1EQBA 1AJRA 2W7LA 4MQPA 1CL2A 1TOGA 3E2YA 4DGTA 1MAQA 5G09A 2WB6A 1TOIA 3BWNC 1MDOA 3BB8A 1N2TA 5M49A 2G7JA 2TPLA 1MDZA 5LH9A 1ARHA 2D64A 2X3LA 1SF2A 1SVVA 2Z9XA 3WKRA 3AELA 3P6KA 4UHOA 4JEYA 3BCBA 2D5YA 2Q7WA 4NOGA 4ZM3A 4FFCA 2FQ6A 4EU1A 1RVUA 2OKKA
chains in the Genus database with same CATH topology
2YCNA 1G7XA 1BJOB 3CQ5A 4MKJA 1QIRA 1BS0A 2OKJA 3AV7A 2E7UA 1CQ7A 2EZ1A 1ASEA 3G0TA 3QM2A 2C0RA 3FZ8A 3HT4A 3PD6A 5F9SA 1B4XA 2YRRA 4ZDLA 3ZRQA 4JEWA 1U08A 3E2ZB 5G2QA 1AMAA 1D2FA 4RAEA 1M4NA 2YRIA 2AY2A 1ASMA 2EGYA 3FVXA 5F8VA 1DJEA 3CQ4A 2R2NA 2W7DA 2QB2A 3G7QA 3K40A 4OYTA 4ADDA 3N4XA 3A9YA 4A6UA 1KMKA 1B9IA 2HP2A 3N7NA 3G8MA 3IHJA 4P7YA 4WLHA 5FT8A 4F5IA 2CH1A 1J04A 3EI9A 1QJ3A 3MADA 3Q8NA 4LNMA 3LG0A 4TV7A 2AY9A 1IX7A 1KMJA 2VGZA 4ZWMA 4F5GA 4KYOA 2BYLA 5C6UA 3MC6A 4R2NA 1ARSA 3N5MA 4XAUA 2E7JA 3HBXA 1Z3ZA 2AEVA 2O0RA 3DU4A 1LC7A 4IXZA 4ZM4A 4K05A 1GEYA 3LVJA 2ZY4A 3BC8A 3T32A 2QBTA 4U2HA 1Z7DA 3BV0A 3B1EA 1BW0A 1G4XA 1V72A 5KTBA 3HVYA 3QPGA 3FQ7A 2VMOA 3CQ6A 3AENB 4HF8A 1S09A 4JF0A 5E4ZA 3NUBA 4R5FA 2E7IA 1IVRA 3H7FA 3MC6C 4RIZA 3A8UX 1H0CA 1V2FA 3JTXA 3MAFA 2BI9A 4RKDA 4A6RA 2JG2A 3PAAA 5JAYA 2VMZA 3KGWA 1MGVA 1O69A 2WK8A 3F6TA 2O1BA 4B98A 1LS3A 2WK7A 2W8TA 1C4KA 3ASBA 3LV2A 1I41A 3JW9A 2VMSA 3M5UA 4GE9A 4N0BA 2VIBA 4F5FA 2BWNA 1Y4IA 4OT8A 4ZLVA 1W7NA 1DJUA 3DZZA 1RV3A 3K7YA 4OMAA 3ZRPA 4XQ2A 4CXRA 2DGMA 1B9HA 4OCAA 4Y0DA 3USFA 4K2BA 1G7WA 5HDMA 3AEMA 5DJ1A 3NTJA 3PGYA 2CH2A 4RM1A 1IX6A 3KE3A 1D7UA 1M0PA 2BIAA 2YKUA 3MBBA 3PDXA 3AOWA 2CJHA 5FT6A 3RUYA 2RFVA 2EH6A 3JZLA 3WKSA 1D7SA 5E3KA 1AHGA 1GC4A 2GMSA 3FSLA 4XEWA 1ASLA 1M0OA 3HMUA 3K28A 5FT5A 3ELPA 2VGVA 1N31A 2W7KA 4RJYA 4W91A 1LW4A 1W3UA 2DKBA 2VI9A 2QLRA 3VK4A 1WYTB 3AEMC 4GE7A 3MAFB 4TN4A 1IJIA 4WYAA 3VOMA 1ECXA 4L0OA 4A6TA 2VIAA 4CBRA 2QMAA 1AHEA 4MKKA 1OXOA 1SZUA 2GQNA 2ZJGA 5EUDA 3BWNA 3EI5A 1S06A 3KKIA 4K2IA 1BQDA 1BJOA 2PO3A 4XJMA 3N4SA 4LNJA 3EIAA 2W7IA 1E5FA 3H9XA 4F5LA 4KXKA 3LVLB 3GSBA 4MQRA 2YKYA 4R8DA 2A1VA 3NYSA 2VMQA 2X5DA 2D61A 5EAAA 3ECDA 4FL0A 3JWAA 3AOVA 3B8XA 1TARA 1WKGA 3VP6A 2GB3A 3WCNA 2BHXA 5M4DA 2FYFA 1BQAA 1ORDA 1TASA 4J5UA 2JISA 4GEBA 1ZODA 2C44A 1XEYA 3EI8A 3I16A 2BIGA 1KKJA 5G4IA 3HQTA 2AY6A 4Q75A 5EUNA 3W1JA 4XJPA 1ASFA 3FDBA 2C81A 1XI9A 4PFNA 1RVYA 4LW2A 5IWQA 2VYCA 1YOOA 5AX8A 3AEJC 4LNLA 4W1VA 3H14A 1T3IA 2VMTA 2WKAA 4OBUA 2ORDA 5HHYA 3CAIA 3UWCA 2BI3A 4Y0IA 3PDBB 4ATPA 3DODA 2BIEA 2VLHA 4EMYA 4F5JA 2EZ2A 4QGRA 1GCKA 1YJSA 2OGEA 3GZDA 3CBFA 1FC4A 3LVKA 3VAXA 3ACZA 1CZEA 3TFTA 4W1XA 1AY8A 2JJEA 4GRXA 1X2AA 1ASDA 2YCTA 3HLMA 4ZDOA 2QB3A 4ZAHA 3W1HA 2ZY5A 2CJDA 3FD0A 4F5KA 5BJ3A 5EQCA 1B8GA 3MKJA 2OQXA 1EG5A 2CINA 3EZ1A 4M2JA 4CVQA 2FKIA 1CS1A 1ASGA 3GZDC 3D6KA 1P3WA 1S0AA 4WBTA 5EIGA 5DB5A 2AY8A 1TPLA 1SZKA 1DGDA 2VMWA 1LC5A 3TATA 2AEUA 4EB5A 1DJ9A 2JJHA 2DOUA 2CB1A 1ASAA 2YCPA 4TMRA 2VLFA 1V2EA 3DR7A 1O61A 1S08A 3MAUA 4EFFA 2YOBA 8AATA 1KKPA 3JU7A 3BCXA 3PPLA 3L8AA 3FRKA 1LK9A 3RI6A 4W8IA 4GSAA 4JEXA 5EFSA 1AJSB 1JS3A 3TCMA 1QJ5A 5EAVA 3FCRA 4ITGA 1JS6A 2W7FA 3AEJA 2G6WA 3TFUA 3E77A 2HUIA 1MLYA 2DGLA 4E3RA 1WYVA 5K8BA 3GR9A 4B9BA 9AATA 3QI6A 1KL1A 2D63A 4UHNA 1GEXA 4WYDA 1AAMA 4RKCA 3DXWA 3PA9A 4A72A 1M7YA 1YJYA 1EJIA 1AMQA 4AO9A 4WLJA 2Z67A 3N0LA 1OHWA 3NU7A 2ZUKA 4U1TA 5I92A 3A9XA 1DTYA 1JF9A 3EI7A 3I4JA 4JEZA 2ZY3A 1QGNA 2CY8A 2EO5A 1N8PA 4AZKA 2YKXA 1E5EA 3HL2A 3PIUA 3BWOA 1TOEA 1AIAA 3BS8A 2JJFA 1UU0A 2JJGA 3ZZKA 1OHVA 4PIWA 4UHMA 1AMRA 2VGWA 5HXXA 1PFFA 4IW7A 2CFBA 3UAKA 3VK2A 4WYCA 1LKCA 4LC3A 3ZRRA 1W7MA 2DR1A 3DRDA 1MDXA 2DKJA 3NNKA 2CJGA 4PVFA 4Q31A 1QITA 2AY1A 2CANA 4H51A 2W7MA 2D7YA 2HP1A 1AHXA 4WYGA 2AY7A 3A2BA 5G0AA 3N4RA 3AEOA 3WZFA 3VK3A 4E1OA 1UU1A 1IAXA 2FN6A 2XH1A 4O6ZA 3W1IA 2AY3A 3B46A 2W8WA 4ADBA 3COGA 1VP4A 1ARTA 2BWPA 2EPJA 1GEWA 2D66A 2Z9VA 2R5CA 1B5OA 1ELQA 2GSAA 3NYTA 1YJZA 2HZPA 2W8JA 5BJ4A 1DFOA 1O4SA 4JE5D 2VMYA 2F8JA 3I5TA 1V2DA 1TOKA 4OBVA 4E77A 2X8UA 2OGAA 3GZCA 1AIBA 1D7RA 3ASAA 2BI1A 3LY1A 2VMPA 4ISYA 1YIYA 2HUUA 3FTBA 1IAYA 2R0TA 3QN6A 4AH3A 1H1CA 1RV4A 2NMPA 2DGKA 4M2KA 1M0NA 1SZSA 3F0HA 4ZDPA 3WLXA 2KFPA 3MEBA 2Z20A 3NU8A 2BKWA 1M0QA 2GMUA 3QHXA 2Z9WA 3EUCA 4A0RA 1QZ9A 2OATA 2R5CB 5FT4A 3E2ZA 2VMUA 3EI6A 3ISLA 2QA3A 2ZP7A 3WGBA 2D65A 4EB7A 3GBXA 3RBLA 1M6SA 2W7JA 3FVSA 2W7GA 4ITXA 4IXOA 4RJ0A 1JG8A 4WYEA 1IUGA 4A0GA 4F5MA 1B5PA 1BJWA 1CJ0A 3HDOA 4BQ0A 4A0FA 4R5ZA 1DGEA 1QISA 3B1DA 4XJLA 5D95A 2W8VA 5EIGB 2X5FA 1M32A 3ELEA 5DX5A 4I8AA 3AATA 4K2MA 3GWPA 4W1WA 1CQ6A 2WK9A 4CXQA 2VMNA 2BWOA 2CSTA 3EZSA 1WYVB 2PB2A 1GC0A 3GETA 1AHFA 2BI5A 2HORA 2VGUA 2VI8A 2ZSMA 2ZC0A 2FNIA 3LVMA 4ZASA 3L44A 3EIBA 5J8QA 3QBOA 1CZCA 4IYOA 4MQQA 2HUFA 1C7GA 1OXPA 1AICA 2BYJA 3DXVA 1BJNA 4J8LA 2BI2A 1ASNA 2CTZA 1TOJA 3AENA 1AY5A 3F9TA 3E9KA 4JF1A 1GC3A 3WX9A 1WYUB 4JEVA 4UOYA 1PMMA 3FFHA 1AMSA 1X28A 1X29A 3N75A 3ATHA 1C0NA 3IF2A 4WXBA 2QSRA 1I48A 4ZSWA 2YHKA 3ZZJA 4IXSA 4RLGA 2ZY2A 5E5IA 3WY7A 3OP7A 1BKGA 3FDDA 3R4TA 1BJ4A 3E2FA 4P3MA 2VMRA 1ELUA 1G4VA 3FZ7A 5G2PA 3DYDA 3DR4A 1S07A 2EYQA 3NX3A 4GDYA 2E54A 2V1PA 2PB0A 4N0WA 1OATA 1C7NA 4XJOA 2AY5A 3PJ0A 4ADEA 1MAPA 1IBJA 4KAMA 4RITA 5G4JA 1FG7A 1CQ8A 2YKVA 1ZC9A 1GBNA 2JGTA 4LW4A 1LC8A 2VMVA 4Q6RA 1W7LA 1YNUA 3JWBA 1UU2A 4BMKA 2C7TA 4AO4A 1WYTA 1YIZA 4OC9A 4UQVA 4WYFA 4WXGA 3NDNA 1D7VA 2W7EA 4DBCA 1ASCA 1OHYA 4WXFA 1C7OA 1WSTA 4MY5A 4CBSA 4ADCA 4MGRA 5DJ9A 2HOYA 1YAAA 1C9CA 4Y0HA 2Z1YA 4WB0A 5M46A 4F4EA 2HOXA 1ASBA 4WB0B 4F5HA 4W5KA 4JE5A 4H63Q 1AAWA 1FG3A 1LW5A 4BHDA 3LWSA 3WGCA 2VGSA 3PDBA 2ZSLA 4PFFA 3OKSA 1CL1A 3FZ6A 4ZSYA 3GJUA 4HVKA 1SFFA 2Z1ZA 1PG8A 3FKDA 4WP0A 1UKJA 2V0YA 3NRAA 5M4BA 1GD9A 2ZYJA 1GC2A 3BCAA 3AEPA 1ARIA 5TF5A 4IYOB 2O7CA 3UE8A 1I43A 1VEFA 1DKAA 3A9ZA 3FVUA 3RBFA 3TQXA 1X0MA 2Z9UA 2XBNA 4BA5A 1I29A 2R5EA 1GDEA 1BT4A 1ZOBA 1TATA 4WD2A 3DC1A 1VJOA 4E3QA 4Q76A 5LHAA 1WKHA 3RQ1A 3E6GA 4BA4A 2VMXA 4M2MA 4AOAA 1SPAA 4DQ6A 7AATA 1AKCA 1AJSA 4A00A 2FM1A 2FNUA 3FFRA 5EUEA 2W7HA 1AY4A 1AX4A 4GE4A 1AHYA 2Z61A 3FQ8A 1IX8A 3R9AA 1PMOA 3NYUA 4AZJA 3QGUA 4MSOA 4ZWVA 3KGXA 4OTLA 3WCOA 4IX8A 1KL2A 5D5SA 4ATQA 1O62A 2AATA 1ARGA 3FQAA 3BN1A 4XK1A 4A0HA 4IY7A 3PD6B 1AKBA 3NUIA 3II0A 2D7ZA 2VGTA 2W8UA 3P1TA 3RCHB 1MLZA 2HOZA 1J32A 1WYUA 1AKAA 3RCHA 3B1CA 2AY4A 1W23A 1EQBA 1AJRA 2W7LA 4MQPA 1CL2A 1TOGA 3E2YA 4DGTA 1MAQA 5G09A 2WB6A 1TOIA 3BWNC 1MDOA 3BB8A 1N2TA 5M49A 2G7JA 2TPLA 1MDZA 5LH9A 1ARHA 2D64A 2X3LA 1SF2A 1SVVA 2Z9XA 3WKRA 3AELA 3P6KA 4UHOA 4JEYA 3BCBA 2D5YA 2Q7WA 4NOGA 4ZM3A 4FFCA 2FQ6A 4EU1A 1RVUA 2OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YCN A;  1G7X A;  1BJO B;  3CQ5 A;  4MKJ A;  1QIR A;  1BS0 A;  2OKJ A;  3AV7 A;  2E7U A;  1CQ7 A;  2EZ1 A;  1ASE A;  3G0T A;  3QM2 A;  2C0R A;  3FZ8 A;  3HT4 A;  3PD6 A;  5F9S A;  1B4X A;  2YRR A;  4ZDL A;  3ZRQ A;  4JEW A;  1U08 A;  3E2Z B;  5G2Q A;  1AMA A;  1D2F A;  4RAE A;  1M4N A;  2YRI A;  2AY2 A;  1ASM A;  2EGY A;  3FVX A;  5F8V A;  1DJE A;  3CQ4 A;  2R2N A;  2W7D A;  2QB2 A;  3G7Q A;  3K40 A;  4OYT A;  4ADD A;  3A9Y A;  4A6U A;  1KMK A;  1B9I A;  2HP2 A;  3G8M A;  3IHJ A;  4P7Y A;  4WLH A;  5FT8 A;  4F5I A;  2CH1 A;  1J04 A;  3EI9 A;  1QJ3 A;  3MAD A;  3Q8N A;  4LNM A;  3LG0 A;  4TV7 A;  2AY9 A;  1IX7 A;  1KMJ A;  2VGZ A;  4ZWM A;  4F5G A;  4KYO A;  2BYL A;  5C6U A;  3MC6 A;  4R2N A;  1ARS A;  3N5M A;  4XAU A;  2E7J A;  3HBX A;  1Z3Z A;  2AEV A;  2O0R A;  3DU4 A;  1LC7 A;  4IXZ A;  4ZM4 A;  1GEY A;  3LVJ A;  2ZY4 A;  3BC8 A;  3T32 A;  2QBT A;  4U2H A;  1Z7D A;  3BV0 A;  3B1E A;  1BW0 A;  1G4X A;  1V72 A;  3HVY A;  3QPG A;  3FQ7 A;  2VMO A;  3CQ6 A;  3AEN B;  4HF8 A;  1S09 A;  4JF0 A;  5E4Z A;  3NUB A;  4R5F A;  2E7I A;  1IVR A;  3H7F A;  3MC6 C;  4RIZ A;  3A8U X;  1H0C A;  1V2F A;  3JTX A;  3MAF A;  2BI9 A;  4RKD A;  4A6R A;  2JG2 A;  3PAA A;  5JAY A;  2VMZ A;  3KGW A;  1MGV A;  1O69 A;  2WK8 A;  3F6T A;  2O1B A;  4B98 A;  1LS3 A;  2WK7 A;  2W8T A;  1C4K A;  3ASB A;  3LV2 A;  1I41 A;  3JW9 A;  2VMS A;  3M5U A;  4GE9 A;  4N0B A;  2VIB A;  4F5F A;  2BWN A;  1Y4I A;  4OT8 A;  4ZLV A;  1W7N A;  1DJU A;  3DZZ A;  1RV3 A;  3K7Y A;  4OMA A;  3ZRP A;  4XQ2 A;  4CXR A;  2DGM A;  1B9H A;  4OCA A;  4Y0D A;  3USF A;  4K2B A;  1G7W A;  5HDM A;  3AEM A;  5DJ1 A;  3NTJ A;  3PGY A;  2CH2 A;  4RM1 A;  1IX6 A;  3KE3 A;  1D7U A;  1M0P A;  2BIA A;  2YKU A;  3MBB A;  3PDX A;  3AOW A;  2CJH A;  5FT6 A;  3RUY A;  2RFV A;  2EH6 A;  3JZL A;  3WKS A;  1D7S A;  5E3K A;  1AHG A;  1GC4 A;  2GMS A;  3FSL A;  4XEW A;  1ASL A;  1M0O A;  3HMU A;  3K28 A;  5FT5 A;  3ELP A;  2VGV A;  1N31 A;  2W7K A;  4RJY A;  4W91 A;  1LW4 A;  1W3U A;  2DKB A;  2VI9 A;  2QLR A;  3VK4 A;  1WYT B;  3AEM C;  4GE7 A;  3MAF B;  4TN4 A;  1IJI A;  4WYA A;  3VOM A;  1ECX A;  4L0O A;  4A6T A;  2VIA A;  4CBR A;  2QMA A;  1AHE A;  4MKK A;  1OXO A;  1SZU A;  2GQN A;  2ZJG A;  5EUD A;  3BWN A;  3EI5 A;  1S06 A;  3KKI A;  4K2I A;  1BQD A;  1BJO A;  2PO3 A;  4XJM A;  4LNJ A;  3EIA A;  2W7I A;  1E5F A;  4F5L A;  4KXK A;  3LVL B;  3GSB A;  4MQR A;  2YKY A;  4R8D A;  3NYS A;  2VMQ A;  2X5D A;  2D61 A;  5EAA A;  3ECD A;  4FL0 A;  3JWA A;  3AOV A;  3B8X A;  1TAR A;  1WKG A;  3VP6 A;  2GB3 A;  3WCN A;  2BHX A;  5M4D A;  2FYF A;  1BQA A;  1ORD A;  1TAS A;  4J5U A;  2JIS A;  4GEB A;  1ZOD A;  2C44 A;  1XEY A;  3EI8 A;  3I16 A;  2BIG A;  1KKJ A;  5G4I A;  3HQT A;  2AY6 A;  4Q75 A;  5EUN A;  3W1J A;  4XJP A;  1ASF A;  3FDB A;  2C81 A;  1XI9 A;  4PFN A;  1RVY A;  4LW2 A;  5IWQ A;  2VYC A;  1YOO A;  5AX8 A;  3AEJ C;  4LNL A;  4W1V A;  3H14 A;  1T3I A;  2VMT A;  2WKA A;  4OBU A;  2ORD A;  5HHY A;  3CAI A;  3UWC A;  2BI3 A;  4Y0I A;  3PDB B;  4ATP A;  3DOD A;  2BIE A;  2VLH A;  4EMY A;  4F5J A;  2EZ2 A;  4QGR A;  1GCK A;  1YJS A;  2OGE A;  3GZD A;  3CBF A;  1FC4 A;  3LVK A;  3VAX A;  3ACZ A;  1CZE A;  3TFT A;  4W1X A;  1AY8 A;  2JJE A;  4GRX A;  1X2A A;  1ASD A;  2YCT A;  3HLM A;  4ZDO A;  2QB3 A;  4ZAH A;  3W1H A;  2ZY5 A;  2CJD A;  3FD0 A;  4F5K A;  5BJ3 A;  5EQC A;  1B8G A;  3MKJ A;  2OQX A;  1EG5 A;  2CIN A;  3EZ1 A;  4M2J A;  4CVQ A;  1CS1 A;  1ASG A;  3GZD C;  3D6K A;  1P3W A;  1S0A A;  4WBT A;  5EIG A;  5DB5 A;  2AY8 A;  1TPL A;  1SZK A;  1DGD A;  2VMW A;  1LC5 A;  3TAT A;  2AEU A;  4EB5 A;  1DJ9 A;  2JJH A;  2DOU A;  2CB1 A;  1ASA A;  2YCP A;  4TMR A;  2VLF A;  1V2E A;  3DR7 A;  1O61 A;  1S08 A;  3MAU A;  4EFF A;  2YOB A;  8AAT A;  1KKP A;  3JU7 A;  3BCX A;  3PPL A;  3L8A A;  3FRK A;  1LK9 A;  3RI6 A;  4W8I A;  4GSA A;  4JEX A;  5EFS A;  1AJS B;  1JS3 A;  3TCM A;  1QJ5 A;  5EAV A;  3FCR A;  4ITG A;  1JS6 A;  2W7F A;  3AEJ A;  2G6W A;  3TFU A;  3E77 A;  2HUI A;  1MLY A;  2DGL A;  4E3R A;  1WYV A;  5K8B A;  3GR9 A;  4B9B A;  9AAT A;  3QI6 A;  1KL1 A;  2D63 A;  4UHN A;  1GEX A;  4WYD A;  1AAM A;  4RKC A;  3DXW A;  3PA9 A;  4A72 A;  1M7Y A;  1YJY A;  1EJI A;  1AMQ A;  4AO9 A;  4WLJ A;  2Z67 A;  3N0L A;  1OHW A;  3NU7 A;  2ZUK A;  4U1T A;  5I92 A;  3A9X A;  1DTY A;  1JF9 A;  3EI7 A;  3I4J A;  4JEZ A;  2ZY3 A;  1QGN A;  2CY8 A;  2EO5 A;  1N8P A;  4AZK A;  2YKX A;  1E5E A;  3HL2 A;  3PIU A;  3BWO A;  1TOE A;  1AIA A;  3BS8 A;  2JJF A;  1UU0 A;  2JJG A;  3ZZK A;  1OHV A;  4PIW A;  4UHM A;  1AMR A;  2VGW A;  5HXX A;  1PFF A;  4IW7 A;  2CFB A;  3UAK A;  3VK2 A;  4WYC A;  1LKC A;  4LC3 A;  3ZRR A;  1W7M A;  2DR1 A;  3DRD A;  1MDX A;  2DKJ A;  3NNK A;  2CJG A;  4PVF A;  4Q31 A;  1QIT A;  2AY1 A;  2CAN A;  4H51 A;  2W7M A;  2D7Y A;  2HP1 A;  1AHX A;  4WYG A;  2AY7 A;  3A2B A;  5G0A A;  3AEO A;  3WZF A;  3VK3 A;  4E1O A;  1UU1 A;  1IAX A;  2FN6 A;  2XH1 A;  4O6Z A;  3W1I A;  2AY3 A;  3B46 A;  2W8W A;  4ADB A;  3COG A;  1VP4 A;  1ART A;  2BWP A;  2EPJ A;  1GEW A;  2D66 A;  2Z9V A;  2R5C A;  1B5O A;  1ELQ A;  2GSA A;  3NYT A;  1YJZ A;  2HZP A;  2W8J A;  5BJ4 A;  1DFO A;  1O4S A;  4JE5 D;  2VMY A;  2F8J A;  3I5T A;  1V2D A;  1TOK A;  4OBV A;  4E77 A;  2X8U A;  2OGA A;  3GZC A;  1AIB A;  1D7R A;  3ASA A;  2BI1 A;  3LY1 A;  2VMP A;  4ISY A;  1YIY A;  2HUU A;  3FTB A;  1IAY A;  2R0T A;  3QN6 A;  4AH3 A;  1H1C A;  1RV4 A;  2NMP A;  2DGK A;  4M2K A;  1M0N A;  1SZS A;  3F0H A;  4ZDP A;  3WLX A;  3MEB A;  2Z20 A;  3NU8 A;  2BKW A;  1M0Q A;  2GMU A;  3QHX A;  2Z9W A;  3EUC A;  4A0R A;  1QZ9 A;  2OAT A;  2R5C B;  5FT4 A;  3E2Z A;  2VMU A;  3EI6 A;  3ISL A;  2QA3 A;  2ZP7 A;  3WGB A;  2D65 A;  4EB7 A;  3GBX A;  3RBL A;  1M6S A;  2W7J A;  3FVS A;  2W7G A;  4ITX A;  4IXO A;  4RJ0 A;  1JG8 A;  4WYE A;  1IUG A;  4A0G A;  4F5M A;  1B5P A;  1BJW A;  1CJ0 A;  3HDO A;  4BQ0 A;  4A0F A;  4R5Z A;  1DGE A;  1QIS A;  3B1D A;  4XJL A;  5D95 A;  2W8V A;  5EIG B;  2X5F A;  1M32 A;  3ELE A;  5DX5 A;  4I8A A;  3AAT A;  4K2M A;  3GWP A;  4W1W A;  1CQ6 A;  2WK9 A;  4CXQ A;  2VMN A;  2BWO A;  2CST A;  3EZS A;  1WYV B;  2PB2 A;  1GC0 A;  3GET A;  1AHF A;  2BI5 A;  2HOR A;  2VGU A;  2VI8 A;  2ZSM A;  2ZC0 A;  2FNI A;  3LVM A;  4ZAS A;  3L44 A;  3EIB A;  5J8Q A;  3QBO A;  1CZC A;  4IYO A;  4MQQ A;  2HUF A;  1C7G A;  1OXP A;  1AIC A;  2BYJ A;  3DXV A;  1BJN A;  4J8L A;  2BI2 A;  1ASN A;  2CTZ A;  1TOJ A;  3AEN A;  1AY5 A;  3F9T A;  3E9K A;  4JF1 A;  1GC3 A;  3WX9 A;  1WYU B;  4JEV A;  4UOY A;  1PMM A;  3FFH A;  1AMS A;  1X28 A;  1X29 A;  3N75 A;  3ATH A;  1C0N A;  3IF2 A;  4WXB A;  1I48 A;  4ZSW A;  2YHK A;  3ZZJ A;  4IXS A;  4RLG A;  2ZY2 A;  5E5I A;  3WY7 A;  3OP7 A;  1BKG A;  3FDD A;  3R4T A;  1BJ4 A;  3E2F A;  4P3M A;  2VMR A;  1ELU A;  1G4V A;  3FZ7 A;  5G2P A;  3DYD A;  3DR4 A;  1S07 A;  3NX3 A;  4GDY A;  2E54 A;  2V1P A;  2PB0 A;  4N0W A;  1OAT A;  1C7N A;  4XJO A;  2AY5 A;  3PJ0 A;  4ADE A;  1MAP A;  1IBJ A;  4KAM A;  4RIT A;  5G4J A;  1FG7 A;  1CQ8 A;  2YKV A;  1ZC9 A;  1GBN A;  2JGT A;  4LW4 A;  1LC8 A;  2VMV A;  4Q6R A;  1W7L A;  1YNU A;  3JWB A;  1UU2 A;  4BMK A;  2C7T A;  4AO4 A;  1WYT A;  1YIZ A;  4OC9 A;  4UQV A;  4WYF A;  4WXG A;  3NDN A;  1D7V A;  2W7E A;  4DBC A;  1ASC A;  1OHY A;  4WXF A;  1C7O A;  1WST A;  4MY5 A;  4CBS A;  4ADC A;  4MGR A;  5DJ9 A;  2HOY A;  1YAA A;  1C9C A;  4Y0H A;  2Z1Y A;  4WB0 A;  5M46 A;  4F4E A;  2HOX A;  1ASB A;  4WB0 B;  4F5H A;  4W5K A;  4JE5 A;  1AAW A;  1FG3 A;  1LW5 A;  4BHD A;  3LWS A;  3WGC A;  2VGS A;  3PDB A;  2ZSL A;  4PFF A;  3OKS A;  1CL1 A;  3FZ6 A;  4ZSY A;  3GJU A;  4HVK A;  1SFF A;  2Z1Z A;  1PG8 A;  3FKD A;  4WP0 A;  1UKJ A;  2V0Y A;  3NRA A;  5M4B A;  1GD9 A;  2ZYJ A;  1GC2 A;  3BCA A;  3AEP A;  1ARI A;  5TF5 A;  4IYO B;  2O7C A;  3UE8 A;  1I43 A;  1VEF A;  1DKA A;  3A9Z A;  3FVU A;  3RBF A;  3TQX A;  1X0M A;  2Z9U A;  2XBN A;  4BA5 A;  1I29 A;  2R5E A;  1GDE A;  1BT4 A;  1ZOB A;  1TAT A;  4WD2 A;  3DC1 A;  1VJO A;  4E3Q A;  4Q76 A;  5LHA A;  1WKH A;  3RQ1 A;  3E6G A;  4BA4 A;  2VMX A;  4M2M A;  4AOA A;  1SPA A;  4DQ6 A;  7AAT A;  1AKC A;  1AJS A;  4A00 A;  2FM1 A;  2FNU A;  3FFR A;  5EUE A;  2W7H A;  1AY4 A;  1AX4 A;  4GE4 A;  1AHY A;  2Z61 A;  3FQ8 A;  1IX8 A;  3R9A A;  1PMO A;  3NYU A;  4AZJ A;  3QGU A;  4MSO A;  4ZWV A;  3KGX A;  4OTL A;  3WCO A;  4IX8 A;  1KL2 A;  5D5S A;  4ATQ A;  1O62 A;  2AAT A;  1ARG A;  3FQA A;  3BN1 A;  4XK1 A;  4A0H A;  4IY7 A;  3PD6 B;  1AKB A;  3NUI A;  3II0 A;  2D7Z A;  2VGT A;  2W8U A;  3P1T A;  3RCH B;  1MLZ A;  2HOZ A;  1J32 A;  1WYU A;  1AKA A;  3RCH A;  3B1C A;  2AY4 A;  1W23 A;  1EQB A;  1AJR A;  2W7L A;  4MQP A;  1CL2 A;  1TOG A;  3E2Y A;  4DGT A;  1MAQ A;  5G09 A;  1TOI A;  3BWN C;  1MDO A;  3BB8 A;  1N2T A;  5M49 A;  2TPL A;  1MDZ A;  5LH9 A;  1ARH A;  2D64 A;  2X3L A;  1SF2 A;  1SVV A;  2Z9X A;  3WKR A;  3AEL A;  3P6K A;  4UHO A;  4JEY A;  3BCB A;  2D5Y A;  2Q7W A;  4NOG A;  4ZM3 A;  4FFC A;  2FQ6 A;  4EU1 A;  1RVU A;  2OKK A; 
#chains in the Genus database with same CATH topology
 2YCN A;  1G7X A;  1BJO B;  3CQ5 A;  4MKJ A;  1QIR A;  1BS0 A;  2OKJ A;  3AV7 A;  2E7U A;  1CQ7 A;  2EZ1 A;  1ASE A;  3G0T A;  3QM2 A;  2C0R A;  3FZ8 A;  3HT4 A;  3PD6 A;  5F9S A;  1B4X A;  2YRR A;  4ZDL A;  3ZRQ A;  4JEW A;  1U08 A;  3E2Z B;  5G2Q A;  1AMA A;  1D2F A;  4RAE A;  1M4N A;  2YRI A;  2AY2 A;  1ASM A;  2EGY A;  3FVX A;  5F8V A;  1DJE A;  3CQ4 A;  2R2N A;  2W7D A;  2QB2 A;  3G7Q A;  3K40 A;  4OYT A;  4ADD A;  3N4X A;  3A9Y A;  4A6U A;  1KMK A;  1B9I A;  2HP2 A;  3N7N A;  3G8M A;  3IHJ A;  4P7Y A;  4WLH A;  5FT8 A;  4F5I A;  2CH1 A;  1J04 A;  3EI9 A;  1QJ3 A;  3MAD A;  3Q8N A;  4LNM A;  3LG0 A;  4TV7 A;  2AY9 A;  1IX7 A;  1KMJ A;  2VGZ A;  4ZWM A;  4F5G A;  4KYO A;  2BYL A;  5C6U A;  3MC6 A;  4R2N A;  1ARS A;  3N5M A;  4XAU A;  2E7J A;  3HBX A;  1Z3Z A;  2AEV A;  2O0R A;  3DU4 A;  1LC7 A;  4IXZ A;  4ZM4 A;  4K05 A;  1GEY A;  3LVJ A;  2ZY4 A;  3BC8 A;  3T32 A;  2QBT A;  4U2H A;  1Z7D A;  3BV0 A;  3B1E A;  1BW0 A;  1G4X A;  1V72 A;  5KTB A;  3HVY A;  3QPG A;  3FQ7 A;  2VMO A;  3CQ6 A;  3AEN B;  4HF8 A;  1S09 A;  4JF0 A;  5E4Z A;  3NUB A;  4R5F A;  2E7I A;  1IVR A;  3H7F A;  3MC6 C;  4RIZ A;  3A8U X;  1H0C A;  1V2F A;  3JTX A;  3MAF A;  2BI9 A;  4RKD A;  4A6R A;  2JG2 A;  3PAA A;  5JAY A;  2VMZ A;  3KGW A;  1MGV A;  1O69 A;  2WK8 A;  3F6T A;  2O1B A;  4B98 A;  1LS3 A;  2WK7 A;  2W8T A;  1C4K A;  3ASB A;  3LV2 A;  1I41 A;  3JW9 A;  2VMS A;  3M5U A;  4GE9 A;  4N0B A;  2VIB A;  4F5F A;  2BWN A;  1Y4I A;  4OT8 A;  4ZLV A;  1W7N A;  1DJU A;  3DZZ A;  1RV3 A;  3K7Y A;  4OMA A;  3ZRP A;  4XQ2 A;  4CXR A;  2DGM A;  1B9H A;  4OCA A;  4Y0D A;  3USF A;  4K2B A;  1G7W A;  5HDM A;  3AEM A;  5DJ1 A;  3NTJ A;  3PGY A;  2CH2 A;  4RM1 A;  1IX6 A;  3KE3 A;  1D7U A;  1M0P A;  2BIA A;  2YKU A;  3MBB A;  3PDX A;  3AOW A;  2CJH A;  5FT6 A;  3RUY A;  2RFV A;  2EH6 A;  3JZL A;  3WKS A;  1D7S A;  5E3K A;  1AHG A;  1GC4 A;  2GMS A;  3FSL A;  4XEW A;  1ASL A;  1M0O A;  3HMU A;  3K28 A;  5FT5 A;  3ELP A;  2VGV A;  1N31 A;  2W7K A;  4RJY A;  4W91 A;  1LW4 A;  1W3U A;  2DKB A;  2VI9 A;  2QLR A;  3VK4 A;  1WYT B;  3AEM C;  4GE7 A;  3MAF B;  4TN4 A;  1IJI A;  4WYA A;  3VOM A;  1ECX A;  4L0O A;  4A6T A;  2VIA A;  4CBR A;  2QMA A;  1AHE A;  4MKK A;  1OXO A;  1SZU A;  2GQN A;  2ZJG A;  5EUD A;  3BWN A;  3EI5 A;  1S06 A;  3KKI A;  4K2I A;  1BQD A;  1BJO A;  2PO3 A;  4XJM A;  3N4S A;  4LNJ A;  3EIA A;  2W7I A;  1E5F A;  3H9X A;  4F5L A;  4KXK A;  3LVL B;  3GSB A;  4MQR A;  2YKY A;  4R8D A;  2A1V A;  3NYS A;  2VMQ A;  2X5D A;  2D61 A;  5EAA A;  3ECD A;  4FL0 A;  3JWA A;  3AOV A;  3B8X A;  1TAR A;  1WKG A;  3VP6 A;  2GB3 A;  3WCN A;  2BHX A;  5M4D A;  2FYF A;  1BQA A;  1ORD A;  1TAS A;  4J5U A;  2JIS A;  4GEB A;  1ZOD A;  2C44 A;  1XEY A;  3EI8 A;  3I16 A;  2BIG A;  1KKJ A;  5G4I A;  3HQT A;  2AY6 A;  4Q75 A;  5EUN A;  3W1J A;  4XJP A;  1ASF A;  3FDB A;  2C81 A;  1XI9 A;  4PFN A;  1RVY A;  4LW2 A;  5IWQ A;  2VYC A;  1YOO A;  5AX8 A;  3AEJ C;  4LNL A;  4W1V A;  3H14 A;  1T3I A;  2VMT A;  2WKA A;  4OBU A;  2ORD A;  5HHY A;  3CAI A;  3UWC A;  2BI3 A;  4Y0I A;  3PDB B;  4ATP A;  3DOD A;  2BIE A;  2VLH A;  4EMY A;  4F5J A;  2EZ2 A;  4QGR A;  1GCK A;  1YJS A;  2OGE A;  3GZD A;  3CBF A;  1FC4 A;  3LVK A;  3VAX A;  3ACZ A;  1CZE A;  3TFT A;  4W1X A;  1AY8 A;  2JJE A;  4GRX A;  1X2A A;  1ASD A;  2YCT A;  3HLM A;  4ZDO A;  2QB3 A;  4ZAH A;  3W1H A;  2ZY5 A;  2CJD A;  3FD0 A;  4F5K A;  5BJ3 A;  5EQC A;  1B8G A;  3MKJ A;  2OQX A;  1EG5 A;  2CIN A;  3EZ1 A;  4M2J A;  4CVQ A;  2FKI A;  1CS1 A;  1ASG A;  3GZD C;  3D6K A;  1P3W A;  1S0A A;  4WBT A;  5EIG A;  5DB5 A;  2AY8 A;  1TPL A;  1SZK A;  1DGD A;  2VMW A;  1LC5 A;  3TAT A;  2AEU A;  4EB5 A;  1DJ9 A;  2JJH A;  2DOU A;  2CB1 A;  1ASA A;  2YCP A;  4TMR A;  2VLF A;  1V2E A;  3DR7 A;  1O61 A;  1S08 A;  3MAU A;  4EFF A;  2YOB A;  8AAT A;  1KKP A;  3JU7 A;  3BCX A;  3PPL A;  3L8A A;  3FRK A;  1LK9 A;  3RI6 A;  4W8I A;  4GSA A;  4JEX A;  5EFS A;  1AJS B;  1JS3 A;  3TCM A;  1QJ5 A;  5EAV A;  3FCR A;  4ITG A;  1JS6 A;  2W7F A;  3AEJ A;  2G6W A;  3TFU A;  3E77 A;  2HUI A;  1MLY A;  2DGL A;  4E3R A;  1WYV A;  5K8B A;  3GR9 A;  4B9B A;  9AAT A;  3QI6 A;  1KL1 A;  2D63 A;  4UHN A;  1GEX A;  4WYD A;  1AAM A;  4RKC A;  3DXW A;  3PA9 A;  4A72 A;  1M7Y A;  1YJY A;  1EJI A;  1AMQ A;  4AO9 A;  4WLJ A;  2Z67 A;  3N0L A;  1OHW A;  3NU7 A;  2ZUK A;  4U1T A;  5I92 A;  3A9X A;  1DTY A;  1JF9 A;  3EI7 A;  3I4J A;  4JEZ A;  2ZY3 A;  1QGN A;  2CY8 A;  2EO5 A;  1N8P A;  4AZK A;  2YKX A;  1E5E A;  3HL2 A;  3PIU A;  3BWO A;  1TOE A;  1AIA A;  3BS8 A;  2JJF A;  1UU0 A;  2JJG A;  3ZZK A;  1OHV A;  4PIW A;  4UHM A;  1AMR A;  2VGW A;  5HXX A;  1PFF A;  4IW7 A;  2CFB A;  3UAK A;  3VK2 A;  4WYC A;  1LKC A;  4LC3 A;  3ZRR A;  1W7M A;  2DR1 A;  3DRD A;  1MDX A;  2DKJ A;  3NNK A;  2CJG A;  4PVF A;  4Q31 A;  1QIT A;  2AY1 A;  2CAN A;  4H51 A;  2W7M A;  2D7Y A;  2HP1 A;  1AHX A;  4WYG A;  2AY7 A;  3A2B A;  5G0A A;  3N4R A;  3AEO A;  3WZF A;  3VK3 A;  4E1O A;  1KAF A;  1UU1 A;  1IAX A;  2FN6 A;  2XH1 A;  4O6Z A;  3W1I A;  2AY3 A;  3B46 A;  2W8W A;  4ADB A;  3COG A;  1VP4 A;  1ART A;  2BWP A;  2EPJ A;  1GEW A;  2D66 A;  2Z9V A;  2R5C A;  1B5O A;  1ELQ A;  2GSA A;  3NYT A;  1YJZ A;  2HZP A;  2W8J A;  5BJ4 A;  1DFO A;  1O4S A;  4JE5 D;  2VMY A;  2F8J A;  3I5T A;  1V2D A;  1TOK A;  4OBV A;  4E77 A;  2X8U A;  2OGA A;  3GZC A;  1AIB A;  1D7R A;  3ASA A;  2BI1 A;  3LY1 A;  2VMP A;  4ISY A;  1YIY A;  2HUU A;  3FTB A;  1IAY A;  2R0T A;  3QN6 A;  4AH3 A;  1H1C A;  1RV4 A;  2NMP A;  2DGK A;  4M2K A;  1M0N A;  1SZS A;  3F0H A;  4ZDP A;  3WLX A;  2KFP A;  3MEB A;  2Z20 A;  3NU8 A;  2BKW A;  1M0Q A;  2GMU A;  3QHX A;  2Z9W A;  3EUC A;  4A0R A;  1QZ9 A;  2OAT A;  2R5C B;  5FT4 A;  3E2Z A;  2VMU A;  3EI6 A;  3ISL A;  2QA3 A;  2ZP7 A;  3WGB A;  2D65 A;  4EB7 A;  3GBX A;  3RBL A;  1M6S A;  2W7J A;  3FVS A;  2W7G A;  4ITX A;  4IXO A;  4RJ0 A;  1JG8 A;  4WYE A;  1IUG A;  4A0G A;  4F5M A;  1B5P A;  1BJW A;  1CJ0 A;  3HDO A;  4BQ0 A;  4A0F A;  4R5Z A;  1DGE A;  1QIS A;  3B1D A;  4XJL A;  5D95 A;  2W8V A;  5EIG B;  2X5F A;  1M32 A;  3ELE A;  5DX5 A;  4I8A A;  3AAT A;  4K2M A;  3GWP A;  4W1W A;  1CQ6 A;  2WK9 A;  4CXQ A;  2VMN A;  2BWO A;  2CST A;  3EZS A;  1WYV B;  2PB2 A;  1GC0 A;  3GET A;  1AHF A;  2BI5 A;  2HOR A;  2VGU A;  2VI8 A;  2ZSM A;  2ZC0 A;  2FNI A;  3LVM A;  4ZAS A;  3L44 A;  3EIB A;  5J8Q A;  3QBO A;  1CZC A;  4IYO A;  4MQQ A;  2HUF A;  1C7G A;  1OXP A;  1AIC A;  2BYJ A;  3DXV A;  1BJN A;  4J8L A;  2BI2 A;  1ASN A;  2CTZ A;  1TOJ A;  3AEN A;  1AY5 A;  3F9T A;  3E9K A;  4JF1 A;  1GC3 A;  3WX9 A;  1WYU B;  4JEV A;  4UOY A;  1PMM A;  3FFH A;  1AMS A;  1X28 A;  1X29 A;  3N75 A;  3ATH A;  1C0N A;  3IF2 A;  4WXB A;  2QSR A;  1I48 A;  4ZSW A;  2YHK A;  3ZZJ A;  4IXS A;  4RLG A;  2ZY2 A;  5E5I A;  3WY7 A;  3OP7 A;  1BKG A;  3FDD A;  3R4T A;  1BJ4 A;  3E2F A;  4P3M A;  2VMR A;  1ELU A;  1G4V A;  3FZ7 A;  5G2P A;  3DYD A;  3DR4 A;  1S07 A;  2EYQ A;  3NX3 A;  4GDY A;  2E54 A;  2V1P A;  2PB0 A;  4N0W A;  1OAT A;  1C7N A;  4XJO A;  2AY5 A;  3PJ0 A;  4ADE A;  1MAP A;  1IBJ A;  4KAM A;  4RIT A;  5G4J A;  1FG7 A;  1CQ8 A;  2YKV A;  1ZC9 A;  1GBN A;  2JGT A;  4LW4 A;  1LC8 A;  2VMV A;  4Q6R A;  1W7L A;  1YNU A;  3JWB A;  1UU2 A;  4BMK A;  2C7T A;  4AO4 A;  1WYT A;  1YIZ A;  4OC9 A;  4UQV A;  4WYF A;  4WXG A;  3NDN A;  1D7V A;  2W7E A;  4DBC A;  1ASC A;  1OHY A;  4WXF A;  1C7O A;  1WST A;  4MY5 A;  4CBS A;  4ADC A;  4MGR A;  5DJ9 A;  2HOY A;  1YAA A;  1C9C A;  4Y0H A;  2Z1Y A;  4WB0 A;  5M46 A;  4F4E A;  2HOX A;  1ASB A;  4WB0 B;  4F5H A;  4W5K A;  4JE5 A;  4H63 Q;  1AAW A;  1FG3 A;  1LW5 A;  4BHD A;  3LWS A;  3WGC A;  2VGS A;  3PDB A;  2ZSL A;  4PFF A;  3OKS A;  1CL1 A;  3FZ6 A;  4ZSY A;  3GJU A;  4HVK A;  1SFF A;  2Z1Z A;  1PG8 A;  3FKD A;  4WP0 A;  1UKJ A;  2V0Y A;  3NRA A;  5M4B A;  1GD9 A;  2ZYJ A;  1GC2 A;  3BCA A;  3AEP A;  1ARI A;  5TF5 A;  4IYO B;  2O7C A;  3UE8 A;  1I43 A;  1VEF A;  1DKA A;  3A9Z A;  3FVU A;  3RBF A;  3TQX A;  1X0M A;  2Z9U A;  2XBN A;  4BA5 A;  1I29 A;  2R5E A;  1GDE A;  1BT4 A;  1ZOB A;  1TAT A;  4WD2 A;  3DC1 A;  1VJO A;  4E3Q A;  4Q76 A;  5LHA A;  1WKH A;  3RQ1 A;  3E6G A;  4BA4 A;  2VMX A;  4M2M A;  4AOA A;  1SPA A;  4DQ6 A;  7AAT A;  1AKC A;  1AJS A;  4A00 A;  2FM1 A;  2FNU A;  3FFR A;  5EUE A;  2W7H A;  1AY4 A;  1AX4 A;  4GE4 A;  1AHY A;  2Z61 A;  3FQ8 A;  1IX8 A;  3R9A A;  1PMO A;  3NYU A;  4AZJ A;  3QGU A;  4MSO A;  4ZWV A;  3KGX A;  4OTL A;  3WCO A;  4IX8 A;  1KL2 A;  5D5S A;  4ATQ A;  1O62 A;  2AAT A;  1ARG A;  3FQA A;  3BN1 A;  4XK1 A;  4A0H A;  4IY7 A;  3PD6 B;  1AKB A;  3NUI A;  3II0 A;  2D7Z A;  2VGT A;  2W8U A;  3P1T A;  3RCH B;  1MLZ A;  2HOZ A;  1J32 A;  1WYU A;  1AKA A;  3RCH A;  3B1C A;  2AY4 A;  1W23 A;  1EQB A;  1AJR A;  2W7L A;  4MQP A;  1CL2 A;  1TOG A;  3E2Y A;  4DGT A;  1MAQ A;  5G09 A;  2WB6 A;  1TOI A;  3BWN C;  1MDO A;  3BB8 A;  1N2T A;  5M49 A;  2G7J A;  2TPL A;  1MDZ A;  5LH9 A;  1ARH A;  2D64 A;  2X3L A;  1SF2 A;  1SVV A;  2Z9X A;  3WKR A;  3AEL A;  3P6K A;  4UHO A;  4JEY A;  3BCB A;  2D5Y A;  2Q7W A;  4NOG A;  4ZM3 A;  4FFC A;  2FQ6 A;  4EU1 A;  1RVU A;  2OKK A; 
#chains in the Genus database with same CATH homology
 2YCN A;  1G7X A;  1BJO B;  3CQ5 A;  4MKJ A;  1QIR A;  1BS0 A;  2OKJ A;  3AV7 A;  2E7U A;  1CQ7 A;  2EZ1 A;  1ASE A;  3G0T A;  3QM2 A;  2C0R A;  3FZ8 A;  3HT4 A;  3PD6 A;  5F9S A;  1B4X A;  2YRR A;  4ZDL A;  3ZRQ A;  4JEW A;  1U08 A;  3E2Z B;  5G2Q A;  1AMA A;  1D2F A;  4RAE A;  1M4N A;  2YRI A;  2AY2 A;  1ASM A;  2EGY A;  3FVX A;  5F8V A;  1DJE A;  3CQ4 A;  2R2N A;  2W7D A;  2QB2 A;  3G7Q A;  3K40 A;  4OYT A;  4ADD A;  3N4X A;  3A9Y A;  4A6U A;  1KMK A;  1B9I A;  2HP2 A;  3N7N A;  3G8M A;  3IHJ A;  4P7Y A;  4WLH A;  5FT8 A;  4F5I A;  2CH1 A;  1J04 A;  3EI9 A;  1QJ3 A;  3MAD A;  3Q8N A;  4LNM A;  3LG0 A;  4TV7 A;  2AY9 A;  1IX7 A;  1KMJ A;  2VGZ A;  4ZWM A;  4F5G A;  4KYO A;  2BYL A;  5C6U A;  3MC6 A;  4R2N A;  1ARS A;  3N5M A;  4XAU A;  2E7J A;  3HBX A;  1Z3Z A;  2AEV A;  2O0R A;  3DU4 A;  1LC7 A;  4IXZ A;  4ZM4 A;  4K05 A;  1GEY A;  3LVJ A;  2ZY4 A;  3BC8 A;  3T32 A;  2QBT A;  4U2H A;  1Z7D A;  3BV0 A;  3B1E A;  1BW0 A;  1G4X A;  1V72 A;  5KTB A;  3HVY A;  3QPG A;  3FQ7 A;  2VMO A;  3CQ6 A;  3AEN B;  4HF8 A;  1S09 A;  4JF0 A;  5E4Z A;  3NUB A;  4R5F A;  2E7I A;  1IVR A;  3H7F A;  3MC6 C;  4RIZ A;  3A8U X;  1H0C A;  1V2F A;  3JTX A;  3MAF A;  2BI9 A;  4RKD A;  4A6R A;  2JG2 A;  3PAA A;  5JAY A;  2VMZ A;  3KGW A;  1MGV A;  1O69 A;  2WK8 A;  3F6T A;  2O1B A;  4B98 A;  1LS3 A;  2WK7 A;  2W8T A;  1C4K A;  3ASB A;  3LV2 A;  1I41 A;  3JW9 A;  2VMS A;  3M5U A;  4GE9 A;  4N0B A;  2VIB A;  4F5F A;  2BWN A;  1Y4I A;  4OT8 A;  4ZLV A;  1W7N A;  1DJU A;  3DZZ A;  1RV3 A;  3K7Y A;  4OMA A;  3ZRP A;  4XQ2 A;  4CXR A;  2DGM A;  1B9H A;  4OCA A;  4Y0D A;  3USF A;  4K2B A;  1G7W A;  5HDM A;  3AEM A;  5DJ1 A;  3NTJ A;  3PGY A;  2CH2 A;  4RM1 A;  1IX6 A;  3KE3 A;  1D7U A;  1M0P A;  2BIA A;  2YKU A;  3MBB A;  3PDX A;  3AOW A;  2CJH A;  5FT6 A;  3RUY A;  2RFV A;  2EH6 A;  3JZL A;  3WKS A;  1D7S A;  5E3K A;  1AHG A;  1GC4 A;  2GMS A;  3FSL A;  4XEW A;  1ASL A;  1M0O A;  3HMU A;  3K28 A;  5FT5 A;  3ELP A;  2VGV A;  1N31 A;  2W7K A;  4RJY A;  4W91 A;  1LW4 A;  1W3U A;  2DKB A;  2VI9 A;  2QLR A;  3VK4 A;  1WYT B;  3AEM C;  4GE7 A;  3MAF B;  4TN4 A;  1IJI A;  4WYA A;  3VOM A;  1ECX A;  4L0O A;  4A6T A;  2VIA A;  4CBR A;  2QMA A;  1AHE A;  4MKK A;  1OXO A;  1SZU A;  2GQN A;  2ZJG A;  5EUD A;  3BWN A;  3EI5 A;  1S06 A;  3KKI A;  4K2I A;  1BQD A;  1BJO A;  2PO3 A;  4XJM A;  3N4S A;  4LNJ A;  3EIA A;  2W7I A;  1E5F A;  3H9X A;  4F5L A;  4KXK A;  3LVL B;  3GSB A;  4MQR A;  2YKY A;  4R8D A;  2A1V A;  3NYS A;  2VMQ A;  2X5D A;  2D61 A;  5EAA A;  3ECD A;  4FL0 A;  3JWA A;  3AOV A;  3B8X A;  1TAR A;  1WKG A;  3VP6 A;  2GB3 A;  3WCN A;  2BHX A;  5M4D A;  2FYF A;  1BQA A;  1ORD A;  1TAS A;  4J5U A;  2JIS A;  4GEB A;  1ZOD A;  2C44 A;  1XEY A;  3EI8 A;  3I16 A;  2BIG A;  1KKJ A;  5G4I A;  3HQT A;  2AY6 A;  4Q75 A;  5EUN A;  3W1J A;  4XJP A;  1ASF A;  3FDB A;  2C81 A;  1XI9 A;  4PFN A;  1RVY A;  4LW2 A;  5IWQ A;  2VYC A;  1YOO A;  5AX8 A;  3AEJ C;  4LNL A;  4W1V A;  3H14 A;  1T3I A;  2VMT A;  2WKA A;  4OBU A;  2ORD A;  5HHY A;  3CAI A;  3UWC A;  2BI3 A;  4Y0I A;  3PDB B;  4ATP A;  3DOD A;  2BIE A;  2VLH A;  4EMY A;  4F5J A;  2EZ2 A;  4QGR A;  1GCK A;  1YJS A;  2OGE A;  3GZD A;  3CBF A;  1FC4 A;  3LVK A;  3VAX A;  3ACZ A;  1CZE A;  3TFT A;  4W1X A;  1AY8 A;  2JJE A;  4GRX A;  1X2A A;  1ASD A;  2YCT A;  3HLM A;  4ZDO A;  2QB3 A;  4ZAH A;  3W1H A;  2ZY5 A;  2CJD A;  3FD0 A;  4F5K A;  5BJ3 A;  5EQC A;  1B8G A;  3MKJ A;  2OQX A;  1EG5 A;  2CIN A;  3EZ1 A;  4M2J A;  4CVQ A;  2FKI A;  1CS1 A;  1ASG A;  3GZD C;  3D6K A;  1P3W A;  1S0A A;  4WBT A;  5EIG A;  5DB5 A;  2AY8 A;  1TPL A;  1SZK A;  1DGD A;  2VMW A;  1LC5 A;  3TAT A;  2AEU A;  4EB5 A;  1DJ9 A;  2JJH A;  2DOU A;  2CB1 A;  1ASA A;  2YCP A;  4TMR A;  2VLF A;  1V2E A;  3DR7 A;  1O61 A;  1S08 A;  3MAU A;  4EFF A;  2YOB A;  8AAT A;  1KKP A;  3JU7 A;  3BCX A;  3PPL A;  3L8A A;  3FRK A;  1LK9 A;  3RI6 A;  4W8I A;  4GSA A;  4JEX A;  5EFS A;  1AJS B;  1JS3 A;  3TCM A;  1QJ5 A;  5EAV A;  3FCR A;  4ITG A;  1JS6 A;  2W7F A;  3AEJ A;  2G6W A;  3TFU A;  3E77 A;  2HUI A;  1MLY A;  2DGL A;  4E3R A;  1WYV A;  5K8B A;  3GR9 A;  4B9B A;  9AAT A;  3QI6 A;  1KL1 A;  2D63 A;  4UHN A;  1GEX A;  4WYD A;  1AAM A;  4RKC A;  3DXW A;  3PA9 A;  4A72 A;  1M7Y A;  1YJY A;  1EJI A;  1AMQ A;  4AO9 A;  4WLJ A;  2Z67 A;  3N0L A;  1OHW A;  3NU7 A;  2ZUK A;  4U1T A;  5I92 A;  3A9X A;  1DTY A;  1JF9 A;  3EI7 A;  3I4J A;  4JEZ A;  2ZY3 A;  1QGN A;  2CY8 A;  2EO5 A;  1N8P A;  4AZK A;  2YKX A;  1E5E A;  3HL2 A;  3PIU A;  3BWO A;  1TOE A;  1AIA A;  3BS8 A;  2JJF A;  1UU0 A;  2JJG A;  3ZZK A;  1OHV A;  4PIW A;  4UHM A;  1AMR A;  2VGW A;  5HXX A;  1PFF A;  4IW7 A;  2CFB A;  3UAK A;  3VK2 A;  4WYC A;  1LKC A;  4LC3 A;  3ZRR A;  1W7M A;  2DR1 A;  3DRD A;  1MDX A;  2DKJ A;  3NNK A;  2CJG A;  4PVF A;  4Q31 A;  1QIT A;  2AY1 A;  2CAN A;  4H51 A;  2W7M A;  2D7Y A;  2HP1 A;  1AHX A;  4WYG A;  2AY7 A;  3A2B A;  5G0A A;  3N4R A;  3AEO A;  3WZF A;  3VK3 A;  4E1O A;  1UU1 A;  1IAX A;  2FN6 A;  2XH1 A;  4O6Z A;  3W1I A;  2AY3 A;  3B46 A;  2W8W A;  4ADB A;  3COG A;  1VP4 A;  1ART A;  2BWP A;  2EPJ A;  1GEW A;  2D66 A;  2Z9V A;  2R5C A;  1B5O A;  1ELQ A;  2GSA A;  3NYT A;  1YJZ A;  2HZP A;  2W8J A;  5BJ4 A;  1DFO A;  1O4S A;  4JE5 D;  2VMY A;  2F8J A;  3I5T A;  1V2D A;  1TOK A;  4OBV A;  4E77 A;  2X8U A;  2OGA A;  3GZC A;  1AIB A;  1D7R A;  3ASA A;  2BI1 A;  3LY1 A;  2VMP A;  4ISY A;  1YIY A;  2HUU A;  3FTB A;  1IAY A;  2R0T A;  3QN6 A;  4AH3 A;  1H1C A;  1RV4 A;  2NMP A;  2DGK A;  4M2K A;  1M0N A;  1SZS A;  3F0H A;  4ZDP A;  3WLX A;  2KFP A;  3MEB A;  2Z20 A;  3NU8 A;  2BKW A;  1M0Q A;  2GMU A;  3QHX A;  2Z9W A;  3EUC A;  4A0R A;  1QZ9 A;  2OAT A;  2R5C B;  5FT4 A;  3E2Z A;  2VMU A;  3EI6 A;  3ISL A;  2QA3 A;  2ZP7 A;  3WGB A;  2D65 A;  4EB7 A;  3GBX A;  3RBL A;  1M6S A;  2W7J A;  3FVS A;  2W7G A;  4ITX A;  4IXO A;  4RJ0 A;  1JG8 A;  4WYE A;  1IUG A;  4A0G A;  4F5M A;  1B5P A;  1BJW A;  1CJ0 A;  3HDO A;  4BQ0 A;  4A0F A;  4R5Z A;  1DGE A;  1QIS A;  3B1D A;  4XJL A;  5D95 A;  2W8V A;  5EIG B;  2X5F A;  1M32 A;  3ELE A;  5DX5 A;  4I8A A;  3AAT A;  4K2M A;  3GWP A;  4W1W A;  1CQ6 A;  2WK9 A;  4CXQ A;  2VMN A;  2BWO A;  2CST A;  3EZS A;  1WYV B;  2PB2 A;  1GC0 A;  3GET A;  1AHF A;  2BI5 A;  2HOR A;  2VGU A;  2VI8 A;  2ZSM A;  2ZC0 A;  2FNI A;  3LVM A;  4ZAS A;  3L44 A;  3EIB A;  5J8Q A;  3QBO A;  1CZC A;  4IYO A;  4MQQ A;  2HUF A;  1C7G A;  1OXP A;  1AIC A;  2BYJ A;  3DXV A;  1BJN A;  4J8L A;  2BI2 A;  1ASN A;  2CTZ A;  1TOJ A;  3AEN A;  1AY5 A;  3F9T A;  3E9K A;  4JF1 A;  1GC3 A;  3WX9 A;  1WYU B;  4JEV A;  4UOY A;  1PMM A;  3FFH A;  1AMS A;  1X28 A;  1X29 A;  3N75 A;  3ATH A;  1C0N A;  3IF2 A;  4WXB A;  2QSR A;  1I48 A;  4ZSW A;  2YHK A;  3ZZJ A;  4IXS A;  4RLG A;  2ZY2 A;  5E5I A;  3WY7 A;  3OP7 A;  1BKG A;  3FDD A;  3R4T A;  1BJ4 A;  3E2F A;  4P3M A;  2VMR A;  1ELU A;  1G4V A;  3FZ7 A;  5G2P A;  3DYD A;  3DR4 A;  1S07 A;  2EYQ A;  3NX3 A;  4GDY A;  2E54 A;  2V1P A;  2PB0 A;  4N0W A;  1OAT A;  1C7N A;  4XJO A;  2AY5 A;  3PJ0 A;  4ADE A;  1MAP A;  1IBJ A;  4KAM A;  4RIT A;  5G4J A;  1FG7 A;  1CQ8 A;  2YKV A;  1ZC9 A;  1GBN A;  2JGT A;  4LW4 A;  1LC8 A;  2VMV A;  4Q6R A;  1W7L A;  1YNU A;  3JWB A;  1UU2 A;  4BMK A;  2C7T A;  4AO4 A;  1WYT A;  1YIZ A;  4OC9 A;  4UQV A;  4WYF A;  4WXG A;  3NDN A;  1D7V A;  2W7E A;  4DBC A;  1ASC A;  1OHY A;  4WXF A;  1C7O A;  1WST A;  4MY5 A;  4CBS A;  4ADC A;  4MGR A;  5DJ9 A;  2HOY A;  1YAA A;  1C9C A;  4Y0H A;  2Z1Y A;  4WB0 A;  5M46 A;  4F4E A;  2HOX A;  1ASB A;  4WB0 B;  4F5H A;  4W5K A;  4JE5 A;  4H63 Q;  1AAW A;  1FG3 A;  1LW5 A;  4BHD A;  3LWS A;  3WGC A;  2VGS A;  3PDB A;  2ZSL A;  4PFF A;  3OKS A;  1CL1 A;  3FZ6 A;  4ZSY A;  3GJU A;  4HVK A;  1SFF A;  2Z1Z A;  1PG8 A;  3FKD A;  4WP0 A;  1UKJ A;  2V0Y A;  3NRA A;  5M4B A;  1GD9 A;  2ZYJ A;  1GC2 A;  3BCA A;  3AEP A;  1ARI A;  5TF5 A;  4IYO B;  2O7C A;  3UE8 A;  1I43 A;  1VEF A;  1DKA A;  3A9Z A;  3FVU A;  3RBF A;  3TQX A;  1X0M A;  2Z9U A;  2XBN A;  4BA5 A;  1I29 A;  2R5E A;  1GDE A;  1BT4 A;  1ZOB A;  1TAT A;  4WD2 A;  3DC1 A;  1VJO A;  4E3Q A;  4Q76 A;  5LHA A;  1WKH A;  3RQ1 A;  3E6G A;  4BA4 A;  2VMX A;  4M2M A;  4AOA A;  1SPA A;  4DQ6 A;  7AAT A;  1AKC A;  1AJS A;  4A00 A;  2FM1 A;  2FNU A;  3FFR A;  5EUE A;  2W7H A;  1AY4 A;  1AX4 A;  4GE4 A;  1AHY A;  2Z61 A;  3FQ8 A;  1IX8 A;  3R9A A;  1PMO A;  3NYU A;  4AZJ A;  3QGU A;  4MSO A;  4ZWV A;  3KGX A;  4OTL A;  3WCO A;  4IX8 A;  1KL2 A;  5D5S A;  4ATQ A;  1O62 A;  2AAT A;  1ARG A;  3FQA A;  3BN1 A;  4XK1 A;  4A0H A;  4IY7 A;  3PD6 B;  1AKB A;  3NUI A;  3II0 A;  2D7Z A;  2VGT A;  2W8U A;  3P1T A;  3RCH B;  1MLZ A;  2HOZ A;  1J32 A;  1WYU A;  1AKA A;  3RCH A;  3B1C A;  2AY4 A;  1W23 A;  1EQB A;  1AJR A;  2W7L A;  4MQP A;  1CL2 A;  1TOG A;  3E2Y A;  4DGT A;  1MAQ A;  5G09 A;  2WB6 A;  1TOI A;  3BWN C;  1MDO A;  3BB8 A;  1N2T A;  5M49 A;  2G7J A;  2TPL A;  1MDZ A;  5LH9 A;  1ARH A;  2D64 A;  2X3L A;  1SF2 A;  1SVV A;  2Z9X A;  3WKR A;  3AEL A;  3P6K A;  4UHO A;  4JEY A;  3BCB A;  2D5Y A;  2Q7W A;  4NOG A;  4ZM3 A;  4FFC A;  2FQ6 A;  4EU1 A;  1RVU A;  2OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...