4GEEA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
molecule keywords DNA gyrase subunit B
molecule tags Isomerase/isomerase inhibitor
source organism Enterococcus faecalis
total genus 59
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4geeA00
1Y8PA 1GJVA 2XJXA 1Z59A 2XX5A 5D7CA 3H4LA 2FYPA 3D2RA 4O07A 3GIGA 4PRVA 1Y8NA 1NHJA 2WI2A 3FT8A 4E01A 2YI5A 3R4PA 5L3JA 4P8OA 3A0TA 3A0WA 5J6AA 4BAEA 1BYQA 2WI1A 4KQVA 2WI4A 1AJ6A 1ZXMA 2YE6A 4E00A 4XITA 3GIEA 2CCTA 3RLPA 5IDMA 3G7EA 1MX0A 2YI7A 1YT2A 4YKYA 4LWEA 4XDMA 4L93A 2VW5A 2UWDA 4FPPA 4YKWA 1YS3A 4ASGA 4ZKIA 4Q20A 1I5AA 3Q5KA 2AKPA 3C11A 4MP2A 1UY7A 2O1UA 3K99A 1UY9A 2IORA 4UROA 1YT0A 2BSMA 5FNDA 3TZ0A 3Q5LA 4YKXA 5F5RA 3PEHA 3A0ZA 4XIRA 3TTZA 3TZ2A 3QDDA 1UYCA 2O1VA 2ESAA 5M4EA 2BU2A 4HZ0A 3INXA 4O05A 4MPNA 4XCLA 4XIPA 3B24A 1Y8OA 4XTJA 3RKZA 3B26A 2YE2A 1U2OA 3PEJA 1TH8A 1B62A 1QZRA 1UY8A 2QFOA 2YKBA 2BT0A 2VCIA 2CG9A 2XJGA 4EFTA 4WUDA 2YGEA 1UYLA 3K97A 4KTNA 3VHAA 3VHDA 4HXZA 4QPJA 1UYMA 3HYYA 2WI6A 2XHTA 3O0IA 2CCUA 1Y4SA 4EGHA 2YEFA 2BTZA 4L91A 2YGAA 2YK9A 3CWVA 4EMVA 1YERA 1ZWHA 3VHCA 4JASA 2CH4A 2YKJA 4L8ZA 3G7BA 5BODA 4H81A 3T0ZA 1AH6A 1S14A 4EFUA 2H8MA 2YE7A 1B63A 2YKIA 4WUCA 4BIUA 1YETA 3O6OA 1YT1A 2BREA 1H7UA 2Q8IA 4YKUA 2YGFA 3WQ9A 3OW6A 3FT5A 1L0OA 2JJCA 1UYDA 1AMWA 3U2KA 2YEAA 3HEKA 3O2FA 4PRXA 4XE2A 3T10A 1Z5AA 1I5BA 5CF0A 2HKJA 2IWXA 3A0RA 1YC4A 2BYIA 4AWPA 3NMQA 1BKNA 2YEEA 4ASAA 4CWTA 3HYZA 4LWIA 4XD8A 5CTUA 1AH8A 3A0YA 1EA6A 1YSZA 3RLRA 4I3HA 2YJWA 2CGFA 1A4HA 2WEQA 4V26A 1QY8A 3OWDA 4BQGA 1H7SA 1QYEA 4R3AA 3R4MA 4GFNA 2YK2A 2BRCA 4EGKA 5C93A 2H55A 4HZ5A 5D7DA 2XK2A 1UY6A 4O09A 4X9LA 2HG1A 4JAVA 2FXSA 2GQPA 1NHHA 4CWQA 4XIQA 3KE6A 2QF6A 2XABA 5IDJA 1ZXNA 1UYEA 4HYMA 5D6QA 4PU9A 1KZNA 5CPHA 1GKXA 4GGLA 4XKAA 2XDLA 4HY6A 3JZ3A 2QG2A 4URMA 3HHUA 2YEBA 2XCMA 3H80A 4WUBA 3T1KA 3ZKBA 4EEHA 1YC3A 3K98A 2E0AA 5BOCA 4FCRA 4AS9A 4YKRA 3LNUA 5GGZA 1JM6A 2XDSA 3D0BA 1Z5CA 2XHRA 4LWGA 3Q5JA 4NH8A 4CE2A 5M4MA 2VWCA 4KSGA 1TC0A 3VADA 3ZM7A 4EGIA 2YE8A 3OWBA 2Q8HA 4CE3A 2YI6A 4LP0A 3B28A 2FWZA 4LWHA 4LPBA 1TC6A 3OPDA 1GKZA 2XX2A 2WI3A 2YEGA 3IEDA 3B25A 4HYPA 2XHXA 1US7A 3INWA 4GT8A 4EM7A 1U0ZA 4U93A 3CGYA 4O04A 4R1FA 4KP4A 4MB9A 2YE9A 4URNA 5M4KA 4K4OA 4I5SA 4U7OA 4MBCA 4W7TA 4CWPA 5CTWA 1Z5BA 4CWNA 3U67A 3U2DA 2BZ5A 1YESA 4QPKA 2ZDYA 4GQTA 2XDKA 4NH9A 2XX4A 2IWUA 2PNRA 2YEJA 1I58A 2FWYA 1TBWA 4MPCA 2HCHA 4CWSA 1ID0A 3EHFA 3TZ4A 2YI0A 2C2AA 4FCPA 4U7NA 4B6CA 2BU8A 2IOPA 4XC0A 4BIZA 5FNCA 3QTFA 3HZ1A 3ZXOA 2Q8GA 4L94A 3R91A 4CWRA 1KIJA 4FMTA 4YKZA 4PL9A 2IWSA 3C0EA 2YJXA 3ZXQA 4CWFA 1OSFA 3LPSA 4XCJA 4AWQA 5IN9A 2VCJA 2JKIA 2ZKJA 1UYFA 2YE4A 3EHGA 3TUHA 4DZYA 1MU5A 4JQLA 4HY1A 1NHIA 3BM9A 3CRLA 2BU6A 2K5BA 4CE1A 2EXLA 3SL2A 5FWKA 3K60A 1EI1A 3HZ5A 5CTXA 4V25A 1AM1A 1Y4UA 3GIFA 3D36A 1YSRA 1I5DA 5M4PA 3R4NA 3T2SA 3BMYA 3DGEA 2O1WA 4GCZA 1B3QA 3ZKDA 1ZW9A 4O0BA 4B7PA 3R92A 1BXDA 5M4NA 3G75A 5FNFA 2XD6A 3MNRP 5J71A 4KSHA 1THNA 4R3MA 1TIDA 3GIGB 4YKTA 4P7AA 4NH7A 5D7RA 4DUHA 4BXIA 4ZVIA 4KFGA 2ZBKB 2WERA 4E02A 3T0HA 4MPEA 3R4OA 2YEDA 4GEEA 3CRKA 5F3KA 2YE5A 4JAUA 2BU7A 3B27A 3EHJA 3OMUA 1R62A 4AWOA 2BYHA 2Q8FA 3TZ5A 2GFDA 2ZDXA 5M4HA 4CWOA 1PVGA 1I59A 2IOQA 2XDUA 3CGZA 3WHAA 2QG0A 4H85A 2XDXA 1TILA 2WI5A 2XJJA 1UYHA 3A0XA 4H7QA 1UYGA 4L90A 2YEHA 3EHHA 4XKOA 4XKKA 1UYKA 2YECA 2YEIA 2YKEA 4ASFA 2WEPA 4HXWA 2WI7A 4ASBA 2Q2EB 1I5CA 2YKCA 1UYIA 2CCSA 3EKOA 2BU5A 4YKQA 1BGQA 1S16A 2YE3A 3EKRA 4URLA 1YC1A 4LWFA 5CTYA 4BQJA 5D6PA 3FV5A 4FCQA 3RLQA 4MOTA 4MP7A
chains in the Genus database with same CATH superfamily
1Y8PA 1GJVA 2XJXA 1Z59A 2XX5A 5D7CA 3H4LA 2FYPA 3D2RA 4O07A 3GIGA 4PRVA 1Y8NA 1NHJA 2WI2A 3FT8A 4E01A 2YI5A 3R4PA 5L3JA 4P8OA 3A0TA 3A0WA 5J6AA 4BAEA 1BYQA 2WI1A 4KQVA 2WI4A 1AJ6A 1ZXMA 2YE6A 4E00A 4XITA 2C1GA 3GIEA 2CCTA 3RLPA 5IDMA 3G7EA 1MX0A 2YI7A 1YT2A 4YKYA 4LWEA 4XDMA 4L93A 2VW5A 2UWDA 4FPPA 4YKWA 1YS3A 4ASGA 4ZKIA 4Q20A 1I5AA 3Q5KA 2AKPA 3C11A 4MP2A 1UY7A 2O1UA 3K99A 1UY9A 2IORA 4UROA 1YT0A 2BSMA 5FNDA 3TZ0A 3Q5LA 4YKXA 5F5RA 3PEHA 3A0ZA 4XIRA 3TTZA 3TZ2A 3QDDA 1UYCA 2O1VA 2ESAA 5M4EA 2BU2A 4HZ0A 3INXA 4O05A 4MPNA 4XCLA 4XIPA 3B24A 4E72A 1Y8OA 4XTJA 3RKZA 3B26A 2YE2A 1U2OA 3PEJA 3CYGA 1TH8A 1B62A 1QZRA 1UY8A 2QFOA 2YKBA 2BT0A 2VCIA 2CG9A 2XJGA 4EFTA 4WUDA 2YGEA 1UYLA 3K97A 4KTNA 3VHAA 3VHDA 4HXZA 4QPJA 1UYMA 3HYYA 2WI6A 2XHTA 3O0IA 2CCUA 3S5TA 1IXMA 1Y4SA 4EGHA 2YEFA 2BTZA 4L91A 2YGAA 2YK9A 3CWVA 4EMVA 1YERA 1ZWHA 3VHCA 4JASA 2CH4A 2YKJA 4L8ZA 3G7BA 5BODA 4H81A 3T0ZA 1AH6A 1S14A 4EFUA 2H8MA 2YE7A 1B63A 2YKIA 4WUCA 4BIUA 1YETA 3O6OA 1YT1A 2BREA 1H7UA 2Q8IA 4YKUA 2YGFA 3WQ9A 3OW6A 3FT5A 1L0OA 2JJCA 1UYDA 1AMWA 3U2KA 2YEAA 3HEKA 3O2FA 4PRXA 4XE2A 3T10A 1Z5AA 1I5BA 5CF0A 2HKJA 2IWXA 3A0RA 1YC4A 2BYIA 4AWPA 3NMQA 1BKNA 2YEEA 4ASAA 4CWTA 3HYZA 4LWIA 4XD8A 5CTUA 1AH8A 3A0YA 1EA6A 1YSZA 3RLRA 4I3HA 2YJWA 2CGFA 1A4HA 2WEQA 4V26A 1QY8A 3OWDA 4BQGA 1H7SA 1QYEA 4R3AA 3R4MA 4GFNA 2YK2A 2BRCA 4EGKA 5C93A 2H55A 4HZ5A 5D7DA 2XK2A 1UY6A 4O09A 4X9LA 2HG1A 4JAVA 2FTKA 2FXSA 2GQPA 1NHHA 4CWQA 4XIQA 3KE6A 2QF6A 2XABA 5IDJA 1ZXNA 1UYEA 4HYMA 5D6QA 4PU9A 1KZNA 5CPHA 1GKXA 4GGLA 4XKAA 2XDLA 4HY6A 3JZ3A 2QG2A 4URMA 3HHUA 2YEBA 2XCMA 3H80A 4WUBA 3T1KA 3ZKBA 4EEHA 1YC3A 3K98A 2E0AA 5BOCA 4FCRA 4AS9A 4YKRA 3LNUA 5GGZA 1JM6A 2XDSA 3D0BA 1Z5CA 2XHRA 4LWGA 3Q5JA 4NH8A 4CE2A 5M4MA 2VWCA 4KSGA 1TC0A 2C1IA 3VADA 3ZM7A 4EGIA 2YE8A 3OWBA 2Q8HA 4CE3A 2YI6A 4LP0A 3B28A 2FWZA 4LWHA 4LPBA 3OPDA 1TC6A 1GKZA 2XX2A 2WI3A 2YEGA 3IEDA 3B25A 4HYPA 2XHXA 1US7A 3INWA 4GT8A 4EM7A 1U0ZA 4U93A 3CGYA 4O04A 4R1FA 4KP4A 4MB9A 2YE9A 4URNA 5M4KA 4K4OA 4I5SA 4U7OA 4MBCA 4W7TA 4CWPA 5CTWA 1Z5BA 4CWNA 3U67A 3U2DA 2BZ5A 1F51A 1YESA 4QPKA 2ZDYA 4GQTA 2XDKA 4NH9A 2XX4A 2IWUA 2PNRA 2YEJA 1I58A 2FWYA 2HHIA 1TBWA 4MPCA 2HCHA 4CWSA 1ID0A 3EHFA 3TZ4A 2YI0A 2C2AA 4FCPA 4U7NA 4B6CA 2BU8A 2IOPA 4XC0A 4BIZA 5FNCA 3QTFA 3HZ1A 3ZXOA 2Q8GA 4L94A 3R91A 4CWRA 1KIJA 4FMTA 4YKZA 4PL9A 2IWSA 3C0EA 2YJXA 3ZXQA 4CWFA 1OSFA 3LPSA 4XCJA 4AWQA 5IN9A 2VCJA 2JKIA 2ZKJA 1UYFA 2YE4A 3EHGA 3TUHA 4DZYA 1MU5A 4JQLA 4HY1A 1NHIA 3BM9A 3CRLA 2BU6A 2K5BA 4CE1A 2EXLA 3SL2A 5FWKA 3K60A 1EI1A 3HZ5A 5CTXA 4V25A 1AM1A 1Y4UA 3GIFA 3D36A 1YSRA 1I5DA 5M4PA 3R4NA 3T2SA 3BMYA 3DGEA 2O1WA 4GCZA 1B3QA 3ZKDA 1ZW9A 4O0BA 4B7PA 3R92A 1BXDA 5M4NA 3G75A 5FNFA 2XD6A 3MNRP 5J71A 4KSHA 1THNA 4R3MA 1TIDA 3GIGB 4YKTA 4P7AA 4NH7A 5D7RA 4DUHA 4BXIA 4ZVIA 4KFGA 2ZBKB 2WERA 4E02A 3T0HA 4MPEA 3R4OA 2YEDA 4GEEA 3CRKA 5F3KA 2YE5A 4JAUA 2BU7A 3B27A 3EHJA 3OMUA 1R62A 4AWOA 3LMMA 2BYHA 2Q8FA 3TZ5A 2GFDA 5JENA 2ZDXA 5M4HA 4CWOA 1PVGA 1I59A 2IOQA 2XDUA 3CGZA 3WHAA 2QG0A 4H85A 2XDXA 1TILA 2WI5A 2XJJA 1UYHA 3A0XA 4H7QA 1UYGA 4L90A 2YEHA 3EHHA 4XKOA 4XKKA 1UYKA 2YECA 2YEIA 2YKEA 4ASFA 2WEPA 4HXWA 2WI7A 4ASBA 2Q2EB 1I5CA 2YKCA 1UYIA 2CCSA 3EKOA 2BU5A 4YKQA 1BGQA 1S16A 2YE3A 3EKRA 4URLA 1YC1A 4LWFA 5CTYA 4BQJA 5D6PA 3FV5A 4FCQA 3RLQA 4MOTA 4MP7A
chains in the Genus database with same CATH topology
1Y8PA 1GJVA 2XJXA 1Z59A 2XX5A 5D7CA 3H4LA 2FYPA 3D2RA 4O07A 3GIGA 4PRVA 1Y8NA 1NHJA 2WI2A 3FT8A 4E01A 2YI5A 3R4PA 5L3JA 4P8OA 3A0TA 3A0WA 5J6AA 4BAEA 1BYQA 2WI1A 4KQVA 2WI4A 1AJ6A 1ZXMA 2YE6A 4E00A 4XITA 3GIEA 2CCTA 3RLPA 5IDMA 3G7EA 1MX0A 2YI7A 1YT2A 4YKYA 4LWEA 4XDMA 4L93A 2VW5A 2UWDA 4FPPA 4YKWA 1YS3A 4ASGA 4ZKIA 4Q20A 1I5AA 3Q5KA 2AKPA 3C11A 4MP2A 1UY7A 2O1UA 3K99A 1UY9A 2IORA 4UROA 1YT0A 2BSMA 5FNDA 3TZ0A 3Q5LA 4YKXA 5F5RA 3PEHA 3A0ZA 4XIRA 3TTZA 3TZ2A 3QDDA 1UYCA 2O1VA 2ESAA 5M4EA 2BU2A 4HZ0A 3INXA 4O05A 4MPNA 4XCLA 4XIPA 3B24A 1Y8OA 4XTJA 3RKZA 3B26A 2YE2A 1U2OA 3PEJA 1TH8A 1B62A 1QZRA 1UY8A 2QFOA 2YKBA 2BT0A 2VCIA 2CG9A 2XJGA 4EFTA 4WUDA 2YGEA 1UYLA 3K97A 4KTNA 3VHAA 3VHDA 4HXZA 4QPJA 1UYMA 3HYYA 2WI6A 2XHTA 3O0IA 2CCUA 1Y4SA 4EGHA 2YEFA 2BTZA 4L91A 2YGAA 2YK9A 3CWVA 4EMVA 1YERA 1ZWHA 3VHCA 4JASA 2CH4A 2YKJA 4L8ZA 3G7BA 5BODA 4H81A 3T0ZA 1AH6A 1S14A 4EFUA 2H8MA 2YE7A 1B63A 2YKIA 4WUCA 4BIUA 1YETA 3O6OA 1YT1A 2BREA 1H7UA 2Q8IA 4YKUA 2YGFA 3WQ9A 3OW6A 3FT5A 1L0OA 2JJCA 1UYDA 1AMWA 3U2KA 2YEAA 3HEKA 3O2FA 4PRXA 4XE2A 3T10A 1Z5AA 1I5BA 5CF0A 2HKJA 2IWXA 3A0RA 1YC4A 2BYIA 4AWPA 3NMQA 1BKNA 2YEEA 4ASAA 4CWTA 3HYZA 4LWIA 4XD8A 5CTUA 1AH8A 3A0YA 1EA6A 1YSZA 3RLRA 4I3HA 2YJWA 2CGFA 1A4HA 2WEQA 4V26A 1QY8A 3OWDA 4BQGA 1H7SA 1QYEA 4R3AA 3R4MA 4GFNA 2YK2A 2BRCA 4EGKA 5C93A 2H55A 4HZ5A 5D7DA 2XK2A 1UY6A 4O09A 4X9LA 2HG1A 4JAVA 2FXSA 2GQPA 1NHHA 4CWQA 4XIQA 3KE6A 2QF6A 2XABA 5IDJA 1ZXNA 1UYEA 4HYMA 5D6QA 4PU9A 1KZNA 5CPHA 1GKXA 4GGLA 4XKAA 2XDLA 4HY6A 3JZ3A 2QG2A 4URMA 3HHUA 2YEBA 2XCMA 3H80A 4WUBA 3T1KA 3ZKBA 4EEHA 1YC3A 3K98A 2E0AA 5BOCA 4FCRA 4AS9A 4YKRA 3LNUA 5GGZA 1JM6A 2XDSA 3D0BA 1Z5CA 2XHRA 4LWGA 3Q5JA 4NH8A 4CE2A 5M4MA 2VWCA 4KSGA 1TC0A 3VADA 3ZM7A 4EGIA 2YE8A 3OWBA 2Q8HA 4CE3A 2YI6A 4LP0A 3B28A 2FWZA 4LWHA 4LPBA 1TC6A 3OPDA 1GKZA 2XX2A 2WI3A 2YEGA 3IEDA 3B25A 4HYPA 2XHXA 1US7A 3INWA 4GT8A 4EM7A 1U0ZA 4U93A 3CGYA 4O04A 4R1FA 4KP4A 4MB9A 2YE9A 4URNA 5M4KA 4K4OA 4I5SA 4U7OA 4MBCA 4W7TA 4CWPA 5CTWA 1Z5BA 4CWNA 3U67A 3U2DA 2BZ5A 1YESA 4QPKA 2ZDYA 4GQTA 2XDKA 4NH9A 2XX4A 2IWUA 2PNRA 2YEJA 1I58A 2FWYA 1TBWA 4MPCA 2HCHA 4CWSA 1ID0A 3EHFA 3TZ4A 2YI0A 2C2AA 4FCPA 4U7NA 4B6CA 2BU8A 2IOPA 4XC0A 4BIZA 5FNCA 3QTFA 3HZ1A 3ZXOA 2Q8GA 4L94A 3R91A 4CWRA 1KIJA 4FMTA 4YKZA 4PL9A 2IWSA 3C0EA 2YJXA 3ZXQA 4CWFA 1OSFA 3LPSA 4XCJA 4AWQA 5IN9A 2VCJA 2JKIA 2ZKJA 1UYFA 2YE4A 3EHGA 3TUHA 4DZYA 1MU5A 4JQLA 4HY1A 1NHIA 3BM9A 3CRLA 2BU6A 2K5BA 4CE1A 2EXLA 3SL2A 5FWKA 3K60A 1EI1A 3HZ5A 5CTXA 4V25A 1AM1A 1Y4UA 3GIFA 3D36A 1YSRA 1I5DA 5M4PA 3R4NA 3T2SA 3BMYA 3DGEA 2O1WA 4GCZA 1B3QA 3ZKDA 1ZW9A 4O0BA 4B7PA 3R92A 1BXDA 5M4NA 3G75A 5FNFA 2XD6A 3MNRP 5J71A 4KSHA 1THNA 4R3MA 1TIDA 3GIGB 4YKTA 4P7AA 4NH7A 5D7RA 4DUHA 4BXIA 4ZVIA 4KFGA 2ZBKB 2WERA 4E02A 3T0HA 4MPEA 3R4OA 2YEDA 4GEEA 3CRKA 5F3KA 2YE5A 4JAUA 2BU7A 3B27A 3EHJA 3OMUA 1R62A 4AWOA 2BYHA 2Q8FA 3TZ5A 2GFDA 2ZDXA 5M4HA 4CWOA 1PVGA 1I59A 2IOQA 2XDUA 3CGZA 3WHAA 2QG0A 4H85A 2XDXA 1TILA 2WI5A 2XJJA 1UYHA 3A0XA 4H7QA 1UYGA 4L90A 2YEHA 3EHHA 4XKOA 4XKKA 1UYKA 2YECA 2YEIA 2YKEA 4ASFA 2WEPA 4HXWA 2WI7A 4ASBA 2Q2EB 1I5CA 2YKCA 1UYIA 2CCSA 3EKOA 2BU5A 4YKQA 1BGQA 1S16A 2YE3A 3EKRA 4URLA 1YC1A 4LWFA 5CTYA 4BQJA 5D6PA 3FV5A 4FCQA 3RLQA 4MOTA 4MP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8P A;  1GJV A;  2XJX A;  1Z59 A;  2XX5 A;  5D7C A;  3H4L A;  2FYP A;  3D2R A;  4O07 A;  3GIG A;  4PRV A;  1Y8N A;  1NHJ A;  2WI2 A;  3FT8 A;  4E01 A;  2YI5 A;  3R4P A;  5L3J A;  4P8O A;  3A0T A;  3A0W A;  5J6A A;  4BAE A;  1BYQ A;  2WI1 A;  4KQV A;  2WI4 A;  1AJ6 A;  1ZXM A;  2YE6 A;  4E00 A;  4XIT A;  3GIE A;  2CCT A;  3RLP A;  5IDM A;  3G7E A;  1MX0 A;  2YI7 A;  1YT2 A;  4YKY A;  4LWE A;  4XDM A;  4L93 A;  2VW5 A;  2UWD A;  4FPP A;  4YKW A;  1YS3 A;  4ASG A;  4ZKI A;  4Q20 A;  1I5A A;  3Q5K A;  2AKP A;  3C11 A;  4MP2 A;  1UY7 A;  2O1U A;  3K99 A;  1UY9 A;  2IOR A;  4URO A;  1YT0 A;  2BSM A;  5FND A;  3TZ0 A;  3Q5L A;  4YKX A;  5F5R A;  3PEH A;  3A0Z A;  4XIR A;  3TTZ A;  3TZ2 A;  3QDD A;  1UYC A;  2O1V A;  2ESA A;  5M4E A;  2BU2 A;  4HZ0 A;  3INX A;  4O05 A;  4MPN A;  4XCL A;  4XIP A;  3B24 A;  1Y8O A;  4XTJ A;  3RKZ A;  3B26 A;  2YE2 A;  1U2O A;  3PEJ A;  1TH8 A;  1B62 A;  1QZR A;  1UY8 A;  2QFO A;  2YKB A;  2BT0 A;  2VCI A;  2CG9 A;  2XJG A;  4EFT A;  4WUD A;  2YGE A;  1UYL A;  3K97 A;  4KTN A;  3VHA A;  3VHD A;  4HXZ A;  4QPJ A;  1UYM A;  3HYY A;  2WI6 A;  2XHT A;  3O0I A;  2CCU A;  1Y4S A;  4EGH A;  2YEF A;  2BTZ A;  4L91 A;  2YGA A;  2YK9 A;  3CWV A;  4EMV A;  1YER A;  1ZWH A;  3VHC A;  4JAS A;  2CH4 A;  2YKJ A;  4L8Z A;  3G7B A;  5BOD A;  4H81 A;  3T0Z A;  1AH6 A;  1S14 A;  4EFU A;  2H8M A;  2YE7 A;  1B63 A;  2YKI A;  4WUC A;  4BIU A;  1YET A;  3O6O A;  1YT1 A;  2BRE A;  1H7U A;  2Q8I A;  4YKU A;  2YGF A;  3WQ9 A;  3OW6 A;  3FT5 A;  1L0O A;  2JJC A;  1UYD A;  1AMW A;  3U2K A;  2YEA A;  3HEK A;  3O2F A;  4PRX A;  4XE2 A;  3T10 A;  1Z5A A;  1I5B A;  5CF0 A;  2HKJ A;  2IWX A;  3A0R A;  1YC4 A;  2BYI A;  4AWP A;  3NMQ A;  1BKN A;  2YEE A;  4ASA A;  4CWT A;  3HYZ A;  4LWI A;  4XD8 A;  5CTU A;  1AH8 A;  3A0Y A;  1EA6 A;  1YSZ A;  3RLR A;  4I3H A;  2YJW A;  2CGF A;  1A4H A;  2WEQ A;  4V26 A;  1QY8 A;  3OWD A;  4BQG A;  1H7S A;  1QYE A;  4R3A A;  3R4M A;  4GFN A;  2YK2 A;  2BRC A;  4EGK A;  5C93 A;  2H55 A;  4HZ5 A;  5D7D A;  2XK2 A;  1UY6 A;  4O09 A;  4X9L A;  2HG1 A;  4JAV A;  2FXS A;  2GQP A;  1NHH A;  4CWQ A;  4XIQ A;  3KE6 A;  2QF6 A;  2XAB A;  5IDJ A;  1ZXN A;  1UYE A;  4HYM A;  5D6Q A;  4PU9 A;  1KZN A;  5CPH A;  1GKX A;  4GGL A;  4XKA A;  2XDL A;  4HY6 A;  3JZ3 A;  2QG2 A;  4URM A;  3HHU A;  2YEB A;  2XCM A;  3H80 A;  4WUB A;  3T1K A;  3ZKB A;  4EEH A;  1YC3 A;  3K98 A;  2E0A A;  5BOC A;  4FCR A;  4AS9 A;  4YKR A;  3LNU A;  5GGZ A;  1JM6 A;  2XDS A;  3D0B A;  1Z5C A;  2XHR A;  4LWG A;  3Q5J A;  4NH8 A;  4CE2 A;  5M4M A;  2VWC A;  4KSG A;  1TC0 A;  3VAD A;  3ZM7 A;  4EGI A;  2YE8 A;  3OWB A;  2Q8H A;  4CE3 A;  2YI6 A;  4LP0 A;  3B28 A;  2FWZ A;  4LWH A;  4LPB A;  1TC6 A;  3OPD A;  1GKZ A;  2XX2 A;  2WI3 A;  2YEG A;  3IED A;  3B25 A;  4HYP A;  2XHX A;  1US7 A;  3INW A;  4GT8 A;  4EM7 A;  1U0Z A;  4U93 A;  3CGY A;  4O04 A;  4R1F A;  4KP4 A;  4MB9 A;  2YE9 A;  4URN A;  5M4K A;  4K4O A;  4I5S A;  4U7O A;  4MBC A;  4W7T A;  4CWP A;  5CTW A;  1Z5B A;  4CWN A;  3U67 A;  3U2D A;  2BZ5 A;  1YES A;  4QPK A;  2ZDY A;  4GQT A;  2XDK A;  4NH9 A;  2XX4 A;  2IWU A;  2PNR A;  2YEJ A;  1I58 A;  2FWY A;  1TBW A;  4MPC A;  2HCH A;  4CWS A;  1ID0 A;  3EHF A;  3TZ4 A;  2YI0 A;  2C2A A;  4FCP A;  4U7N A;  4B6C A;  2BU8 A;  2IOP A;  4XC0 A;  4BIZ A;  5FNC A;  3QTF A;  3HZ1 A;  3ZXO A;  2Q8G A;  4L94 A;  3R91 A;  4CWR A;  1KIJ A;  4FMT A;  4YKZ A;  4PL9 A;  2IWS A;  3C0E A;  2YJX A;  3ZXQ A;  4CWF A;  1OSF A;  3LPS A;  4XCJ A;  4AWQ A;  5IN9 A;  2VCJ A;  2JKI A;  2ZKJ A;  1UYF A;  2YE4 A;  3EHG A;  3TUH A;  4DZY A;  1MU5 A;  4JQL A;  4HY1 A;  1NHI A;  3BM9 A;  3CRL A;  2BU6 A;  2K5B A;  4CE1 A;  2EXL A;  3SL2 A;  5FWK A;  3K60 A;  1EI1 A;  3HZ5 A;  5CTX A;  4V25 A;  1AM1 A;  1Y4U A;  3GIF A;  3D36 A;  1YSR A;  1I5D A;  5M4P A;  3R4N A;  3T2S A;  3BMY A;  3DGE A;  2O1W A;  4GCZ A;  1B3Q A;  3ZKD A;  1ZW9 A;  4O0B A;  4B7P A;  3R92 A;  1BXD A;  5M4N A;  3G75 A;  5FNF A;  2XD6 A;  3MNR P;  5J71 A;  4KSH A;  1THN A;  4R3M A;  1TID A;  3GIG B;  4YKT A;  4P7A A;  4NH7 A;  5D7R A;  4DUH A;  4BXI A;  4ZVI A;  4KFG A;  2ZBK B;  2WER A;  4E02 A;  3T0H A;  4MPE A;  3R4O A;  2YED A;  4GEE A;  3CRK A;  5F3K A;  2YE5 A;  4JAU A;  2BU7 A;  3B27 A;  3EHJ A;  3OMU A;  1R62 A;  4AWO A;  2BYH A;  2Q8F A;  3TZ5 A;  2GFD A;  2ZDX A;  5M4H A;  4CWO A;  1PVG A;  1I59 A;  2IOQ A;  2XDU A;  3CGZ A;  3WHA A;  2QG0 A;  4H85 A;  2XDX A;  1TIL A;  2WI5 A;  2XJJ A;  1UYH A;  3A0X A;  4H7Q A;  1UYG A;  4L90 A;  2YEH A;  3EHH A;  4XKO A;  4XKK A;  1UYK A;  2YEC A;  2YEI A;  2YKE A;  4ASF A;  2WEP A;  4HXW A;  2WI7 A;  4ASB A;  2Q2E B;  1I5C A;  2YKC A;  1UYI A;  2CCS A;  3EKO A;  2BU5 A;  4YKQ A;  1BGQ A;  1S16 A;  2YE3 A;  3EKR A;  4URL A;  1YC1 A;  4LWF A;  5CTY A;  4BQJ A;  5D6P A;  3FV5 A;  4FCQ A;  3RLQ A;  4MOT A;  4MP7 A; 
#chains in the Genus database with same CATH topology
 1Y8P A;  1GJV A;  2XJX A;  1Z59 A;  2XX5 A;  5D7C A;  3H4L A;  2FYP A;  3D2R A;  4O07 A;  3GIG A;  4PRV A;  1Y8N A;  1NHJ A;  2WI2 A;  3FT8 A;  4E01 A;  2YI5 A;  3R4P A;  5L3J A;  4P8O A;  3A0T A;  3A0W A;  5J6A A;  4BAE A;  1BYQ A;  2WI1 A;  4KQV A;  2WI4 A;  1AJ6 A;  1ZXM A;  2YE6 A;  4E00 A;  4XIT A;  2C1G A;  3GIE A;  2CCT A;  3RLP A;  5IDM A;  3G7E A;  1MX0 A;  2YI7 A;  1YT2 A;  4YKY A;  4LWE A;  4XDM A;  4L93 A;  2VW5 A;  2UWD A;  4FPP A;  4YKW A;  1YS3 A;  4ASG A;  4ZKI A;  4Q20 A;  1I5A A;  3Q5K A;  2AKP A;  3C11 A;  4MP2 A;  1UY7 A;  2O1U A;  3K99 A;  1UY9 A;  2IOR A;  4URO A;  1YT0 A;  2BSM A;  5FND A;  3TZ0 A;  3Q5L A;  4YKX A;  5F5R A;  3PEH A;  3A0Z A;  4XIR A;  3TTZ A;  3TZ2 A;  3QDD A;  1UYC A;  2O1V A;  2ESA A;  5M4E A;  2BU2 A;  4HZ0 A;  3INX A;  4O05 A;  4MPN A;  4XCL A;  4XIP A;  3B24 A;  4E72 A;  1Y8O A;  4XTJ A;  3RKZ A;  3B26 A;  2YE2 A;  1U2O A;  3PEJ A;  3CYG A;  1TH8 A;  1B62 A;  1QZR A;  1UY8 A;  2QFO A;  2YKB A;  2BT0 A;  2VCI A;  2CG9 A;  2XJG A;  4EFT A;  4WUD A;  2YGE A;  1UYL A;  3K97 A;  4KTN A;  3VHA A;  3VHD A;  4HXZ A;  4QPJ A;  1UYM A;  3HYY A;  2WI6 A;  2XHT A;  3O0I A;  2CCU A;  3S5T A;  1IXM A;  1Y4S A;  4EGH A;  2YEF A;  2BTZ A;  4L91 A;  2YGA A;  2YK9 A;  3CWV A;  4EMV A;  1YER A;  1ZWH A;  3VHC A;  4JAS A;  2CH4 A;  2YKJ A;  4L8Z A;  3G7B A;  5BOD A;  4H81 A;  3T0Z A;  1AH6 A;  1S14 A;  4EFU A;  2H8M A;  2YE7 A;  1B63 A;  2YKI A;  4WUC A;  4BIU A;  1YET A;  3O6O A;  1YT1 A;  2BRE A;  1H7U A;  2Q8I A;  4YKU A;  2YGF A;  3WQ9 A;  3OW6 A;  3FT5 A;  1L0O A;  2JJC A;  1UYD A;  1AMW A;  3U2K A;  2YEA A;  3HEK A;  3O2F A;  4PRX A;  4XE2 A;  3T10 A;  1Z5A A;  1I5B A;  5CF0 A;  2HKJ A;  2IWX A;  3A0R A;  1YC4 A;  2BYI A;  4AWP A;  3NMQ A;  1BKN A;  2YEE A;  4ASA A;  4CWT A;  3HYZ A;  4LWI A;  4XD8 A;  5CTU A;  1AH8 A;  3A0Y A;  1EA6 A;  1YSZ A;  3RLR A;  4I3H A;  2YJW A;  2CGF A;  1A4H A;  2WEQ A;  4V26 A;  1QY8 A;  3OWD A;  4BQG A;  1H7S A;  1QYE A;  4R3A A;  3R4M A;  4GFN A;  2YK2 A;  2BRC A;  4EGK A;  5C93 A;  2H55 A;  4HZ5 A;  5D7D A;  2XK2 A;  1UY6 A;  4O09 A;  4X9L A;  2HG1 A;  4JAV A;  2FTK A;  2FXS A;  2GQP A;  1NHH A;  4CWQ A;  4XIQ A;  3KE6 A;  2QF6 A;  2XAB A;  5IDJ A;  1ZXN A;  1UYE A;  4HYM A;  5D6Q A;  4PU9 A;  1KZN A;  5CPH A;  1GKX A;  4GGL A;  4XKA A;  2XDL A;  4HY6 A;  3JZ3 A;  2QG2 A;  4URM A;  3HHU A;  2YEB A;  2XCM A;  3H80 A;  4WUB A;  3T1K A;  3ZKB A;  4EEH A;  1YC3 A;  3K98 A;  2E0A A;  5BOC A;  4FCR A;  4AS9 A;  4YKR A;  3LNU A;  5GGZ A;  1JM6 A;  2XDS A;  3D0B A;  1Z5C A;  2XHR A;  4LWG A;  3Q5J A;  4NH8 A;  4CE2 A;  5M4M A;  2VWC A;  4KSG A;  1TC0 A;  2C1I A;  3VAD A;  3ZM7 A;  4EGI A;  2YE8 A;  3OWB A;  2Q8H A;  4CE3 A;  2YI6 A;  4LP0 A;  3B28 A;  2FWZ A;  4LWH A;  4LPB A;  3OPD A;  1TC6 A;  1GKZ A;  2XX2 A;  2WI3 A;  2YEG A;  3IED A;  3B25 A;  4HYP A;  2XHX A;  1US7 A;  3INW A;  4GT8 A;  4EM7 A;  1U0Z A;  4U93 A;  3CGY A;  4O04 A;  4R1F A;  4KP4 A;  4MB9 A;  2YE9 A;  4URN A;  5M4K A;  4K4O A;  4I5S A;  4U7O A;  4MBC A;  4W7T A;  4CWP A;  5CTW A;  1Z5B A;  4CWN A;  3U67 A;  3U2D A;  2BZ5 A;  1F51 A;  1YES A;  4QPK A;  2ZDY A;  4GQT A;  2XDK A;  4NH9 A;  2XX4 A;  2IWU A;  2PNR A;  2YEJ A;  1I58 A;  2FWY A;  2HHI A;  1TBW A;  4MPC A;  2HCH A;  4CWS A;  1ID0 A;  3EHF A;  3TZ4 A;  2YI0 A;  2C2A A;  4FCP A;  4U7N A;  4B6C A;  2BU8 A;  2IOP A;  4XC0 A;  4BIZ A;  5FNC A;  3QTF A;  3HZ1 A;  3ZXO A;  2Q8G A;  4L94 A;  3R91 A;  4CWR A;  1KIJ A;  4FMT A;  4YKZ A;  4PL9 A;  2IWS A;  3C0E A;  2YJX A;  3ZXQ A;  4CWF A;  1OSF A;  3LPS A;  4XCJ A;  4AWQ A;  5IN9 A;  2VCJ A;  2JKI A;  2ZKJ A;  1UYF A;  2YE4 A;  3EHG A;  3TUH A;  4DZY A;  1MU5 A;  4JQL A;  4HY1 A;  1NHI A;  3BM9 A;  3CRL A;  2BU6 A;  2K5B A;  4CE1 A;  2EXL A;  3SL2 A;  5FWK A;  3K60 A;  1EI1 A;  3HZ5 A;  5CTX A;  4V25 A;  1AM1 A;  1Y4U A;  3GIF A;  3D36 A;  1YSR A;  1I5D A;  5M4P A;  3R4N A;  3T2S A;  3BMY A;  3DGE A;  2O1W A;  4GCZ A;  1B3Q A;  3ZKD A;  1ZW9 A;  4O0B A;  4B7P A;  3R92 A;  1BXD A;  5M4N A;  3G75 A;  5FNF A;  2XD6 A;  3MNR P;  5J71 A;  4KSH A;  1THN A;  4R3M A;  1TID A;  3GIG B;  4YKT A;  4P7A A;  4NH7 A;  5D7R A;  4DUH A;  4BXI A;  4ZVI A;  4KFG A;  2ZBK B;  2WER A;  4E02 A;  3T0H A;  4MPE A;  3R4O A;  2YED A;  4GEE A;  3CRK A;  5F3K A;  2YE5 A;  4JAU A;  2BU7 A;  3B27 A;  3EHJ A;  3OMU A;  1R62 A;  4AWO A;  3LMM A;  2BYH A;  2Q8F A;  3TZ5 A;  2GFD A;  5JEN A;  2ZDX A;  5M4H A;  4CWO A;  1PVG A;  1I59 A;  2IOQ A;  2XDU A;  3CGZ A;  3WHA A;  2QG0 A;  4H85 A;  2XDX A;  1TIL A;  2WI5 A;  2XJJ A;  1UYH A;  3A0X A;  4H7Q A;  1UYG A;  4L90 A;  2YEH A;  3EHH A;  4XKO A;  4XKK A;  1UYK A;  2YEC A;  2YEI A;  2YKE A;  4ASF A;  2WEP A;  4HXW A;  2WI7 A;  4ASB A;  2Q2E B;  1I5C A;  2YKC A;  1UYI A;  2CCS A;  3EKO A;  2BU5 A;  4YKQ A;  1BGQ A;  1S16 A;  2YE3 A;  3EKR A;  4URL A;  1YC1 A;  4LWF A;  5CTY A;  4BQJ A;  5D6P A;  3FV5 A;  4FCQ A;  3RLQ A;  4MOT A;  4MP7 A; 
#chains in the Genus database with same CATH homology
 1Y8P A;  1GJV A;  2XJX A;  1Z59 A;  2XX5 A;  5D7C A;  3H4L A;  2FYP A;  3D2R A;  4O07 A;  3GIG A;  4PRV A;  1Y8N A;  1NHJ A;  2WI2 A;  3FT8 A;  4E01 A;  2YI5 A;  3R4P A;  5L3J A;  4P8O A;  3A0T A;  3A0W A;  5J6A A;  4BAE A;  1BYQ A;  2WI1 A;  4KQV A;  2WI4 A;  1AJ6 A;  1ZXM A;  2YE6 A;  4E00 A;  4XIT A;  3GIE A;  2CCT A;  3RLP A;  5IDM A;  3G7E A;  1MX0 A;  2YI7 A;  1YT2 A;  4YKY A;  4LWE A;  4XDM A;  4L93 A;  2VW5 A;  2UWD A;  4FPP A;  4YKW A;  1YS3 A;  4ASG A;  4ZKI A;  4Q20 A;  1I5A A;  3Q5K A;  2AKP A;  3C11 A;  4MP2 A;  1UY7 A;  2O1U A;  3K99 A;  1UY9 A;  2IOR A;  4URO A;  1YT0 A;  2BSM A;  5FND A;  3TZ0 A;  3Q5L A;  4YKX A;  5F5R A;  3PEH A;  3A0Z A;  4XIR A;  3TTZ A;  3TZ2 A;  3QDD A;  1UYC A;  2O1V A;  2ESA A;  5M4E A;  2BU2 A;  4HZ0 A;  3INX A;  4O05 A;  4MPN A;  4XCL A;  4XIP A;  3B24 A;  1Y8O A;  4XTJ A;  3RKZ A;  3B26 A;  2YE2 A;  1U2O A;  3PEJ A;  1TH8 A;  1B62 A;  1QZR A;  1UY8 A;  2QFO A;  2YKB A;  2BT0 A;  2VCI A;  2CG9 A;  2XJG A;  4EFT A;  4WUD A;  2YGE A;  1UYL A;  3K97 A;  4KTN A;  3VHA A;  3VHD A;  4HXZ A;  4QPJ A;  1UYM A;  3HYY A;  2WI6 A;  2XHT A;  3O0I A;  2CCU A;  1Y4S A;  4EGH A;  2YEF A;  2BTZ A;  4L91 A;  2YGA A;  2YK9 A;  3CWV A;  4EMV A;  1YER A;  1ZWH A;  3VHC A;  4JAS A;  2CH4 A;  2YKJ A;  4L8Z A;  3G7B A;  5BOD A;  4H81 A;  3T0Z A;  1AH6 A;  1S14 A;  4EFU A;  2H8M A;  2YE7 A;  1B63 A;  2YKI A;  4WUC A;  4BIU A;  1YET A;  3O6O A;  1YT1 A;  2BRE A;  1H7U A;  2Q8I A;  4YKU A;  2YGF A;  3WQ9 A;  3OW6 A;  3FT5 A;  1L0O A;  2JJC A;  1UYD A;  1AMW A;  3U2K A;  2YEA A;  3HEK A;  3O2F A;  4PRX A;  4XE2 A;  3T10 A;  1Z5A A;  1I5B A;  5CF0 A;  2HKJ A;  2IWX A;  3A0R A;  1YC4 A;  2BYI A;  4AWP A;  3NMQ A;  1BKN A;  2YEE A;  4ASA A;  4CWT A;  3HYZ A;  4LWI A;  4XD8 A;  5CTU A;  1AH8 A;  3A0Y A;  1EA6 A;  1YSZ A;  3RLR A;  4I3H A;  2YJW A;  2CGF A;  1A4H A;  2WEQ A;  4V26 A;  1QY8 A;  3OWD A;  4BQG A;  1H7S A;  1QYE A;  4R3A A;  3R4M A;  4GFN A;  2YK2 A;  2BRC A;  4EGK A;  5C93 A;  2H55 A;  4HZ5 A;  5D7D A;  2XK2 A;  1UY6 A;  4O09 A;  4X9L A;  2HG1 A;  4JAV A;  2FXS A;  2GQP A;  1NHH A;  4CWQ A;  4XIQ A;  3KE6 A;  2QF6 A;  2XAB A;  5IDJ A;  1ZXN A;  1UYE A;  4HYM A;  5D6Q A;  4PU9 A;  1KZN A;  5CPH A;  1GKX A;  4GGL A;  4XKA A;  2XDL A;  4HY6 A;  3JZ3 A;  2QG2 A;  4URM A;  3HHU A;  2YEB A;  2XCM A;  3H80 A;  4WUB A;  3T1K A;  3ZKB A;  4EEH A;  1YC3 A;  3K98 A;  2E0A A;  5BOC A;  4FCR A;  4AS9 A;  4YKR A;  3LNU A;  5GGZ A;  1JM6 A;  2XDS A;  3D0B A;  1Z5C A;  2XHR A;  4LWG A;  3Q5J A;  4NH8 A;  4CE2 A;  5M4M A;  2VWC A;  4KSG A;  1TC0 A;  3VAD A;  3ZM7 A;  4EGI A;  2YE8 A;  3OWB A;  2Q8H A;  4CE3 A;  2YI6 A;  4LP0 A;  3B28 A;  2FWZ A;  4LWH A;  4LPB A;  1TC6 A;  3OPD A;  1GKZ A;  2XX2 A;  2WI3 A;  2YEG A;  3IED A;  3B25 A;  4HYP A;  2XHX A;  1US7 A;  3INW A;  4GT8 A;  4EM7 A;  1U0Z A;  4U93 A;  3CGY A;  4O04 A;  4R1F A;  4KP4 A;  4MB9 A;  2YE9 A;  4URN A;  5M4K A;  4K4O A;  4I5S A;  4U7O A;  4MBC A;  4W7T A;  4CWP A;  5CTW A;  1Z5B A;  4CWN A;  3U67 A;  3U2D A;  2BZ5 A;  1YES A;  4QPK A;  2ZDY A;  4GQT A;  2XDK A;  4NH9 A;  2XX4 A;  2IWU A;  2PNR A;  2YEJ A;  1I58 A;  2FWY A;  1TBW A;  4MPC A;  2HCH A;  4CWS A;  1ID0 A;  3EHF A;  3TZ4 A;  2YI0 A;  2C2A A;  4FCP A;  4U7N A;  4B6C A;  2BU8 A;  2IOP A;  4XC0 A;  4BIZ A;  5FNC A;  3QTF A;  3HZ1 A;  3ZXO A;  2Q8G A;  4L94 A;  3R91 A;  4CWR A;  1KIJ A;  4FMT A;  4YKZ A;  4PL9 A;  2IWS A;  3C0E A;  2YJX A;  3ZXQ A;  4CWF A;  1OSF A;  3LPS A;  4XCJ A;  4AWQ A;  5IN9 A;  2VCJ A;  2JKI A;  2ZKJ A;  1UYF A;  2YE4 A;  3EHG A;  3TUH A;  4DZY A;  1MU5 A;  4JQL A;  4HY1 A;  1NHI A;  3BM9 A;  3CRL A;  2BU6 A;  2K5B A;  4CE1 A;  2EXL A;  3SL2 A;  5FWK A;  3K60 A;  1EI1 A;  3HZ5 A;  5CTX A;  4V25 A;  1AM1 A;  1Y4U A;  3GIF A;  3D36 A;  1YSR A;  1I5D A;  5M4P A;  3R4N A;  3T2S A;  3BMY A;  3DGE A;  2O1W A;  4GCZ A;  1B3Q A;  3ZKD A;  1ZW9 A;  4O0B A;  4B7P A;  3R92 A;  1BXD A;  5M4N A;  3G75 A;  5FNF A;  2XD6 A;  3MNR P;  5J71 A;  4KSH A;  1THN A;  4R3M A;  1TID A;  3GIG B;  4YKT A;  4P7A A;  4NH7 A;  5D7R A;  4DUH A;  4BXI A;  4ZVI A;  4KFG A;  2ZBK B;  2WER A;  4E02 A;  3T0H A;  4MPE A;  3R4O A;  2YED A;  4GEE A;  3CRK A;  5F3K A;  2YE5 A;  4JAU A;  2BU7 A;  3B27 A;  3EHJ A;  3OMU A;  1R62 A;  4AWO A;  2BYH A;  2Q8F A;  3TZ5 A;  2GFD A;  2ZDX A;  5M4H A;  4CWO A;  1PVG A;  1I59 A;  2IOQ A;  2XDU A;  3CGZ A;  3WHA A;  2QG0 A;  4H85 A;  2XDX A;  1TIL A;  2WI5 A;  2XJJ A;  1UYH A;  3A0X A;  4H7Q A;  1UYG A;  4L90 A;  2YEH A;  3EHH A;  4XKO A;  4XKK A;  1UYK A;  2YEC A;  2YEI A;  2YKE A;  4ASF A;  2WEP A;  4HXW A;  2WI7 A;  4ASB A;  2Q2E B;  1I5C A;  2YKC A;  1UYI A;  2CCS A;  3EKO A;  2BU5 A;  4YKQ A;  1BGQ A;  1S16 A;  2YE3 A;  3EKR A;  4URL A;  1YC1 A;  4LWF A;  5CTY A;  4BQJ A;  5D6P A;  3FV5 A;  4FCQ A;  3RLQ A;  4MOT A;  4MP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...