4GEEA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
total genus 59
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4geeA00
2XJXA 2YE7A 4CWSA 2XHXA 2E0AA 3R91A 4B6CA 4E02A 4LWIA 4YKWA 1QYEA 2YE4A 4AWPA 5F3KA 2CCSA 4AS9A 2YEJA 3CWVA 3B24A 1B3QA 3OWDA 4E01A 4NH7A 3VHAA 2VCJA 2WERA 4XIQA 1THNA 1Y4SA 3TZ5A 4X9LA 1U0ZA 3DGEA 5M4NA 4CWTA 2ZDYA 3O0IA 1H7UA 3ZXOA 1H7SA 2BYIA 4QPJA 3TUHA 3JZ3A 5IN9A 4WUBA 4EFUA 3O2FA 2YKJA 2XDKA 1BKNA 2XHTA 3IEDA 2IWXA 3G7BA 1UYLA 2YKEA 4U7OA 5CPHA 3A0TA 5FNDA 4YKTA 4O04A 4LWEA 5FWKA 3K97A 3HYYA 3RLRA 3SL2A 2YEGA 1MU5A 2YEIA 4P8OA 4JQLA 4YKUA 3EHHA 3T10A 1YERA 2YEFA 3D2RA 1Y8NA 3WHAA 3EHJA 3GIGB 4L91A 4KTNA 1UY7A 4KSHA 2VWCA 3T1KA 4MPNA 2FWYA 4EEHA 5CF0A 3B27A 4XCJA 2O1UA 2HCHA 1AH8A 4XE2A 2Q8FA 3MNRP 3U2KA 1ZWHA 4XIRA 2XJJA 3B28A 3A0WA 4U93A 4HY6A 3K99A 4XKKA 3ZKDA 5L3JA 4CWPA 4PU9A 1TC6A 2XCMA 3CGZA 4O05A 4CWRA 1BGQA 1QY8A 4HZ5A 4XKAA 2XX4A 2YE9A 3Q5KA 4KP4A 4BQGA 2FWZA 5M4KA 4PRVA 4EGIA 1EI1A 3HHUA 4P7AA 1TC0A 2H55A 2ESAA 2YE6A 1Z5BA 2YKIA 2YKCA 1BXDA 2HKJA 4WUDA 1Z5AA 1S16A 4BXIA 1UYIA 2Q8IA 1I58A 2PNRA 5BODA 1US7A 4HZ0A 4ASAA 2CCUA 3A0YA 1B62A 4LP0A 1GJVA 1TIDA 2BU5A 3HYZA 4XTJA 1AMWA 2WI2A 4ASBA 3PEHA 3RKZA 2BZ5A 1UYCA 3OPDA 5IDMA 2BU2A 4H85A 4YKZA 2FYPA 4MBCA 4I3HA 3A0ZA 3B26A 1YC3A 4B7PA 4FPPA 3PEJA 3VADA 4MPCA 3INWA 3EKOA 2YE5A 3T0HA 2O1WA 2YEAA 5M4HA 4BIZA 1TBWA 1ID0A 4XC0A 4ZKIA 2CGFA 3CRKA 3TZ4A 4EFTA 3KE6A 4XITA 4CE1A 3D36A 2BREA 2WEPA 1B63A 3WQ9A 4R3MA 4O07A 2YEDA 3FV5A 4UROA 3LPSA 1Y4UA 4MB9A 4BAEA 3K60A 4MPEA 2YE8A 2YEBA 4FMTA 3R4NA 4BQJA 2YGFA 4CWFA 4GQTA 2QFOA 2YK2A 1YSRA 4LWGA 4XDMA 1ZW9A 3A0XA 5M4MA 3ZKBA 1UY8A 4YKXA 2XD6A 4FCQA 2WI4A 1YSZA 3GIFA 4LWHA 2WI5A 4JAVA 2Q2EB 4QPKA 1TILA 3D0BA 1EA6A 2FXSA 3Q5JA 3R92A 2IWUA 5J71A 2ZBKB 5CTUA 1ZXNA 3G75A 4DZYA 3TZ2A 4CWQA 4GGLA 1NHJA 3FT5A 2Q8GA 3T2SA 2BYHA 1KZNA 2YKBA 4CWNA 4HXZA 2AKPA 2WI6A 3OWBA 3OW6A 2XDXA 4PL9A 2YI5A 1YC1A 1UYGA 2YGAA 2YE2A 2IOPA 2BU6A 3ZXQA 4CWOA 1UY6A 4PRXA 4GCZA 4L8ZA 3VHDA 1U2OA 2IORA 1R62A 1UYMA 4L94A 1JM6A 3K98A 1I5BA 3R4MA 4U7NA 3RLPA 4JAUA 2YEHA 2CG9A 4URLA 3OMUA 3HEKA 2YE3A 4FCRA 3T0ZA 1NHIA 5BOCA 2XX5A 4NH9A 4L90A 4I5SA 3EKRA 2YI0A 4LPBA 5CTYA 3EHFA 4MOTA 4H81A 2BTZA 4K4OA 1Y8OA 2JJCA 4XKOA 1I59A 2WI1A 4W7TA 5IDJA 4R3AA 5M4EA 3QDDA 4URNA 5D7RA 4V26A 3FT8A 5M4PA 4HY1A 4GEEA 2YECA 2C2AA 4BIUA 1Z5CA 1QZRA 2CH4A 4XIPA 4YKQA 2BRCA 1KIJA 2YGEA 3H4LA 1NHHA 1ZXMA 1YT2A 2XHRA 4EGHA 4NH8A 5F5RA 5D7DA 3ZM7A 1YS3A 1L0OA 2ZKJA 5C93A 5GGZA 1I5AA 4AWQA 3GIEA 4ZVIA 3TZ0A 2QG2A 5J6AA 2HG1A 4MP2A 2XJGA 4Q20A 4YKRA 2BU7A 3O6OA 3Q5LA 2O1VA 2XX2A 1YC4A 2VW5A 4AWOA 1YT0A 1Y8PA 4WUCA 2WI7A 2IWSA 2H8MA 3BMYA 2QF6A 1UYKA 4GFNA 4V25A 3U67A 1AJ6A 4O09A 3C0EA 1UYDA 1S14A 3G7EA 2XK2A 3INXA 2IOQA 2XDLA 2XDSA 3B25A 1BYQA 2CCTA 2BSMA 4R1FA 2YI7A 1Z59A 4ASFA 3H80A 3R4PA 2YJWA 3HZ5A 1YETA 2XABA 3QTFA 4KFGA 3CRLA 3BM9A 3HZ1A 4MP7A 1PVGA 2XDUA 2YK9A 3C11A 5CTXA 1UY9A 4JASA 2GFDA 1I5DA 1GKZA 4E00A 1UYEA 5FNFA 2BT0A 3TTZA 1I5CA 3EHGA 4XD8A 4YKYA 5D7CA 3VHCA 2UWDA 4ASGA 4HYPA 1TH8A 2WEQA 4EGKA 4CE2A 4EM7A 1MX0A 1A4HA 4XCLA 1AM1A 4CE3A 3NMQA 3R4OA 2YEEA 2Q8HA 5CTWA 2YJXA 3CGYA 5D6PA 1AH6A 2ZDXA 5D6QA 4L93A 3LNUA 4LWFA 1UYFA 2VCIA 4GT8A 1YESA 4O0BA 5FNCA 4FCPA 1YT1A 2QG0A 4HYMA 3A0RA 2YI6A 4HXWA 3RLQA 4DUHA 2EXLA 4H7QA 2GQPA 1OSFA 2WI3A 2K5BA 3U2DA 1UYHA 3GIGA 4KQVA 1GKXA 2JKIA 4URMA 4KSGA 4EMVA 2BU8A
chains in the Genus database with same CATH superfamily
2XJXA 2YE7A 4CWSA 2XHXA 2E0AA 3R91A 4B6CA 4E02A 4LWIA 4YKWA 1QYEA 2YE4A 4AWPA 5F3KA 2CCSA 4AS9A 2YEJA 3CWVA 3B24A 1B3QA 3OWDA 4E01A 4NH7A 3VHAA 2VCJA 2WERA 4XIQA 1THNA 1Y4SA 3TZ5A 4X9LA 1U0ZA 3DGEA 5M4NA 4CWTA 2ZDYA 3O0IA 1H7UA 3ZXOA 1H7SA 2BYIA 4QPJA 3TUHA 3JZ3A 5IN9A 4WUBA 4EFUA 3O2FA 2YKJA 2XDKA 1BKNA 2XHTA 3IEDA 2IWXA 3G7BA 1UYLA 2YKEA 4U7OA 5CPHA 3A0TA 5FNDA 4YKTA 4O04A 4LWEA 5FWKA 3K97A 3HYYA 3RLRA 3SL2A 2YEGA 1MU5A 2YEIA 4P8OA 4JQLA 4YKUA 3EHHA 3T10A 1YERA 2YEFA 3D2RA 1Y8NA 3WHAA 3EHJA 3GIGB 4L91A 4KTNA 3LMMA 1UY7A 4KSHA 2VWCA 3T1KA 4MPNA 2FWYA 4EEHA 5CF0A 3B27A 4XCJA 2O1UA 2HCHA 1AH8A 4XE2A 2Q8FA 3MNRP 3U2KA 1ZWHA 4XIRA 2XJJA 3B28A 3A0WA 4U93A 4HY6A 3K99A 4XKKA 3ZKDA 5L3JA 4CWPA 4PU9A 1TC6A 2XCMA 3CGZA 4O05A 4CWRA 1BGQA 1QY8A 4HZ5A 4XKAA 2XX4A 2YE9A 3Q5KA 4KP4A 4BQGA 2FWZA 5M4KA 4PRVA 4EGIA 1EI1A 3HHUA 4P7AA 1TC0A 2H55A 2ESAA 2YE6A 1Z5BA 2HHIA 2YKIA 2YKCA 1BXDA 2HKJA 4WUDA 1Z5AA 1S16A 4BXIA 1UYIA 2Q8IA 1I58A 2PNRA 5BODA 1US7A 4HZ0A 4ASAA 2CCUA 3A0YA 1B62A 4LP0A 1GJVA 1TIDA 2BU5A 3HYZA 4XTJA 1AMWA 2WI2A 4ASBA 3PEHA 2FTKA 3RKZA 2BZ5A 1UYCA 3OPDA 5IDMA 2BU2A 4H85A 4YKZA 2FYPA 4MBCA 4I3HA 3A0ZA 3B26A 1YC3A 4B7PA 4FPPA 3PEJA 3VADA 4MPCA 3INWA 3EKOA 2YE5A 3T0HA 1F51A 2O1WA 2YEAA 5M4HA 4BIZA 1TBWA 1IXMA 1ID0A 4XC0A 4ZKIA 2CGFA 3CRKA 3TZ4A 4EFTA 3KE6A 4XITA 4CE1A 3D36A 2BREA 2WEPA 1B63A 3WQ9A 4R3MA 4O07A 2YEDA 3FV5A 4UROA 3LPSA 1Y4UA 4MB9A 4BAEA 3K60A 4MPEA 2YE8A 2YEBA 4FMTA 3R4NA 4BQJA 2YGFA 4CWFA 4GQTA 2QFOA 2YK2A 1YSRA 4LWGA 4XDMA 1ZW9A 3A0XA 5M4MA 3ZKBA 1UY8A 4YKXA 2XD6A 4FCQA 2WI4A 1YSZA 3GIFA 4LWHA 2WI5A 4JAVA 2Q2EB 4QPKA 1TILA 3D0BA 1EA6A 2FXSA 3Q5JA 3R92A 2IWUA 5J71A 2ZBKB 5CTUA 1ZXNA 3G75A 4DZYA 3TZ2A 4CWQA 4GGLA 1NHJA 3FT5A 2Q8GA 3T2SA 2BYHA 1KZNA 2YKBA 2C1IA 4CWNA 4HXZA 2AKPA 2WI6A 3OWBA 3OW6A 2XDXA 4PL9A 2YI5A 1YC1A 1UYGA 2YGAA 2YE2A 2IOPA 2BU6A 3ZXQA 4CWOA 1UY6A 4PRXA 4GCZA 4L8ZA 3VHDA 1U2OA 2IORA 1R62A 1UYMA 4L94A 1JM6A 3K98A 1I5BA 3R4MA 4U7NA 3RLPA 4JAUA 2YEHA 2CG9A 4URLA 3OMUA 3HEKA 2YE3A 4FCRA 3T0ZA 1NHIA 5BOCA 2XX5A 4NH9A 4L90A 4I5SA 3EKRA 2YI0A 4LPBA 5CTYA 3EHFA 4MOTA 5JENA 4H81A 2BTZA 4K4OA 1Y8OA 2JJCA 4XKOA 1I59A 2WI1A 4W7TA 5IDJA 4R3AA 5M4EA 3QDDA 4URNA 5D7RA 4V26A 3FT8A 5M4PA 4HY1A 4GEEA 2YECA 2C2AA 4BIUA 1Z5CA 1QZRA 2CH4A 4XIPA 4YKQA 2BRCA 1KIJA 2YGEA 3H4LA 1NHHA 1ZXMA 1YT2A 2XHRA 4EGHA 4NH8A 5F5RA 5D7DA 3ZM7A 1YS3A 1L0OA 3S5TA 2ZKJA 5C93A 5GGZA 1I5AA 4AWQA 3GIEA 4ZVIA 3TZ0A 2QG2A 5J6AA 2HG1A 4MP2A 2XJGA 4Q20A 4YKRA 2BU7A 3O6OA 3Q5LA 2O1VA 2XX2A 1YC4A 2VW5A 4AWOA 1YT0A 1Y8PA 4WUCA 2WI7A 2IWSA 2H8MA 3BMYA 2QF6A 1UYKA 3CYGA 4GFNA 4V25A 3U67A 1AJ6A 4O09A 3C0EA 1UYDA 1S14A 3G7EA 2XK2A 3INXA 2IOQA 2XDLA 2XDSA 3B25A 1BYQA 2CCTA 2BSMA 4R1FA 2YI7A 1Z59A 4ASFA 3H80A 3R4PA 2YJWA 3HZ5A 1YETA 2XABA 3QTFA 4KFGA 3CRLA 3BM9A 3HZ1A 4MP7A 1PVGA 2XDUA 2YK9A 3C11A 5CTXA 1UY9A 4JASA 2GFDA 1I5DA 1GKZA 4E00A 1UYEA 5FNFA 2BT0A 3TTZA 1I5CA 3EHGA 4XD8A 4YKYA 5D7CA 4E72A 3VHCA 2UWDA 4ASGA 4HYPA 1TH8A 2WEQA 4EGKA 4CE2A 4EM7A 1MX0A 1A4HA 4XCLA 1AM1A 4CE3A 3NMQA 3R4OA 2YEEA 2Q8HA 5CTWA 2YJXA 3CGYA 5D6PA 1AH6A 2ZDXA 5D6QA 4L93A 3LNUA 4LWFA 1UYFA 2VCIA 4GT8A 1YESA 4O0BA 5FNCA 4FCPA 1YT1A 2QG0A 4HYMA 3A0RA 2YI6A 4HXWA 3RLQA 4DUHA 2EXLA 4H7QA 2C1GA 2GQPA 1OSFA 2WI3A 2K5BA 3U2DA 1UYHA 3GIGA 4KQVA 1GKXA 2JKIA 4URMA 4KSGA 4EMVA 2BU8A
chains in the Genus database with same CATH topology
2XJXA 2YE7A 4CWSA 2XHXA 2E0AA 3R91A 4B6CA 4E02A 4LWIA 4YKWA 1QYEA 2YE4A 4AWPA 5F3KA 2CCSA 4AS9A 2YEJA 3CWVA 3B24A 1B3QA 3OWDA 4E01A 4NH7A 3VHAA 2VCJA 2WERA 4XIQA 1THNA 1Y4SA 3TZ5A 4X9LA 1U0ZA 3DGEA 5M4NA 4CWTA 2ZDYA 3O0IA 1H7UA 3ZXOA 1H7SA 2BYIA 4QPJA 3TUHA 3JZ3A 5IN9A 4WUBA 4EFUA 3O2FA 2YKJA 2XDKA 1BKNA 2XHTA 3IEDA 2IWXA 3G7BA 1UYLA 2YKEA 4U7OA 5CPHA 3A0TA 5FNDA 4YKTA 4O04A 4LWEA 5FWKA 3K97A 3HYYA 3RLRA 3SL2A 2YEGA 1MU5A 2YEIA 4P8OA 4JQLA 4YKUA 3EHHA 3T10A 1YERA 2YEFA 3D2RA 1Y8NA 3WHAA 3EHJA 3GIGB 4L91A 4KTNA 1UY7A 4KSHA 2VWCA 3T1KA 4MPNA 2FWYA 4EEHA 5CF0A 3B27A 4XCJA 2O1UA 2HCHA 1AH8A 4XE2A 2Q8FA 3MNRP 3U2KA 1ZWHA 4XIRA 2XJJA 3B28A 3A0WA 4U93A 4HY6A 3K99A 4XKKA 3ZKDA 5L3JA 4CWPA 4PU9A 1TC6A 2XCMA 3CGZA 4O05A 4CWRA 1BGQA 1QY8A 4HZ5A 4XKAA 2XX4A 2YE9A 3Q5KA 4KP4A 4BQGA 2FWZA 5M4KA 4PRVA 4EGIA 1EI1A 3HHUA 4P7AA 1TC0A 2H55A 2ESAA 2YE6A 1Z5BA 2YKIA 2YKCA 1BXDA 2HKJA 4WUDA 1Z5AA 1S16A 4BXIA 1UYIA 2Q8IA 1I58A 2PNRA 5BODA 1US7A 4HZ0A 4ASAA 2CCUA 3A0YA 1B62A 4LP0A 1GJVA 1TIDA 2BU5A 3HYZA 4XTJA 1AMWA 2WI2A 4ASBA 3PEHA 3RKZA 2BZ5A 1UYCA 3OPDA 5IDMA 2BU2A 4H85A 4YKZA 2FYPA 4MBCA 4I3HA 3A0ZA 3B26A 1YC3A 4B7PA 4FPPA 3PEJA 3VADA 4MPCA 3INWA 3EKOA 2YE5A 3T0HA 2O1WA 2YEAA 5M4HA 4BIZA 1TBWA 1ID0A 4XC0A 4ZKIA 2CGFA 3CRKA 3TZ4A 4EFTA 3KE6A 4XITA 4CE1A 3D36A 2BREA 2WEPA 1B63A 3WQ9A 4R3MA 4O07A 2YEDA 3FV5A 4UROA 3LPSA 1Y4UA 4MB9A 4BAEA 3K60A 4MPEA 2YE8A 2YEBA 4FMTA 3R4NA 4BQJA 2YGFA 4CWFA 4GQTA 2QFOA 2YK2A 1YSRA 4LWGA 4XDMA 1ZW9A 3A0XA 5M4MA 3ZKBA 1UY8A 4YKXA 2XD6A 4FCQA 2WI4A 1YSZA 3GIFA 4LWHA 2WI5A 4JAVA 2Q2EB 4QPKA 1TILA 3D0BA 1EA6A 2FXSA 3Q5JA 3R92A 2IWUA 5J71A 2ZBKB 5CTUA 1ZXNA 3G75A 4DZYA 3TZ2A 4CWQA 4GGLA 1NHJA 3FT5A 2Q8GA 3T2SA 2BYHA 1KZNA 2YKBA 4CWNA 4HXZA 2AKPA 2WI6A 3OWBA 3OW6A 2XDXA 4PL9A 2YI5A 1YC1A 1UYGA 2YGAA 2YE2A 2IOPA 2BU6A 3ZXQA 4CWOA 1UY6A 4PRXA 4GCZA 4L8ZA 3VHDA 1U2OA 2IORA 1R62A 1UYMA 4L94A 1JM6A 3K98A 1I5BA 3R4MA 4U7NA 3RLPA 4JAUA 2YEHA 2CG9A 4URLA 3OMUA 3HEKA 2YE3A 4FCRA 3T0ZA 1NHIA 5BOCA 2XX5A 4NH9A 4L90A 4I5SA 3EKRA 2YI0A 4LPBA 5CTYA 3EHFA 4MOTA 4H81A 2BTZA 4K4OA 1Y8OA 2JJCA 4XKOA 1I59A 2WI1A 4W7TA 5IDJA 4R3AA 5M4EA 3QDDA 4URNA 5D7RA 4V26A 3FT8A 5M4PA 4HY1A 4GEEA 2YECA 2C2AA 4BIUA 1Z5CA 1QZRA 2CH4A 4XIPA 4YKQA 2BRCA 1KIJA 2YGEA 3H4LA 1NHHA 1ZXMA 1YT2A 2XHRA 4EGHA 4NH8A 5F5RA 5D7DA 3ZM7A 1YS3A 1L0OA 2ZKJA 5C93A 5GGZA 1I5AA 4AWQA 3GIEA 4ZVIA 3TZ0A 2QG2A 5J6AA 2HG1A 4MP2A 2XJGA 4Q20A 4YKRA 2BU7A 3O6OA 3Q5LA 2O1VA 2XX2A 1YC4A 2VW5A 4AWOA 1YT0A 1Y8PA 4WUCA 2WI7A 2IWSA 2H8MA 3BMYA 2QF6A 1UYKA 4GFNA 4V25A 3U67A 1AJ6A 4O09A 3C0EA 1UYDA 1S14A 3G7EA 2XK2A 3INXA 2IOQA 2XDLA 2XDSA 3B25A 1BYQA 2CCTA 2BSMA 4R1FA 2YI7A 1Z59A 4ASFA 3H80A 3R4PA 2YJWA 3HZ5A 1YETA 2XABA 3QTFA 4KFGA 3CRLA 3BM9A 3HZ1A 4MP7A 1PVGA 2XDUA 2YK9A 3C11A 5CTXA 1UY9A 4JASA 2GFDA 1I5DA 1GKZA 4E00A 1UYEA 5FNFA 2BT0A 3TTZA 1I5CA 3EHGA 4XD8A 4YKYA 5D7CA 3VHCA 2UWDA 4ASGA 4HYPA 1TH8A 2WEQA 4EGKA 4CE2A 4EM7A 1MX0A 1A4HA 4XCLA 1AM1A 4CE3A 3NMQA 3R4OA 2YEEA 2Q8HA 5CTWA 2YJXA 3CGYA 5D6PA 1AH6A 2ZDXA 5D6QA 4L93A 3LNUA 4LWFA 1UYFA 2VCIA 4GT8A 1YESA 4O0BA 5FNCA 4FCPA 1YT1A 2QG0A 4HYMA 3A0RA 2YI6A 4HXWA 3RLQA 4DUHA 2EXLA 4H7QA 2GQPA 1OSFA 2WI3A 2K5BA 3U2DA 1UYHA 3GIGA 4KQVA 1GKXA 2JKIA 4URMA 4KSGA 4EMVA 2BU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XJX A;  2YE7 A;  4CWS A;  2XHX A;  2E0A A;  3R91 A;  4B6C A;  4E02 A;  4LWI A;  4YKW A;  1QYE A;  2YE4 A;  4AWP A;  5F3K A;  2CCS A;  4AS9 A;  2YEJ A;  3CWV A;  3B24 A;  1B3Q A;  3OWD A;  4E01 A;  4NH7 A;  3VHA A;  2VCJ A;  2WER A;  4XIQ A;  1THN A;  1Y4S A;  3TZ5 A;  4X9L A;  1U0Z A;  3DGE A;  5M4N A;  4CWT A;  2ZDY A;  3O0I A;  1H7U A;  3ZXO A;  1H7S A;  2BYI A;  4QPJ A;  3TUH A;  3JZ3 A;  5IN9 A;  4WUB A;  4EFU A;  3O2F A;  2YKJ A;  2XDK A;  1BKN A;  2XHT A;  3IED A;  2IWX A;  3G7B A;  1UYL A;  2YKE A;  4U7O A;  5CPH A;  3A0T A;  5FND A;  4YKT A;  4O04 A;  4LWE A;  5FWK A;  3K97 A;  3HYY A;  3RLR A;  3SL2 A;  2YEG A;  1MU5 A;  2YEI A;  4P8O A;  4JQL A;  4YKU A;  3EHH A;  3T10 A;  1YER A;  2YEF A;  3D2R A;  1Y8N A;  3WHA A;  3EHJ A;  3GIG B;  4L91 A;  4KTN A;  1UY7 A;  4KSH A;  2VWC A;  3T1K A;  4MPN A;  2FWY A;  4EEH A;  5CF0 A;  3B27 A;  4XCJ A;  2O1U A;  2HCH A;  1AH8 A;  4XE2 A;  2Q8F A;  3MNR P;  3U2K A;  1ZWH A;  4XIR A;  2XJJ A;  3B28 A;  3A0W A;  4U93 A;  4HY6 A;  3K99 A;  4XKK A;  3ZKD A;  5L3J A;  4CWP A;  4PU9 A;  1TC6 A;  2XCM A;  3CGZ A;  4O05 A;  4CWR A;  1BGQ A;  1QY8 A;  4HZ5 A;  4XKA A;  2XX4 A;  2YE9 A;  3Q5K A;  4KP4 A;  4BQG A;  2FWZ A;  5M4K A;  4PRV A;  4EGI A;  1EI1 A;  3HHU A;  4P7A A;  1TC0 A;  2H55 A;  2ESA A;  2YE6 A;  1Z5B A;  2YKI A;  2YKC A;  1BXD A;  2HKJ A;  4WUD A;  1Z5A A;  1S16 A;  4BXI A;  1UYI A;  2Q8I A;  1I58 A;  2PNR A;  5BOD A;  1US7 A;  4HZ0 A;  4ASA A;  2CCU A;  3A0Y A;  1B62 A;  4LP0 A;  1GJV A;  1TID A;  2BU5 A;  3HYZ A;  4XTJ A;  1AMW A;  2WI2 A;  4ASB A;  3PEH A;  3RKZ A;  2BZ5 A;  1UYC A;  3OPD A;  5IDM A;  2BU2 A;  4H85 A;  4YKZ A;  2FYP A;  4MBC A;  4I3H A;  3A0Z A;  3B26 A;  1YC3 A;  4B7P A;  4FPP A;  3PEJ A;  3VAD A;  4MPC A;  3INW A;  3EKO A;  2YE5 A;  3T0H A;  2O1W A;  2YEA A;  5M4H A;  4BIZ A;  1TBW A;  1ID0 A;  4XC0 A;  4ZKI A;  2CGF A;  3CRK A;  3TZ4 A;  4EFT A;  3KE6 A;  4XIT A;  4CE1 A;  3D36 A;  2BRE A;  2WEP A;  1B63 A;  3WQ9 A;  4R3M A;  4O07 A;  2YED A;  3FV5 A;  4URO A;  3LPS A;  1Y4U A;  4MB9 A;  4BAE A;  3K60 A;  4MPE A;  2YE8 A;  2YEB A;  4FMT A;  3R4N A;  4BQJ A;  2YGF A;  4CWF A;  4GQT A;  2QFO A;  2YK2 A;  1YSR A;  4LWG A;  4XDM A;  1ZW9 A;  3A0X A;  5M4M A;  3ZKB A;  1UY8 A;  4YKX A;  2XD6 A;  4FCQ A;  2WI4 A;  1YSZ A;  3GIF A;  4LWH A;  2WI5 A;  4JAV A;  2Q2E B;  4QPK A;  1TIL A;  3D0B A;  1EA6 A;  2FXS A;  3Q5J A;  3R92 A;  2IWU A;  5J71 A;  2ZBK B;  5CTU A;  1ZXN A;  3G75 A;  4DZY A;  3TZ2 A;  4CWQ A;  4GGL A;  1NHJ A;  3FT5 A;  2Q8G A;  3T2S A;  2BYH A;  1KZN A;  2YKB A;  4CWN A;  4HXZ A;  2AKP A;  2WI6 A;  3OWB A;  3OW6 A;  2XDX A;  4PL9 A;  2YI5 A;  1YC1 A;  1UYG A;  2YGA A;  2YE2 A;  2IOP A;  2BU6 A;  3ZXQ A;  4CWO A;  1UY6 A;  4PRX A;  4GCZ A;  4L8Z A;  3VHD A;  1U2O A;  2IOR A;  1R62 A;  1UYM A;  4L94 A;  1JM6 A;  3K98 A;  1I5B A;  3R4M A;  4U7N A;  3RLP A;  4JAU A;  2YEH A;  2CG9 A;  4URL A;  3OMU A;  3HEK A;  2YE3 A;  4FCR A;  3T0Z A;  1NHI A;  5BOC A;  2XX5 A;  4NH9 A;  4L90 A;  4I5S A;  3EKR A;  2YI0 A;  4LPB A;  5CTY A;  3EHF A;  4MOT A;  4H81 A;  2BTZ A;  4K4O A;  1Y8O A;  2JJC A;  4XKO A;  1I59 A;  2WI1 A;  4W7T A;  5IDJ A;  4R3A A;  5M4E A;  3QDD A;  4URN A;  5D7R A;  4V26 A;  3FT8 A;  5M4P A;  4HY1 A;  4GEE A;  2YEC A;  2C2A A;  4BIU A;  1Z5C A;  1QZR A;  2CH4 A;  4XIP A;  4YKQ A;  2BRC A;  1KIJ A;  2YGE A;  3H4L A;  1NHH A;  1ZXM A;  1YT2 A;  2XHR A;  4EGH A;  4NH8 A;  5F5R A;  5D7D A;  3ZM7 A;  1YS3 A;  1L0O A;  2ZKJ A;  5C93 A;  5GGZ A;  1I5A A;  4AWQ A;  3GIE A;  4ZVI A;  3TZ0 A;  2QG2 A;  5J6A A;  2HG1 A;  4MP2 A;  2XJG A;  4Q20 A;  4YKR A;  2BU7 A;  3O6O A;  3Q5L A;  2O1V A;  2XX2 A;  1YC4 A;  2VW5 A;  4AWO A;  1YT0 A;  1Y8P A;  4WUC A;  2WI7 A;  2IWS A;  2H8M A;  3BMY A;  2QF6 A;  1UYK A;  4GFN A;  4V25 A;  3U67 A;  1AJ6 A;  4O09 A;  3C0E A;  1UYD A;  1S14 A;  3G7E A;  2XK2 A;  3INX A;  2IOQ A;  2XDL A;  2XDS A;  3B25 A;  1BYQ A;  2CCT A;  2BSM A;  4R1F A;  2YI7 A;  1Z59 A;  4ASF A;  3H80 A;  3R4P A;  2YJW A;  3HZ5 A;  1YET A;  2XAB A;  3QTF A;  4KFG A;  3CRL A;  3BM9 A;  3HZ1 A;  4MP7 A;  1PVG A;  2XDU A;  2YK9 A;  3C11 A;  5CTX A;  1UY9 A;  4JAS A;  2GFD A;  1I5D A;  1GKZ A;  4E00 A;  1UYE A;  5FNF A;  2BT0 A;  3TTZ A;  1I5C A;  3EHG A;  4XD8 A;  4YKY A;  5D7C A;  3VHC A;  2UWD A;  4ASG A;  4HYP A;  1TH8 A;  2WEQ A;  4EGK A;  4CE2 A;  4EM7 A;  1MX0 A;  1A4H A;  4XCL A;  1AM1 A;  4CE3 A;  3NMQ A;  3R4O A;  2YEE A;  2Q8H A;  5CTW A;  2YJX A;  3CGY A;  5D6P A;  1AH6 A;  2ZDX A;  5D6Q A;  4L93 A;  3LNU A;  4LWF A;  1UYF A;  2VCI A;  4GT8 A;  1YES A;  4O0B A;  5FNC A;  4FCP A;  1YT1 A;  2QG0 A;  4HYM A;  3A0R A;  2YI6 A;  4HXW A;  3RLQ A;  4DUH A;  2EXL A;  4H7Q A;  2GQP A;  1OSF A;  2WI3 A;  2K5B A;  3U2D A;  1UYH A;  3GIG A;  4KQV A;  1GKX A;  2JKI A;  4URM A;  4KSG A;  4EMV A;  2BU8 A; 
#chains in the Genus database with same CATH topology
 2XJX A;  2YE7 A;  4CWS A;  2XHX A;  2E0A A;  3R91 A;  4B6C A;  4E02 A;  4LWI A;  4YKW A;  1QYE A;  2YE4 A;  4AWP A;  5F3K A;  2CCS A;  4AS9 A;  2YEJ A;  3CWV A;  3B24 A;  1B3Q A;  3OWD A;  4E01 A;  4NH7 A;  3VHA A;  2VCJ A;  2WER A;  4XIQ A;  1THN A;  1Y4S A;  3TZ5 A;  4X9L A;  1U0Z A;  3DGE A;  5M4N A;  4CWT A;  2ZDY A;  3O0I A;  1H7U A;  3ZXO A;  1H7S A;  2BYI A;  4QPJ A;  3TUH A;  3JZ3 A;  5IN9 A;  4WUB A;  4EFU A;  3O2F A;  2YKJ A;  2XDK A;  1BKN A;  2XHT A;  3IED A;  2IWX A;  3G7B A;  1UYL A;  2YKE A;  4U7O A;  5CPH A;  3A0T A;  5FND A;  4YKT A;  4O04 A;  4LWE A;  5FWK A;  3K97 A;  3HYY A;  3RLR A;  3SL2 A;  2YEG A;  1MU5 A;  2YEI A;  4P8O A;  4JQL A;  4YKU A;  3EHH A;  3T10 A;  1YER A;  2YEF A;  3D2R A;  1Y8N A;  3WHA A;  3EHJ A;  3GIG B;  4L91 A;  4KTN A;  3LMM A;  1UY7 A;  4KSH A;  2VWC A;  3T1K A;  4MPN A;  2FWY A;  4EEH A;  5CF0 A;  3B27 A;  4XCJ A;  2O1U A;  2HCH A;  1AH8 A;  4XE2 A;  2Q8F A;  3MNR P;  3U2K A;  1ZWH A;  4XIR A;  2XJJ A;  3B28 A;  3A0W A;  4U93 A;  4HY6 A;  3K99 A;  4XKK A;  3ZKD A;  5L3J A;  4CWP A;  4PU9 A;  1TC6 A;  2XCM A;  3CGZ A;  4O05 A;  4CWR A;  1BGQ A;  1QY8 A;  4HZ5 A;  4XKA A;  2XX4 A;  2YE9 A;  3Q5K A;  4KP4 A;  4BQG A;  2FWZ A;  5M4K A;  4PRV A;  4EGI A;  1EI1 A;  3HHU A;  4P7A A;  1TC0 A;  2H55 A;  2ESA A;  2YE6 A;  1Z5B A;  2HHI A;  2YKI A;  2YKC A;  1BXD A;  2HKJ A;  4WUD A;  1Z5A A;  1S16 A;  4BXI A;  1UYI A;  2Q8I A;  1I58 A;  2PNR A;  5BOD A;  1US7 A;  4HZ0 A;  4ASA A;  2CCU A;  3A0Y A;  1B62 A;  4LP0 A;  1GJV A;  1TID A;  2BU5 A;  3HYZ A;  4XTJ A;  1AMW A;  2WI2 A;  4ASB A;  3PEH A;  2FTK A;  3RKZ A;  2BZ5 A;  1UYC A;  3OPD A;  5IDM A;  2BU2 A;  4H85 A;  4YKZ A;  2FYP A;  4MBC A;  4I3H A;  3A0Z A;  3B26 A;  1YC3 A;  4B7P A;  4FPP A;  3PEJ A;  3VAD A;  4MPC A;  3INW A;  3EKO A;  2YE5 A;  3T0H A;  1F51 A;  2O1W A;  2YEA A;  5M4H A;  4BIZ A;  1TBW A;  1IXM A;  1ID0 A;  4XC0 A;  4ZKI A;  2CGF A;  3CRK A;  3TZ4 A;  4EFT A;  3KE6 A;  4XIT A;  4CE1 A;  3D36 A;  2BRE A;  2WEP A;  1B63 A;  3WQ9 A;  4R3M A;  4O07 A;  2YED A;  3FV5 A;  4URO A;  3LPS A;  1Y4U A;  4MB9 A;  4BAE A;  3K60 A;  4MPE A;  2YE8 A;  2YEB A;  4FMT A;  3R4N A;  4BQJ A;  2YGF A;  4CWF A;  4GQT A;  2QFO A;  2YK2 A;  1YSR A;  4LWG A;  4XDM A;  1ZW9 A;  3A0X A;  5M4M A;  3ZKB A;  1UY8 A;  4YKX A;  2XD6 A;  4FCQ A;  2WI4 A;  1YSZ A;  3GIF A;  4LWH A;  2WI5 A;  4JAV A;  2Q2E B;  4QPK A;  1TIL A;  3D0B A;  1EA6 A;  2FXS A;  3Q5J A;  3R92 A;  2IWU A;  5J71 A;  2ZBK B;  5CTU A;  1ZXN A;  3G75 A;  4DZY A;  3TZ2 A;  4CWQ A;  4GGL A;  1NHJ A;  3FT5 A;  2Q8G A;  3T2S A;  2BYH A;  1KZN A;  2YKB A;  2C1I A;  4CWN A;  4HXZ A;  2AKP A;  2WI6 A;  3OWB A;  3OW6 A;  2XDX A;  4PL9 A;  2YI5 A;  1YC1 A;  1UYG A;  2YGA A;  2YE2 A;  2IOP A;  2BU6 A;  3ZXQ A;  4CWO A;  1UY6 A;  4PRX A;  4GCZ A;  4L8Z A;  3VHD A;  1U2O A;  2IOR A;  1R62 A;  1UYM A;  4L94 A;  1JM6 A;  3K98 A;  1I5B A;  3R4M A;  4U7N A;  3RLP A;  4JAU A;  2YEH A;  2CG9 A;  4URL A;  3OMU A;  3HEK A;  2YE3 A;  4FCR A;  3T0Z A;  1NHI A;  5BOC A;  2XX5 A;  4NH9 A;  4L90 A;  4I5S A;  3EKR A;  2YI0 A;  4LPB A;  5CTY A;  3EHF A;  4MOT A;  5JEN A;  4H81 A;  2BTZ A;  4K4O A;  1Y8O A;  2JJC A;  4XKO A;  1I59 A;  2WI1 A;  4W7T A;  5IDJ A;  4R3A A;  5M4E A;  3QDD A;  4URN A;  5D7R A;  4V26 A;  3FT8 A;  5M4P A;  4HY1 A;  4GEE A;  2YEC A;  2C2A A;  4BIU A;  1Z5C A;  1QZR A;  2CH4 A;  4XIP A;  4YKQ A;  2BRC A;  1KIJ A;  2YGE A;  3H4L A;  1NHH A;  1ZXM A;  1YT2 A;  2XHR A;  4EGH A;  4NH8 A;  5F5R A;  5D7D A;  3ZM7 A;  1YS3 A;  1L0O A;  3S5T A;  2ZKJ A;  5C93 A;  5GGZ A;  1I5A A;  4AWQ A;  3GIE A;  4ZVI A;  3TZ0 A;  2QG2 A;  5J6A A;  2HG1 A;  4MP2 A;  2XJG A;  4Q20 A;  4YKR A;  2BU7 A;  3O6O A;  3Q5L A;  2O1V A;  2XX2 A;  1YC4 A;  2VW5 A;  4AWO A;  1YT0 A;  1Y8P A;  4WUC A;  2WI7 A;  2IWS A;  2H8M A;  3BMY A;  2QF6 A;  1UYK A;  3CYG A;  4GFN A;  4V25 A;  3U67 A;  1AJ6 A;  4O09 A;  3C0E A;  1UYD A;  1S14 A;  3G7E A;  2XK2 A;  3INX A;  2IOQ A;  2XDL A;  2XDS A;  3B25 A;  1BYQ A;  2CCT A;  2BSM A;  4R1F A;  2YI7 A;  1Z59 A;  4ASF A;  3H80 A;  3R4P A;  2YJW A;  3HZ5 A;  1YET A;  2XAB A;  3QTF A;  4KFG A;  3CRL A;  3BM9 A;  3HZ1 A;  4MP7 A;  1PVG A;  2XDU A;  2YK9 A;  3C11 A;  5CTX A;  1UY9 A;  4JAS A;  2GFD A;  1I5D A;  1GKZ A;  4E00 A;  1UYE A;  5FNF A;  2BT0 A;  3TTZ A;  1I5C A;  3EHG A;  4XD8 A;  4YKY A;  5D7C A;  4E72 A;  3VHC A;  2UWD A;  4ASG A;  4HYP A;  1TH8 A;  2WEQ A;  4EGK A;  4CE2 A;  4EM7 A;  1MX0 A;  1A4H A;  4XCL A;  1AM1 A;  4CE3 A;  3NMQ A;  3R4O A;  2YEE A;  2Q8H A;  5CTW A;  2YJX A;  3CGY A;  5D6P A;  1AH6 A;  2ZDX A;  5D6Q A;  4L93 A;  3LNU A;  4LWF A;  1UYF A;  2VCI A;  4GT8 A;  1YES A;  4O0B A;  5FNC A;  4FCP A;  1YT1 A;  2QG0 A;  4HYM A;  3A0R A;  2YI6 A;  4HXW A;  3RLQ A;  4DUH A;  2EXL A;  4H7Q A;  2C1G A;  2GQP A;  1OSF A;  2WI3 A;  2K5B A;  3U2D A;  1UYH A;  3GIG A;  4KQV A;  1GKX A;  2JKI A;  4URM A;  4KSG A;  4EMV A;  2BU8 A; 
#chains in the Genus database with same CATH homology
 2XJX A;  2YE7 A;  4CWS A;  2XHX A;  2E0A A;  3R91 A;  4B6C A;  4E02 A;  4LWI A;  4YKW A;  1QYE A;  2YE4 A;  4AWP A;  5F3K A;  2CCS A;  4AS9 A;  2YEJ A;  3CWV A;  3B24 A;  1B3Q A;  3OWD A;  4E01 A;  4NH7 A;  3VHA A;  2VCJ A;  2WER A;  4XIQ A;  1THN A;  1Y4S A;  3TZ5 A;  4X9L A;  1U0Z A;  3DGE A;  5M4N A;  4CWT A;  2ZDY A;  3O0I A;  1H7U A;  3ZXO A;  1H7S A;  2BYI A;  4QPJ A;  3TUH A;  3JZ3 A;  5IN9 A;  4WUB A;  4EFU A;  3O2F A;  2YKJ A;  2XDK A;  1BKN A;  2XHT A;  3IED A;  2IWX A;  3G7B A;  1UYL A;  2YKE A;  4U7O A;  5CPH A;  3A0T A;  5FND A;  4YKT A;  4O04 A;  4LWE A;  5FWK A;  3K97 A;  3HYY A;  3RLR A;  3SL2 A;  2YEG A;  1MU5 A;  2YEI A;  4P8O A;  4JQL A;  4YKU A;  3EHH A;  3T10 A;  1YER A;  2YEF A;  3D2R A;  1Y8N A;  3WHA A;  3EHJ A;  3GIG B;  4L91 A;  4KTN A;  1UY7 A;  4KSH A;  2VWC A;  3T1K A;  4MPN A;  2FWY A;  4EEH A;  5CF0 A;  3B27 A;  4XCJ A;  2O1U A;  2HCH A;  1AH8 A;  4XE2 A;  2Q8F A;  3MNR P;  3U2K A;  1ZWH A;  4XIR A;  2XJJ A;  3B28 A;  3A0W A;  4U93 A;  4HY6 A;  3K99 A;  4XKK A;  3ZKD A;  5L3J A;  4CWP A;  4PU9 A;  1TC6 A;  2XCM A;  3CGZ A;  4O05 A;  4CWR A;  1BGQ A;  1QY8 A;  4HZ5 A;  4XKA A;  2XX4 A;  2YE9 A;  3Q5K A;  4KP4 A;  4BQG A;  2FWZ A;  5M4K A;  4PRV A;  4EGI A;  1EI1 A;  3HHU A;  4P7A A;  1TC0 A;  2H55 A;  2ESA A;  2YE6 A;  1Z5B A;  2YKI A;  2YKC A;  1BXD A;  2HKJ A;  4WUD A;  1Z5A A;  1S16 A;  4BXI A;  1UYI A;  2Q8I A;  1I58 A;  2PNR A;  5BOD A;  1US7 A;  4HZ0 A;  4ASA A;  2CCU A;  3A0Y A;  1B62 A;  4LP0 A;  1GJV A;  1TID A;  2BU5 A;  3HYZ A;  4XTJ A;  1AMW A;  2WI2 A;  4ASB A;  3PEH A;  3RKZ A;  2BZ5 A;  1UYC A;  3OPD A;  5IDM A;  2BU2 A;  4H85 A;  4YKZ A;  2FYP A;  4MBC A;  4I3H A;  3A0Z A;  3B26 A;  1YC3 A;  4B7P A;  4FPP A;  3PEJ A;  3VAD A;  4MPC A;  3INW A;  3EKO A;  2YE5 A;  3T0H A;  2O1W A;  2YEA A;  5M4H A;  4BIZ A;  1TBW A;  1ID0 A;  4XC0 A;  4ZKI A;  2CGF A;  3CRK A;  3TZ4 A;  4EFT A;  3KE6 A;  4XIT A;  4CE1 A;  3D36 A;  2BRE A;  2WEP A;  1B63 A;  3WQ9 A;  4R3M A;  4O07 A;  2YED A;  3FV5 A;  4URO A;  3LPS A;  1Y4U A;  4MB9 A;  4BAE A;  3K60 A;  4MPE A;  2YE8 A;  2YEB A;  4FMT A;  3R4N A;  4BQJ A;  2YGF A;  4CWF A;  4GQT A;  2QFO A;  2YK2 A;  1YSR A;  4LWG A;  4XDM A;  1ZW9 A;  3A0X A;  5M4M A;  3ZKB A;  1UY8 A;  4YKX A;  2XD6 A;  4FCQ A;  2WI4 A;  1YSZ A;  3GIF A;  4LWH A;  2WI5 A;  4JAV A;  2Q2E B;  4QPK A;  1TIL A;  3D0B A;  1EA6 A;  2FXS A;  3Q5J A;  3R92 A;  2IWU A;  5J71 A;  2ZBK B;  5CTU A;  1ZXN A;  3G75 A;  4DZY A;  3TZ2 A;  4CWQ A;  4GGL A;  1NHJ A;  3FT5 A;  2Q8G A;  3T2S A;  2BYH A;  1KZN A;  2YKB A;  4CWN A;  4HXZ A;  2AKP A;  2WI6 A;  3OWB A;  3OW6 A;  2XDX A;  4PL9 A;  2YI5 A;  1YC1 A;  1UYG A;  2YGA A;  2YE2 A;  2IOP A;  2BU6 A;  3ZXQ A;  4CWO A;  1UY6 A;  4PRX A;  4GCZ A;  4L8Z A;  3VHD A;  1U2O A;  2IOR A;  1R62 A;  1UYM A;  4L94 A;  1JM6 A;  3K98 A;  1I5B A;  3R4M A;  4U7N A;  3RLP A;  4JAU A;  2YEH A;  2CG9 A;  4URL A;  3OMU A;  3HEK A;  2YE3 A;  4FCR A;  3T0Z A;  1NHI A;  5BOC A;  2XX5 A;  4NH9 A;  4L90 A;  4I5S A;  3EKR A;  2YI0 A;  4LPB A;  5CTY A;  3EHF A;  4MOT A;  4H81 A;  2BTZ A;  4K4O A;  1Y8O A;  2JJC A;  4XKO A;  1I59 A;  2WI1 A;  4W7T A;  5IDJ A;  4R3A A;  5M4E A;  3QDD A;  4URN A;  5D7R A;  4V26 A;  3FT8 A;  5M4P A;  4HY1 A;  4GEE A;  2YEC A;  2C2A A;  4BIU A;  1Z5C A;  1QZR A;  2CH4 A;  4XIP A;  4YKQ A;  2BRC A;  1KIJ A;  2YGE A;  3H4L A;  1NHH A;  1ZXM A;  1YT2 A;  2XHR A;  4EGH A;  4NH8 A;  5F5R A;  5D7D A;  3ZM7 A;  1YS3 A;  1L0O A;  2ZKJ A;  5C93 A;  5GGZ A;  1I5A A;  4AWQ A;  3GIE A;  4ZVI A;  3TZ0 A;  2QG2 A;  5J6A A;  2HG1 A;  4MP2 A;  2XJG A;  4Q20 A;  4YKR A;  2BU7 A;  3O6O A;  3Q5L A;  2O1V A;  2XX2 A;  1YC4 A;  2VW5 A;  4AWO A;  1YT0 A;  1Y8P A;  4WUC A;  2WI7 A;  2IWS A;  2H8M A;  3BMY A;  2QF6 A;  1UYK A;  4GFN A;  4V25 A;  3U67 A;  1AJ6 A;  4O09 A;  3C0E A;  1UYD A;  1S14 A;  3G7E A;  2XK2 A;  3INX A;  2IOQ A;  2XDL A;  2XDS A;  3B25 A;  1BYQ A;  2CCT A;  2BSM A;  4R1F A;  2YI7 A;  1Z59 A;  4ASF A;  3H80 A;  3R4P A;  2YJW A;  3HZ5 A;  1YET A;  2XAB A;  3QTF A;  4KFG A;  3CRL A;  3BM9 A;  3HZ1 A;  4MP7 A;  1PVG A;  2XDU A;  2YK9 A;  3C11 A;  5CTX A;  1UY9 A;  4JAS A;  2GFD A;  1I5D A;  1GKZ A;  4E00 A;  1UYE A;  5FNF A;  2BT0 A;  3TTZ A;  1I5C A;  3EHG A;  4XD8 A;  4YKY A;  5D7C A;  3VHC A;  2UWD A;  4ASG A;  4HYP A;  1TH8 A;  2WEQ A;  4EGK A;  4CE2 A;  4EM7 A;  1MX0 A;  1A4H A;  4XCL A;  1AM1 A;  4CE3 A;  3NMQ A;  3R4O A;  2YEE A;  2Q8H A;  5CTW A;  2YJX A;  3CGY A;  5D6P A;  1AH6 A;  2ZDX A;  5D6Q A;  4L93 A;  3LNU A;  4LWF A;  1UYF A;  2VCI A;  4GT8 A;  1YES A;  4O0B A;  5FNC A;  4FCP A;  1YT1 A;  2QG0 A;  4HYM A;  3A0R A;  2YI6 A;  4HXW A;  3RLQ A;  4DUH A;  2EXL A;  4H7Q A;  2GQP A;  1OSF A;  2WI3 A;  2K5B A;  3U2D A;  1UYH A;  3GIG A;  4KQV A;  1GKX A;  2JKI A;  4URM A;  4KSG A;  4EMV A;  2BU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...