4GEIA

N-terminal domain of vdup-1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
144
Chain Sequence
KIKSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCAQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-interacting protein
publication title Structure of the N-terminal domain of human thioredoxin-interacting protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4geiA00
3UGUA 4J2QA 4P2AA 2FAUA 1CF1A 4GEJA 4GEIA 4JQIA 3LH9A 5F0LB 1AYRA 1G4RA 5F0MB 1SUJA 1ZSHA 2WTRB 4R7XA 3GD1C 2WTRA 5F0PB 4LL1A 4LL4A 3LHAA 3UGXA 3GC3A 2R51A 1JSYA 4R7VA 5F0JB 1G4MA 3LH8A 4ZRGA 4GFXA 3P2DA
chains in the Genus database with same CATH superfamily
5DXWA 1UC6A 2OZ4L 5FW8A 2JJWA 5DUPL 5C0NC 5M95B 3FBKA 2PPFA 4BIKA 4AYGA 4XCCH 3NGBB 1HC1A 3VNYA 1E9OB 4C47A 3ULVL 3MUGB 1R5WB 4WWKC 1ET7A 4HQQL 1WQVT 5EORL 5B38A 2GC4C 1ZK5A 3B2MA 5C97A 1OB0A 3IN2A 4IGBC 2QMKA 2YLHA 1KFAL 3EH5B 3NQKA 4OCYH 3QWRD 1HQRA 4KKZA 4ZW8A 5EEYA 1GYAA 4XVTH 1VZIA 4O2EB 5GPRA 4MZ3A 4XT1C 1CDGA 5I73B 4UQBA 4NZJA 2E9IA 2BSSA 3NCMA 3HR5B 2AANA 2PTTA 2ZAIA 1P1ZB 4Q9BA 2OL3H 5D7KD 1G84A 3NFPA 3QEQB 5MERA 2VNCA 1JZIA 3BQUC 3HTLX 3WDHA 1SQ2N 1ZV5A 2IAAC 4R96A 3AQZA 4XC3L 3TBTA 5BO0D 1F02I 4LKCA 3F12A 5C0ND 2YAQA 1BFVL 1OK8A 3WV0A 3EFOB 1SOQA 2XV0A 5DHEA 3UZQA 3MNVA 4L3EA 5K59E 3SJVD 3OZ9H 1CLYH 4RH4A 1SXBA 2X6CA 3T0XA 2G2NA 3NK4A 2GI7A 1Z6JT 3O6LL 4TLTA 2FR4A 4Z77A 1FG9C 4LF3B 4PJEF 4XNUH 1XB3A 3ZGIA 3NEXA 1U8QB 3PWLB 5A2IH 4FQXD 3MODL 4IGBD 4K71C 3TTSA 4ZMYA 5BJTB 2J1WA 1M9SA 5DQDH 4JL1A 5DMYA 1WEJH 4AJ0A 3C6LC 4U31A 3CZFB 3R1GH 3TURA 2VUKA 3CLEL 2ZUUA 3MCYA 5IW1B 3VVWA 4B60A 3VWKD 4E0RB 1YNTF 3V6BR 3VD4A 3BQUD 4HJ0C 4EUPH 1FYTD 2UXTA 1MFVA 4FX5A 5EU7E 1BV8A 1XGTB 5JORB 2BNRD 3EH2A 2IV9A 1E0OB 1KBBA 3DXAA 1RZIB 4MNGB 3G5XA 1O7DC 1RPKA 2ITDA 2GEEA 1SMDA 2YUZA 2HLAB 1YUHB 2H1PL 4TSAL 2GY5A 2R1YA 1BMGA 2PWGA 1KYFA 1UEMA 4DGVH 1FZJB 3SKNB 1JVLA 1LK3H 2GAZA 5CN1A 5FA4B 5CCGE 3CZKA 1YA5A 5DJZA 1L6PA 3QCTL 4N0RA 3BIBX 3O9WD 1NUFA 3Q0HA 2H0EA 1P4LB 3UAJA 5E5RB 2PW1B 1IM3D 2B0SL 5DD1H 2NYZA 3OQRA 1W0VA 3DTXB 2QLYA 3B7YA 3P3TA 1CVRA 1MZZA 3Q9QA 5IOPA 2JQZA 3EO1A 5CUSH 3CFUA 1DJHA 4OZGA 3T3PB 2E6PA 4L3EE 2JV6A 1IM9B 4CL7A 1U8KA 2ZUSA 3JWNG 1FO0B 5L88L 2NUPB 2X1QA 5GGQH 2ZKXA 4RMUA 5DWPA 4FN0A 4LSTL 4DN3L 1CUOA 4OB5H 5JHDB 3UTTA 3MLYH 3M8OH 2WO3B 1DQDH 2WXOA 3IDXH 3QAZC 3LKRA 4PJCB 2CBQA 1G7QB 4KXBA 3GJEA 3W37A 4G6AD 2AQ3A 1R5VB 4NXSA 2Z7YA 2FX7L 3BD4A 4UBDC 4I3GA 2DMHA 3HPLA 2BNUA 3QZLA 4RZKA 5CSGA 3SKOB 5GRVL 3F84A 4F3FB 1H8OA 3ISRA 1SM3L 3B9KC 4I0CC 2E6QA 1AP2A 2NYKA 2PF6A 3BQVA 1XFPA 4HEPA 4KMTH 2DQ6A 2VQ1B 4YDLC 3CSBA 1RJZB 4U6HA 3IMSA 5EU6E 4HIJA 4K7FA 5DLLA 4TLUA 1WJ3A 4X5LA 5GGSY 5DZJA 3OMNB 3ML8A 1FFNB 3BYYA 4K2UH 1KN2H 3VMPA 3B2PA 2XWJA 4YDJA 4OZIB 1E8YA 3GSOB 4LAJH 2FT7A 4QRPD 15C8H 4ZW5A 4M48L 1DSFL 3GT6A 1OE2A 3WIIH 5FIEA 1IAIH 4HKZB 4OGXH 4P3CH 5ITFA 4JZOA 5FYLL 2MRYA 4QCIB 5IB5B 3SJVA 4XN4A 3VXOA 4WWID 1OSPH 1LDPH 5D9SA 4AGOA 5E2VH 2X40A 4WWKA 5F7DB 2D03L 3V52L 3B9KD 2VDLH 3CFDA 4IGBA 3ZKXC 3ILDA 1U8NA 3GLEA 1FCCA 2DWXA 4ELMA 5F0JB 3G9AB 2OJZL 2JCCA 3T0EB 2FJFA 4LU5L 4ZMPA 4OZGE 3NT0A 3UH8A 1S5HA 3VWKA 4OQTL 3LKSA 2CLRB 3BQUA 4OLUL 5C6TH 5T5FA 1N64H 1FYTA 4PJHB 3H3PH 5DD5H 2EDTA 4FHJA 4L3FA 3SE8H 2BNRA 4F1ZA 4ORGB 3ZE2E 4WU5A 4AVIA 5ITBL 3UTTE 2X9ZA 1AHWB 1GZQA 5DHVB 4EN2A 1SMOA 2CDGB 3MRNB 4NSKB 3DPBB 2YD5A 1NCWL 1DBBL 5DA0B 1AKJB 2W0FA 3QDJE 3SEPA 3FTSA 2X6VA 2QFRA 2CALA 2X9XA 5DHXB 4DW2H 5JW3H 4G6JH 3BVWA 4CILA 3BGMA 4HJTA 4KBPA 5E2JA 2F5AL 1TTGA 3SKJL 5DT1H 4YGAB 5F8QC 2APFA 3O9WA 4QJ3B 1ITBB 1ZHNA 4QGTA 3VDAA 1XGPA 1XF5B 2ZP8A 4M4RB 5IFHL 1Q72H 3FN9A 2XPYA 2QGEA 1YDPA 1BXVA 1FC2D 3GMMB 4M8QB 3LN9A 2Y7QB 3P3UA 2AEWA 3VRIB 1JFQL 4G9DB 2YLKA 5KN5B 2GTZA 2WLKA 4XO5A 4RDQF 4WJKB 4AW4A 4UWQB 5D7EA 3NFSL 1CICD 3Q8AA 4E41B 4DUWA 1EAPB 5I1GL 3MBED 4NQXB 3C9NA 3SJVE 4HWNA 2FLRT 4R2GD 2BH0A 2FEEL 3MOAH 4ICWA 2RR3A 3C87A 5IMKA 2JMRA 4HISA 4X6FB 2CO7A 1TQTA 4GUPB 5JIKA 2UZXB 3S5ZA 1U93A 1XGZA 1NMBH 5GRJL 3RGBA 5HGHA 5TPWH 4ELME 3DX9B 1L9TA 3G5ZA 2HKFL 2HJLB 4HPYL 4TNVF 4Y5XA 1FGVH 5HYSG 3V95A 1IBFA 2DS4A 2ARJA 5DEFB 4UOW1 2HX7A 4OAWA 5EIIA 1FZOB 5EFIA 2Q3XA 3D85D 3BGAA 1FYTE 4AQAA 1JVKA 2BVQA 2IEPA 2WKOF 3APFA 2BNRE 1OHQA 2NDGA 2YD3A 4H13C 1ZLUK 4AVJA 4YHYB 4WRLA 1BDYA 2A77L 2FL5A 2FGZA 3W81A 3HMWH 2J6EL 4KAQL 3I75A 1SHMA 4LSRL 3WFEL 3JWNH 1LO2L 3QZWG 1IQDA 2ITFA 3FO1A 3MX0B 4GBXB 3F5WA 4Y4KC 1I8UA 5CCKH 4NHUA 2R4SL 2V9QA 1CFTB 2H3NB 2X6MA 1SDYA 4KVNL 2Z3FA 2E0PA 3GZKA 4KTDL 4P23B 2G0LA 1X7QB 3X1BA 4B5ZA 3FT2B 4NCDA 1DBAH 3CN1A 3B9KA 3GO1L 1F41A 3I50H 1NEPA 5GS0L 4PD4K 5J9PA 2R8SH 5FFOA 2BLFA 1A7OL 2KZ1B 3IMBA 4GW5A 4EJ1C 2WY3B 4YQXL 1GKEA 1KCVH 1WDAA 4J1UA 3LTVA 4KTEL 2WANA 1TVBB 4WHYH 3OB0H 4K73A 2WMPA 3LV3B 1NKGA 1MRFH 2FNWA 5IGXH 2DWSA 4UIKH 5DJDA 3ZT6A 4E36A 2XQYK 3ZDXE 4Y4KD 3BZ4A 1LWHA 4NOBA 2LU5A 4PW9A 3BESR 2ZX6A 5HHME 2WTRB 1B0IA 2QLVB 2X7LA 4KNQA 3T3PF 5JXAL 2HUEA 1GZPB 3SOTA 5ANMA 5FO8B 1OY3B 3N50A 4E5XB 1CU4H 3MUHL 1ASQA 1IAIM 1K4CA 5J7CC 3BZEA 4DP4X 3TBYB 1C5DA 1LP9A 3FQYA 4FP8L 4QYOB 4BFIB 1H8LA 1G94A 4OGAD 3L3KA 1JZFA 3QJHB 4HIHB 1HI6B 3K80A 2VDMH 1ZLWK 2Z4TA 3FQNA 2DEYX 1CFSB 1JOIA 3KBPA 2BIPA 5H35B 3RVVD 5L8JB 4X98B 2R1WB 5D2LE 3VXNB 5C3LD 4YIQB 1F1AA 3FUJA 4JZJB 2WUBL 4L4TE 1PLBA 2A83B 2NSQA 2YQGA 4M62L 4PJIA 4QRPE 4ES9A 1XBRA 2XXGA 5DD0L 4HOZA 1QKZL 1S7UB 1CICA 3UO1L 2A6DA 4P57A 4Y1AE 4A2FA 3ULUC 3FRPA 1QBLH 5ADPH 1P7KA 3MBEA 4HVBA 1U8CA 3NAAH 1S9VB 1GVIA 2R1XA 2IFFH 3RPBA 4FLQA 3UACA 4PS4H 3NABL 4OZIF 3EYFB 5I8EB 4NWUL 4A2DA 5EU5B 3KL3A 1RULL 1YECH 5C3IA 1MHCA 5C9KA 2Q9OA 5DJ6A 2QVIA 2BSRB 4QRUB 3TYGH 3KVDD 1KGCE 3PP4H 4N8VA 2PWDA 3L8QA 3DMMB 4QJ4B 2R51A 2WZ0A 4P5TD 3PXLA 3WJJC 4KITB 5BV7B 5C0JB 2X4NB 4OFIA 1PMYA 1A3ZA 1SJEB 4H26B 4L1BA 2DWEB 4F27A 2E56A 3UTSB 4BV1A 1AGFB 1CIDA 4H2CA 1EFQA 4OD2B 4YAQB 1TPXB 4ZFGL 5GJSL 4EE2A 4HF5H 3C09B 1KNOB 4JFQB 4FLSA 4UT9H 4X5WB 4PJ6A 5JDJA 4KK9C 5F0LB 2Y5TB 4JKLA 4OY9A 4GS7B 3EDDA 4P8QA 3ILPB 5J57B 3UL4A 1MWAH 1OCRB 1UEYA 5FM8A 4E9SA 4KKBC 1JS4A 4Y2DD 1CMOA 2ATPB 3QHFH 4PJHF 4K3DL 1OM3L 4XRCA 1LP9E 4WI9A 3DIVA 5I74B 4P5MA 3QUZD 2VC2L 1TG8A 5DJ0A 1H6UA 3F2LA 1MVUB 2UUDH 4NYLA 4CSTA 5HDOA 3BDYL 3IFOA 4H4NA 5FHBH 4Z7OE 1DBJL 1JDCA 2O30A 4XMKH 1BXUA 4OCSL 4KHTL 3HRPA 2DB8A 4W9IC 2YGOA 4MZ2A 1YEKH 1QMUA 4ADGA 1Q0XL 5JXEC 5CEYA 3QA3A 1QFWH 3D4ZA 3NJJA 4G3YL 1MJ8L 6TAAA 1FZMB 3QPXL 4Y4KA 2G5BA 5CGTA 3GKZA 1JXDA 1MAKA 3NSXA 5ICZA 2IAND 4XMVA 5G4MA 2A6IA 3WEAA 4WHCA 4F2FA 1UFUA 1KMGA 1B9ZA 1FNEA 3DX4A 3CFCL 4Z7VB 3U2SB 5I15H 1JZEA 3NMEA 4RZCA 4AT6A 4ATTA 1HYSD 4NM8H 3WKYA 1B88A 3DSFL 1AQDA 1SVBA 4K94C 2BMKA 3LZFL 4GKLA 3PWPA 3TJHC 4RBPH 1BZ9B 5AWNL 1KBKA 1FFTB 4LHJB 4AV0A 1AD9A 1Z9SA 1CYXA 4MGXA 2ZQKA 4J3XA 2WVSA 1XSOA 1FP5A 5KS9E 2N7AA 4IM8A 32C2B 1T0MA 4LP8A 4WI2A 4LCWD 5GSVB 1AYRA 3IXTA 1U95A 2GYSA 4LSVH 4O58L 4Y4HC 4JKNA 3BXNB 4R4FH 3BN3B 1FVEB 2FH8A 1B6DA 4EQ2A 3EYOA 3N91A 1IAII 3FAWA 1VACA 4FL4C 3QC5X 1N3NB 2HA1A 4WEEA 5K39A 2BVYA 3FT1A 4HCRH 5JOFA 1KIPA 2VLJD 2IPUG 4CKQA 1KJ2A 4QTHB 3LMJL 1DVYA 3HUJB 3ISWA 2WIMA 3MRMB 2W9EH 3K6IA 4LCVA 1T7XA 1GGBH 1UZ8B 3GMRB 4PJAA 1TUPA 4MSWB 4NKIH 4HEME 2WXGA 2LT9A 4H7VA 3NIGE 1CGTA 4UZGA 1QHQA 1ZE3C 3HI1A 2FT6A 4ZJ9A 1EXHA 3P0VH 5EZLA 2EIMB 2W8CA 5IHUL 3JWOC 4JMNA 1HOEA 1CF8L 5F70A 2GITB 1IEBB 2NOYA 4GO8A 4HS3A 3D18A 2Y06L 2FX8L 1FL6B 3E3QC 4U0RC 5BRPA 3FQUB 3DJ9A 1G6RB 6FABL 5HI5C 2D9QB 4OD3H 1G7PA 4JN2B 1XD0A 5T3XH 3DUUB 5GS1C 4MASA 1C5CL 3O3BB 3QRFM 1JHTB 2QSVA 3KJ4C 3U36A 2R2EB 5DRXA 3ARED 3OV6A 4RGND 3BPNC 3QUZA 5I1LB 4RIRB 5SWZE 1I1CA 1TVDA 4X7TB 1NBZB 3PP3K 1XT5A 4P2RB 5B3JF 3KJ6L 5K93A 4WEUD 2Y72A 2B5IC 1F13A 2YA2A 4NBYB 1WS8A 3T0WA 3GNMH 2ZCLL 4YC2C 2A9NH 1EZVY 3ES6A 4ODXB 3WIFB 2P52A 4IYKA 1AD0A 1HU8A 3SDDB 1G9EA 4MS8C 5DO2D 5FGCE 1GTFA 4MZIA 3NCJH 1TMCB 4G5ZH 3L3GA 4J23A 2VDNB 1RUKL 4NQSB 4Q7DA 2FEDC 1YY9C 4HGWA 3ZTNL 1QYGH 2P47B 1KLGB 5E6SB 4ACPA 4DTGL 3VGHA 3V4UL 4KVPA 1O7SA 2NZ9C 1S7TA 2P43B 5E70A 2BJML 5GZND 3TCTA 5JIDA 3PWNA 1JWSA 1C08A 4JREB 4W4NA 3D69B 4G7VL 5AVZB 4JRFA 1W2KT 4FNUA 3GS0A 2IPTL 3BRGC 4YPGA 4XO8A 2ZIDA 3HE6B 4ONFL 3QS2A 1U8MA 4U1NA 4IU2A 2VW4A 43CAA 1DQQA 1YSOA 1IIIA 2WBXA 4JHAL 1S7WA 1XAKA 4BHUA 1SEBA 4X7FC 5D72L 2J20A 1ETZA 1P4BH 2WP3O 1NCAH 1CE6B 4MKTA 5TD4A 3GJFB 5JXEA 5DHVH 1FH2A 4GNKB 2FCBA 3AG2B 1YY9D 1URLA 4PCSA 4L9LC 3DX6A 2P45B 1AGCA 2Z31D 1EEYA 1NLDL 1U8OB 4XWOC 1GIGL 1CT8A 3GZQA 3WL9A 4UAOC 3H9YA 4A2LA 3RB7A 3VGBA 2NY2C 1RMFL 3SYOA 2CSPA 3PDOA 1QFWM 2H1XA 4PWEA 2XRAH 3ET9F 2VOTA 4JJ5B 1D3CA 5D5MB 5BMFH 5I71C 2VLJA 2NNCA 5B1BB 4GLRH 4GQPH 2YEZA 1OE1A 4MNHB 4TRPL 2DYPD 1BBJA 3FW6A 2FO4B 2EVJA 1EHAA 3PAZA 5DYFA 2WXHA 4GP5B 2JKWA 4NQVA 2VDQB 1N9PA 5DZ9A 4DIXA 1H6FA 2CJTA 1EDHA 1YY8B 5C3TA 3I6KA 3GSUA 3LCYA 3DYOA 4JQIA 3TT3L 4PV9A 4XWOD 3GHEH 4WJ5A 2KYIA 1KGUA 2NSXA 3SY0B 5FO7A 1NDMA 2UWEB 2XG4B 3TOPA 1HINH 4HC1L 1YNLH 3DOHA 4Q56A 1E2WA 2IANE 1Y0LA 5F97E 1MIML 2ICEA 4ZFFB 3ZDYE 2O6PA 3RWIB 1GY2A 1U91B 5FK9B 5ISZA 3D4YA 1WICA 3MGOB 4EZMA 4EVNB 5C0BD 1IFRA 3HVDA 3N85L 5A2LH 3MRHA 4Q6YA 5I82A 4JDTL 4EDXA 3FO9B 4QF1B 1AY1L 4JO1H 3QDHA 4BCXA 5CHNA 1CL7H 3AREA 4C4KT 3W38A 4RMRA 3WGVB 2MCG1 3TEZA 4AYSA 3PQYD 3HLAB 3KGSA 1RZGA 4GPVA 4Z7VF 5E95B 1F8TL 2F7RA 4JO3H 2HXAA 5FV2A 4ODUA 3KWTA 3ZXAC 2QVMA 2MCPL 5IESL 3H7BA 2WGXA 3HS0C 3QSKB 4NX0A 5E0FA 4PCTA 4LCWE 4B53A 3ULVH 4NEHB 3QDMB 2ZX9A 2H2PD 1DZBA 4N2BA 1WPCA 1MOEA 4P9MH 5CP7B 5DVNA 5EORH 1NCIA 4BM7A 3OXRB 3UFIA 2BP8A 1KFAH 3QFJB 1AMXA 3BVXA 4YSSA 4PWHA 2EYRB 2O5YL 3QEGH 4HETA 4MCYB 2AJXL 3QFGA 1NC2D 2PCYA 3BIKB 2AFNA 4DNLA 1RUPH 1DDHA 3PDDA 5GS1A 3VFPA 4OF3A 4G8GD 5GZNA 3HB3D 2X6AA 4WW2A 2MCMA 5I5RA 5L4FA 7TAAA 2O93L 5KSBA 4QAMB 4I2XB 4XC3H 3T71A 3UEQA 4JO5A 2XDHA 1BFVH 2J88L 2APXA 4LNRA 3OAYK 2C9SA 3QYCA 5CJOL 3GXDA 1MUJA 1N8OE 5EO0B 3O6LH 2WZ6A 4QMEA 3TIDA 1T21B 2ADJA 4NAJA 5I0XA 4U1KA 5J13C 4X6DE 4LSPL 3B3BA 3C60D 3HUJF 3QCVL 4LVNC 3TEYA 2Q76B 1BQLL 4GKOA 4K5MA 1VHPA 1OT2A 4X7EC 1FN4B 1R24A 3I9IA 3LXBA 3D5OF 2CR3A 3HZ3A 4J3WA 3RHWK 5L9DL 3RB5A 3G04A 3RVUC 5CZKA 5H2BA 1GKOA 3P1VA 5B7FA 2Z91A 2X42A 4TL5A 1F6LL 2B59B 2AP2A 1QVOA 2P26A 3MFFB 5TDNB 2JJSC 3QP3A 5FOBB 1NCTA 2FWSA 3O2WH 3UGUA 4PCYA 4RGNE 5HGBA 5FDWB 1OAYL 1QTYT 2IWKA 2Y1YA 5F3HA 4E9RA 4TPRH 3BT2L 3GGWA 3MJ7B 3BO8A 5EOQL 3EJSA 5JHBA 1HDMA 4U6XB 2H1PH 1YN6B 2DYPA 1HVXA 3MLWH 3DROB 1EBAA 2JB6B 3HCVB 2BS8A 1H3VA 1MN4A 1NJ9B 2Q8AH 2WPGA 3EH1A 3L3IB 3IU4L 5GGUB 2YMTA 1S9KC 5EBWB 2GTWA 5EBGA 2HN7A 2PXYB 1MJJB 3QCTH 1FL3A 3RVUD 4R4NC 2GQHA 3ECUA 5I0DA 3HS8A 5EV7A 1IZJA 4YX2L 3RWJB 5IMOA 1Y18A 3TVMC 1NGXA 1QFWI 2WZAA 4LBEB 1NGPL 3BJLA 3CDZB 3WNLA 5ILTH 4NKQB 1F18A 3BDBA 3K8KA 4Z0BL 5IZ7A 1JTPA 5DQJA 5E1IA 1A3RL 5EF0A 4YFLF 1DVFC 5KSBE 3X11A 5I6OA 2NXYC 4XP5L 3DK2A 1L9QA 1HL5A 1MRDL 4ZS7L 5C0BA 3T5WA 2YWYA 4Y16B 5BV7H 1TCRB 1PD1A 3U4EA 4FG4A 4JY5L 4EDWL 3DO3A 1OAQH 2IXQA 5KW9H 3GTTA 5A2BA 1XR8A 3QNXA 3WUWG 4F8PA 3FU9A 1TCMA 5ECJE 4ZUTA 2AKRA 2O5XH 3FCSA 1M9WA 5BOJA 4RFOL 3SE9H 3AZUA 4J6RL 1W9XA 3Q06A 3PQYA 4J3OC 4TVPL 3QUYC 5HGAB 4J2XA 4GT7A 4AZ8B 2HJKB 3DRTB 2ZYHA 1F4XL 2FECI 3AY4C 4NLAA 2EXTA 3V0EA 5IB4A 1H3UA 2KZKA 3BPLB 4HKXA 3D51A 5J11C 2NX5B 1W72A 2C7UB 3C08H 4PRNA 5CZXD 2ITCA 4JHUA 1OB1A 4YK4B 4BZ2H 1AI1L 1KDIA 4H1LB 3IFPB 4KV5E 3SDXA 3JV5A 3OKKA 5BPPA 3RJDA 3IJSB 1NC2A 4QHUB 1S7RA 1Q9WB 4L8DA 2Z7WA 1RP8A 2QR0A 4YBLC 4HFWA 1D6VL 4G8GA 1EO8L 4HGKC 4WHTA 4R4BA 3AW5A 4HZLA 4M48H 1DSFH 1FHGA 3IJHB 3WAKA 5IWLC 5KTEL 1OSYA 2OQJA 2DPKA 4OFQA 1N18A 2W88A 3F7LA 4KWUA 2GHWB 3HS0A 1QI5A 4MMYA 1JPFB 5D5MF 1DLHA 2Z7ZA 1G0DA 3VU2A 4ATWA 4F7EB 1BREA 3S4SB 2D03H 1YEFH 4NZTL 3WAJA 3LQAL 2QPFA 3AJ7A 1SPDA 2A38A 4FXKC 4EIUA 4G1MA 4XP4L 1DZ0A 4U3SB 4GUQA 4ABVA 5HDRA 1TT6A 3MRQA 5AUMB 3AS1A 2IPUK 2RCSL 1AZCA 4LU5H 4MWFB 3V0GA 3UYPA 1OV8A 2YA1A 3O6FD 4R83A 4U7KA 2QSCL 3A21A 1KUMA 3PL6C 4F8LA 1KIQB 5C0BE 3SKUD 5JOEA 1GCFA 3H7LA 1E6JL 3PHQA 4NZUH 3FCUB 2AJVL 2I07A 2ZOKB 2UWEF 3V5DB 2WNKA 2MQGA 3ULSB 1DBKL 5ITBH 4O2CB 4EI0A 1AH1A 1A0QH 4OUUA 2X4TB 2XFXB 3T77A 4YDIL 2ZD0A 5C09D 3R19A 4KDTC 1I1AB 4AH2A 1DBBH 1BLIA 3CFQA 3I85A 4KKCC 4LFHD 5F0MB 1DBMH 3UC0H 1J8HD 4AQOA 1AGDA 2WNXA 3CHXA 3F65A 4PW3A 4I77L 3UGXA 4QO1B 1KELL 3V79C 3SKJH 4PBVC 3O4OB 5KVGE 3MMEB 2HRPL 1D5XA 5IFAL 2YGPA 3CZUB 4HLEA 1XZWA 3LKNA 2EO7A 3BGFB 3ZO0A 4MJIE 4U1GB 2CKNA 3B8YA 2JI1A 1D7BA 4P49A 2DZEA 4M1DL 4CSSA 1PFOA 3UZVB 5I24A 1U3NA 2CDFA 1G7IB 3LN4A 3VFOA 2Q7AA 1D7FA 1FC1A 3V6OA 1BOYA 4B9CA 5I1HH 5I1GH 3HHMA 4PRPB 1QSEA 4OKVB 3HJ0A 3RI5K 5D55A 3MLUH 3THML 3S37L 1V8HA 1T6BX 4BRVA 1OANA 4X80H 5GRJH 1AZUA 5CZVL 4JM2D 3I74A 1N7MH 5EOCJ 4UMGA 3LDBB 4WLCA 4IMLA 3AXLA 3OSVA 3CBKB 1PIGA 1FFPA 5D70L 1JE6A 4PLJD 3ZPDA 3W2DL 2P24A 2OMXA 5FB8A 2Q2LA 5D7LB 1QZ1A 1SHSA 1E8ZA 4JANA 1T2QL 3U46A 3L48A 4HCGA 2GK0A 5ICUA 1A65A 1DVFA 4ZUSA 4I3RL 1OZUA 3HG5A 4FZEH 3T0DA 1YYLH 4PP2B 4PRIB 2H8PB 5DMIH 3SODB 1SLWA 4WQOA 5TF0A 4NQED 3GHBL 1ZTXL 2DV6A 2A77H 3QUXD 4QUOA 4XNYL 3L2NA 1K4DA 3JT0A 2XY1A 3TBVB 1A1NB 3E6HB 2J6EH 4OUOA 5KJ7E 4GEJA 2NY1C 4GLRI 2YD9A 3WFEH 1LO2H 1BM3L 2DWTA 2XBTA 4EI5B 2R23B 4CW1A 5K9QI 4W93A 2OLDA 4ZTPH 1PJ9A 5C8JB 1DN0B 4WTXA 2CO1A 4DT2A 3DNKA 4LLVA 3FHEA 3O81A 1D2PA 4KTDH 3VXUB 5AD0B 5F6HJ 1HS6A 2CPUA 2OJEB 2VDRL 4FHKA 3GSVA 3HC4H 5JIMA 4U1LA 3V9FA 4UT7L 5EWIH 1MCLA 2OXGB 4PV1C 1AJ7L 3QQDA 3Q6GH 1A7OH 3SQBB 1PSKL 4GXFA 2K1MA 4LESA 3F6LA 3BAXA 4ZO6A 4YQXH 3DHJA 3FUMA 2YN5A 1IJNA 4UILL 1BIIB 1PLGL 2VO5A 3O6FA 3V6OE 1BQHB 1FAKT 4KTEH 4ZUVB 3ZJAA 4N6RB 1IGJA 3IJYA 2HPOA 5J12C 1OEZW 2QQQA 4FFZL 1ADQA 4JFFD 4TMPA 4AGNA 4GXVL 4AK2A 2BFVH 2HFFB 1YQVL 4YS4A 1KCSL 4JY4B 3GJFH 3CPUA 1U30A 1CL7I 3MRLA 4JEGB 5GRVK 3UJJL 3TBBA 4A55A 2QADC 1UB6B 3O8XB 2WIIB 1BQKA 1WAAF 3KLQA 5C09A 3EDKA 1G1YA 4LRIC 3N42B 4N2OA 4OLZL 3RYMA 5JXAH 2W81C 2G9HB 2NW3B 4FXKA 1CLZH 3KD4A 1J8HA 5CU5A 4ETYA 4H0LC 3N1PC 5EBMA 2F53B 4HK3J 4A7SA 1KJ3L 3HG2A 5K9OB 1CLOL 2AXFB 4R3SA 3HC0A 3QJSB 2NY0C 2OCJA 4NQDB 4I18A 5E8OB 5SWQA 4L1HA 4ZMLA 2CRIA 2EVGA 5E5MB 2ZICA 5E0QA 1I3RB 3EJYC 4A7QA 1QACA 3QT2A 5TDNA 5AYUL 4JZNA 5HVHB 1XMEB 4PB9L 3T8XB 2BK8A 3H9ZA 3MTXA 4HV8B 4W6WB 4G1EA 2MTPA 3KPLB 3LEXB 4W9FC 4CSPA 4MDIB 3VH8G 1QKZH 2Z92B 3L5IA 2CO2A 3Q7JA 1HH9B 4TOYL 1IBZA 1H8SA 4XNMB 3HG1D 3EH3B 1KT2B 4HWEL 1AGEB 4AQ1C 4XVUC 4IU3A 3HZMA 4MFHA 1D7CA 4NC2B 3NPZB 3SBRA 4NWUH 2Z4QB 4N9GA 5AZ2L 3KYNA 4FJYA 5EUKB 1NCDH 5GZOC 1MXDA 4ZRGA 4R97C 1JDDA 5T5NF 3RGVB 4ONGL 5B1KA 4R0LB 4JKPL 4Z7NB 2IV8A 3L3OB 4KNUA 4UDUA 2WXKA 5JPNA 3HZKB 3RTQB 2DJSA 1GMEA 2LFEA 3GBML 4LOVA 4HT1H 1WFTA 2VTFA 4ZTOL 1A6TA 3L5XL 2XJKA 4N0UA 5LHDA 3PXJA 4GW4A 4N5ED 1KYOJ 2DQJL 5C09E 6CGTA 2CLZB 5CD3A 1NC4D 1TZIA 1XAUA 2IH3B 3RAJL 3O41A 1BG9A 3OKLA 4TNEA 5DQ9B 4ZMAT 2GG1A 1EQWA 2ZP9A 4K3DH 4JUTA 1OM3H 3ZU8A 4FAAB 3CFIC 1DSWA 3LIZL 5DURB 3MLTA 4GRLC 4L3CB 3US9A 1X5JA 2VC2H 4L9DA 5T1MA 2DQEH 1G9NC 2VABB 2AXGA 4FDWA 4UCFA 2DJ4A 1YZZA 3IGUA 4LLMB 4BFNA 5B1JC 1CK0L 4X0NA 3SO5A 4QRRD 2L4OA 1T20B 3BFQG 4XHJD 3MJ9A 5GGSA 3PWVA 5IEHB 5F7WC 3LOWA 4TF4A 2FO8A 4H20L 3CVHA 4NC0B 1EJ6A 5SX5H 2FYYB 3BWUF 3GSRB 3BWSA 3IS1X 2IWFA 1MCKA 2A4CA 4JFFA 4KRPD 2OW6A 3WFBL 3QPXH 5JZ7D 4PGZA 4JPVL 1J5IA 4FKKA 1JZ5A 5LDSA 2IAMC 2R56L 1Z5HA 5JIPA 4X5XB 3KWWA 3OHXC 4ZS6D 1BZDA 2ICWB 5FFGA 3WXVL 4Y4FC 4QLRA 3HZYA 4H88L 3GPSA 2I9TB 1LWRA 2W38A 1PKQB 3D8MA 3ARGB 2C3VA 5MENB 1HSAA 1ZT4A 4MA1C 4M93C 4NUGL 1A8JH 1CYWA 4F7MA 3LZFH 1YEEH 1R3LB 3VG0L 4ODHL 2O6CA 4GRMA 3GXFA 1NANH 2A0LC 3PJLA 1VFAB 3E2HB 4HPOH 4FQLL 2B9AA 4NQEE 1T1XA 4PJEA 3CSPA 2OTWB 2L7UA 1MIEL 5I8CB 3QPQC 3GM8A 4ETQA 1JJUA 1TTRA 4MBOA 3GI9L 5I6XB 4JG0H 4M29A 5DGRA 1EXUB 4N8UA 3D3VD 4ZI8A 4NI3A 4FQPA 5FFLA 1RUQH 3MV7D 3MVSA 1JK8A 3RILA 4X4MA 1YNTA 3K6SB 3DGGB 4L4VE 5DMGC 3RVTC 1D9KB 5KYUB 3HG1A 4RQQA 4BA0A 4BFRA 2W5PA 3GXPA 3K7UA 4AI7A 1FIGL 4DAGL 2QVFB 3BD5A 3OKDB 2Y25A 3I6GA 3UJTH 4BFOA 2WSPA 3HC3L 3BFWA 4FI7A 5C9JA 1GJWA 2GJRA 2A4ZA 3FB7B 3F8UB 1T6VN 3FT3A 4YXLH 1TU2B 2F6AA 4XP1L 2F58L 3G7TA 2YPKA 4ZAKB 3RTLA 4KK5C 4G6FB 4PJ5E 5I1JL 1MFEH 5E08L 2KPWA 1R34A 3WTTA 3C5JB 3JUZA 2EE9A 4R5TA 1Z9PA 3VGGA 3ARTA 3TV3H 1XZ0B 3WJLC 3AC0A 2BP0B 2Y06H 5BUGA 4HHAB 5DMGD 3RVTD 3QEUA 4O9HH 4LPXA 2X9WA 3P77A 4N2KA 4UV4L 5IQLA 1B90A 1LE5A 4WV1B 1A7NH 4XWGH 4AQ1A 2Q2EB 1FSKC 3FN3A 2XSKA 1ZV2A 1L7IL 4NO5B 4I48B 4JY6A 5EIVA 4XN7A 2J3SA 2FVNA 5EPMA 2FATH 4ZPTA 5GZOA 2DMKA 2VLKD 2Y36H 3QUMA 4U3HA 3CDCA 4H1LH 2B39A 4O4YL 5AVQB 2DRUA 4MNQB 3VI4B 3UPRB 4FF9A 1TKWB 3DIDA 2AEQL 4RA3A 1SY6A 3N42F 4L8SA 1KWKA 3QEQD 2IQ9H 4A6YL 1TJIL 1V27A 4PJEE 3ERXA 2VRKA 5IVXB 4QRBA 3FFCE 5C0IA 1RJYB 3CDFA 4Y89A 4CU7A 4QKTA 4LPWA 2D9CA 4C56D 2HZHA 4QRRA 4JG1H 4AC2A 1BX2B 3TASA 3AFLA 1H3WM 3BISA 4ZXBB 3S5LA 4N2HA 1SEQH 3KXFB 3D07A 4MXVF 1C12A 2WKLA 1RUKH 4A67A 3ROLB 3ZTNH 4P4KC 4ZPVB 4TUOB 1PZUB 4UIMB 3PABB 3PFUA 3V4UH 3DUHA 1UB5B 3EOBA 2FEEI 1NGZB 3FH5A 1QZNA 4Z95L 5DHDA 3U6XS 3RKDC 1KGIA 5E8DL 1F86A 5KJRL 1CN4A 3D2UB 3A4FA 2EP6A 1CXLA 4HX1B 4YZWA 5CS7A 2VDKL 5KYWB 4JNXA 1ECYA 2YR3A 3MRJA 3JBG7 4ZFOL 4ONFH 4XAWH 2APBA 1UQSA 2AXHA 3IAGC 4ZUWA 3PV6A 5B1JA 1NAMB 1BW8A 4NQQA 2XETA 3FL7A 1KXQE 3HAEA 4K5NA 2CHWA 2YS4A 2VGLM 1OZTG 4X8JB 2YAMA 1WTLA 5CWSB 1XH2A 4FA7B 1FDLL 4GSUA 2SEBB 4S1SL 2APVA 4P4KD 4ES8A 1MHPL 1ZSHA 1KTJA 2DI8A 2VZ3A 4JJOA 4RMSA 5F6IC 1SFHA 5T1KB 4Z7NF 5I18L 4QOKA 2WZPA 4BFKA 5ECGA 3VGEA 3D3VA 3MV7A 4Y4FA 1NOLA 4YFLI 5DK2A 4YN3A 4X7SL 2HKHL 1J7VR 2DWDA 4NDMB 2A1WL 2YBGA 4OF5A 5D96C 5EZPA 5TGBA 4UZSA 2Z7UA 4G7YH 5I8OH 4U1JB 1RV6X 1IGCH 3K2UH 3QJUB 3AGVA 1UUSA 5ETUA 4BGDA 3TA3B 4BUGA 4PPTA 3KLLA 1NMCC 4TRPH 4HG4K 3NIDB 3BKYL 4QXTA 5DJCA 5C07B 1KPUA 5HI4C 4QRRE 1X5FA 5FF6B 2VW6A 2EXYC 2RALA 5IF0B 5JOPD 5F9JB 3EJTA 4NRZB 3UX9B 2UY7A 1IM9D 2CKBB 5DVLA 1J48A 2VWEE 3LS4H 2YO3A 2QVKA 3ABGA 4GUOA 4FC3E 2DH2A 3LQZA 1L9MA 5JHDD 3VFWA 4RMTA 2MQCA 2A2QT 3LYRA 2W9DH 1GSMA 3D09A 2OMZB 4MQXC 1Z5LB 1BQ5A 5LBVA 1M56B 2G60L 4KZ0A 3ARFB 1OAUH 4GSRA 4OZ4B 2AK4B 1E9OA 5D93C 2Y24A 1R5WA 3SE3A 2NY6B 3KBEA 4YHOL 3BVNB 1ZGLB 2F15A 4ZMZA 2FJSA 5KUMA 1X5YA 2VLKA 4KDWA 1I7UB 4O2EA 1XF4B 3QI9B 5JW5A 3J8F7 4XN1A 3WE6B 4F8OA 4YXKH 3QEQA 2J5LC 4JRXB 4M7ZC 4NUJB 1U8PA 1IEAB 3MLZL 3N5AA 3OPZH 4C56A 4FTVA 3WJLA 1CWVA 4U6TA 4MQXD 3EHBB 3B2UD 3EFOA 3EOAB 1EWHA 5ACZB 1BLNA 3KGRA 2PCPA 4MYWB 4U4BA 1VSCA 4P07A 5E51A 1IIKA 1KXTA 2MIZA 4KU1A 2BVOB 2OYPA 4BZ1H 4WK4B 5CFHA 4HIQA 4XMZA 4HZ1A 2AJXH 4NPKA 4TSBL 4IRZA 2IF7A 4LF3A 4CMHC 2X28A 4F7PA 1A2YB 4A63A 3I2CH 5DJXB 5FKPB 2WKOA 1ZANL 2A74B 3UPCA 5LGKA 5LBSA 5BJTA 3PFQA 1DUZB 3SOBH 4B9FA 4LARH 3WFHA 5LXVA 2X5PA 1L5GA 4KI1A 3T0ED 3HE7C 1LK2B 2R0WL 1Z9OA 4G7RB 3UAEA 4TM9A 1P9MC 3O3EB 3WKPA 3BP6B 4E0RA 1I1FB 4LAQL 1A7QH 3L7EA 1OAKL 3Q5YA 1N5YL 5CJOH 1ZLVH 4N0FB 4K8RC 1Z2KA 4IMKA 4L8BB 2X05A 3WFDL 4N68A 1BAFH 1HCFX 3F6IA 4F2EA 1UVQB 4LSPH 3GPEA 4LLWA 3S97C 2X38A 3L4CA 3MJ8A 4IBSA 4P4KA 5C7ZA 4UU9B 2C4XA 1NBCA 4HKJA 4OVVA 1AKJD 5C0RH 4ECNA 3HN3A 3WD5L 2CBOA 3RBGA 4XCEB 1FZJA 3SKNA 4M61A 3UIYA 4U1SB 4NP9A 1Z66A 4PBDA 1MQKH 5CCHE 4ZG1A 4JFPA 2NY5H 4OSUL 1T89A 5E4EB 5CBAA 5EZIL 2C1OA 2N56A 3M86A 1UGNA 3AWFA 2N7SA 3HE7D 2B77A 4OFKA 3CIAA 4MX7B 4NN7B 1OAYH 4HXAH 5FUZH 1P4LA 4TQEL 4GH7B 4OZFA 1G4MA 2IADB 2VIRA 2XWDA 4KKAC 3QEQE 3ARBB 3K1DA 3PGFH 4WI3A 4S2SA 1XTMA 1EJOL 4XBEH 3BYTA 5TH2B 5I1CH 1QBMH 2DQHL 1G7LB 3FN0L 1G9ML 5IUSA 3IU4H 3ALWA 1AXIB 3DC0A 4YNYB 4HUWB 3T1WA 1QTSA 2Z9TA 2K78A 5IJVB 1IM9A 3VI4F 1FO0A 2NUPA 3A67L 4OFDA 3GF8A 4N2GA 4DKDC 5JHDA 4UOJA 3K6NA 3BSHA 3T4AC 4MS6A 3MAWA 4U1IB 2YWZA 5IVXF 4K7PH 1ZHLA 1QEWA 1UWEH 3PHSA 4Z0BH 4S11A 5K9JL 1TQWA 4G8EA 1G7QA 5CGBA 4A04A 1I8LC 2WLIA 3DX7A 2UVFA 4XP5H 2ENSA 3RUGB 3K6DA 5LDUA 4WFHE 1MRDH 1UYWH 1FFOB 4ZS7H 5KBMA 1LQBC 3NRQA 1U8IA 4F3FA 1BP3B 4JO2L 3D30A 3CE1A 4P3DB 5LAXB 3MRPB 4KH2A 4LPCA 1OTUD 4CVZA 4Z7OF 4RFOH 3QR1A 4MNGE 4UNIA 3IGLA 4J6RH 1FFNA 1NANI 2UZPA 4OZIA 4HAGA 3FU0A 1X7SA 3RHWF 2C8NA 2Z1PA 1ZKAA 3DV4A 5DS8B 4HKZA 4GBXD 1F3DJ 2YAOA 4P9HC 3WLBA 4M3HA 1VGEL 2WBJB 2LV4A 4KGJA 1P7HL 5FA3B 5SWSE 1E8XA 1AI1H 3EJPA 4BE6A 3BPCB 2VJXA 4D9RD 4P23D 2CUIA 5JQ6H 3FH7A 2R4RH 2V8MA 2BOBA 3Q8BA 5KYYB 1Q1JL 2M8XA 4OJCA 5FYKH 4KKLC 1ZJAA 2EICA 3VXSB 1FGNL 1UOVA 1EO8H 3C8KB 3Q3GB 4OF8A 2YPLA 1AC6A 5KVDH 3T3PE 4KK8C 3U4BH 4E9TA 3ZE0F 5F2FA 1J1OL 5CEZH 2CLRA 2D3NA 2EACA 2VZOA 4Z7UA 1FE8H 3EDFA 2VQ4A 2PMZA 4AEHH 4NZTH 5JHDE 2EE3A 3LQAH 2P7TA 4ODVL 5F9OH 4ZNEA 3ZZLA 4DH2A 3NIDF 2HVJB 3FJTA 5IT2L 1HQRB 5AKVA 4PJCE 2GEQA 4NSKA 3LNFA 2EC9U 2W80C 4M5TA 1AKJA 2BSSB 4H8WL 4PY8I 4A39A 4KX7A 2PTTB 1QABA 3WO4B 3NFPB 3R4RA 4LRNL 4UZUA 5MERB 5T3XE 1CZ8L 4R96B 3V0DA 3TBTB 2QTEA 3REWB 4LKCB 3F12B 3HE7A 3F83A 1SYSB 1UKQA 4GKNA 1T7YA 2AZAA 1S46A 2YZ1A 4YDIH 1TTBA 2R69H 1YNKL 4BSVA 3MHZA 3HFML 4OZIE 2FR4B 4LSSL 4M8QA 5TDOA 2BDNL 2Y7QA 3SYQA 4Z77B 4HU8A 2CWRA 2N4IA 1RZ7L 1EMTL 4MB5A 4PHZA 1EAPA 1IE5A 4Q97A 2IPKB 1KELH 4P0DA 2HRPH 3IJEB 4QEGA 5IFAH 3NACH 2J1XA 1SN0A 3WYRA 4PVNA 5DMJB 3SPGA 1MFCH 4HS6B 1OO2A 5TQ2H 4PBXA 2UZXA 3JTSA 1AS6A 3VXTB 2AK1L 2E9GA 3H42L 4M1DH 4QI3A 3DX9A 3DXAB 3WBDA 2HJLA 1JZ3A 4AGMA 2RACA 3JYBA 3T0EE 2DYSB 1K9TA 4GKSB 3U4KA 1KG0A 3IFNH 2ZG3A 4ZT1A 5BS0A 2OP4H 1JF6A 3BUQA 4PJHE 2GAZB 3THMH 3LAFA 1P4IH 3SDCC 5LXGH 1AHKA 4ZNEE 4ALAH 4XBGB 3F7KA 3FU6A 4YL4A 3V7MA 4NWTL 3VG9B 5EOTB 2HTKD 3VXPA 1I53A 3WHE1 4AENA 3QAQA 2WK2A 3BKMH 4N0YL 1I7ZB 1MFUA 5HHQA 3QARA 4OIIH 1ZRUA 3L1GA 3BE1L 4J3VA 2DBLL 1F4YL 5DUBB 1KJMB 4GBXA 1T2QH 5F96L 2O6EA 5J06A 3QZOA 4LVOB 4I3RH 3FQRA 1I8LA 4ODTL 3QCUH 3MV9A 4NKMA 2GABA 1YN7A 4Z3GA 4FS0A 3BUYA 4RGMC 3FT2A 3Q2VA 2XX1A 1H6EA 3GHBH 4N5UA 1U8KB 1ZTXH 4XNYH 1ZAGA 3MNZB 2COVD 3LEYH 4LHUG 4PJDA 2Q3ZA 3GSXA 5DWUH 1CGSL 3OAZK 1JK9A 2PWFA 5JYLA 1B0RA 2YPVA 5T33H 4JM4L 4U2YA 3DI3B 1U6AH 3L9BA 4M7JH 5E6IB 3CLWA 1FH5L 3CZGA 2DLFL 3NCBB 1TVBA 4LB8A 4H44C 4KXAA 4N2CA 4E41E 2VDOB 2BSED 5C0FA 1EAOA 2HVKA 1VPOH 2LVCA 4DP9X 3LV3A 2J55A 3GDBA 3QC6X 2BNUB 1ZSDB 1F3JA 2VDRH 1GOFA 5GIRA 5TE6H 1DVSA 2RH0A 3B37A 4PRHE 4WTZG 2XWEA 1AJ7H 1XWVA 2H9GA 4P5SA 2X4UA 4U6HB 4JB9L 1PSKH 1GZPA 2B2XL 4K7FB 3S2CA 2D31B 2ED6A 2VW7A 3LEVL 2R0KL 4R9HA 4UILH 3X3FH 1PLGH 3VTMA 5JHLL 3K72A 3MO1A 2XWJB 4LGPB 5ESAA 2X12A 3PWUA 4QYOA 1NAMH 4BFIA 5JW4M 4BZYA 3LNEA 4WNSA 2EINB 3O6KL 4FFZH 3RI5F 1RIUH 3QJHA 3QS3A 4HIHA 4UT6L 2JLPA 5ITFB 1A4AA 2XV3A 5F7HA 3A0OA 5ALCL 3VXOB 1FPTH 3HKFA 4H8PA 2A9ML 3NSCA 3VXNA 5D9SB 3QJXA 4YIQA 4WWKB 4XCFL 3WUWB 3RUGF 2A83A 3D4GA 5GGVY 1KGWA 4J7RA 2M26A 4RWYL 3CFDB 2CGRL 4IGBB 3KLDA 2VAJA 3CH1A 4OJFL 3ULVE 1T2XA 3SZKC 2NUTA 1S7UA 1JRHH 2E7LC 3OWEA 2Q86A 1YC7A 4D0BA 4EZJA 5H37G 1WZ1H 2A7BA 4GOSA 4F80A 1S5HB 3VWKB 1A64A 4IBQA 4PGCB 3LKSB 3SPCA 3BQUB 4Q9RL 5JW4R 3EYFA 5KSUA 2C9UA 4PB9H 2YKLL 4UQAA 5EU5A 1JYWA 1HQ4A 3VA6A 4UTAH 4M1CC 4KZCA 4WU5B 2ZWSA 4LGSB 4QRUA 1GZQB 1WA2X 3W0WD 3BUTA 4AIEA 2C9XA 3VE0A 1DVZA 2CKBH 4TOYH 5G55A 1CFVL 1PG7L 3ZO9A 2AS5M 4MDRA 2R2BB 2X4NA 3G9VA 3HNVL 1E7VA 4M8RA 1IQWH 4H26A 2DM7A 5FXCH 2DWEA 5HHNB 3S8WA 4K71B 1IILE 4HWEH 2GUYA 1GAFL 4G11A 4FRWA 2K6ZA 3IDMA 3VFGL 5JPMC 3BGMB 1ZT7B 4LP4A 2VUYA 1JN6A 4POZC 1GGUA 4X5WA 5B3JE 4QHMA 2Y5TA 3T04D 1ZHNB 1SQMA 1Y6NR 3RL1A 3ILPA 1KJ2L 5EU4B 4JKPH 4U6YB 1EO5A 1XGYH 1S9WB 1AG6A 5E1QA 3UJIH 1BG1A 3GBMH 4XPTH 4PGEA 1MCRA 1R3IL 1O9ZA 4P2RD 3L5XH 4ZTOH 3WNMA 1MVUA 3C9NB 3MLXH 4HUVB 4N4YB 4BGLA 2E76C 2OMWB 5GS2H 4MVBD 4PHXA 2AQTA 3LH2L 5B38G 1JGEB 1AC0A 2UXGA 3PHOB 3PV7A 3SDDD 4DZ8A 2OK0L 2D7QA 3E8UL 3H9HB 4M7KL 4FXLA 4UQ3B 3RRQA 5C1MB 1THAA 2NDFA 2BSEA 2WXFA 5L7XL 1OM9A 1DN2A 2ARJB 1R75A 3UBHA 4F5CE 3DARA 1P84K 3V4VB 3UEZA 3VFVA 1FZMA 3NCYP 3GLDA 3ZUNC 3S88H 5EFIB 3NFNB 3FF7A 1EPFA 5HDLA 1NAKL 1M05B 3HR6A 4AQAB 2BVQB 5IJBC 1JXKA 4GXUM 2J25A 4Z7VA 4TNWF 2V17L 3NIFB 1KGYE 3HE6D 4PQXA 1AIZA 2A6KA 1F58L 1OP9A 1OWRM 3OLGA 2EH8L 3A47A 3ESNA 2YRBA 1WWCA 4ZO9A 3UTQB 2IQAB 3FTYA 3QAZB 5F3BA 1IQDB 2E27L 1GGCH 3FO1B 3J7HA 3UTSE 5DD6A 4NHUB 1AS7A 2DD8L 3NJIA 5MEQA 1JXJA 1T0PB 4PU2A 3WXVH 5AVTB 4XPHL 3QQ9C 1OCWL 5HPMA 5I19H 3O2DH 4OZHB 5GSVA 4FFVC 1U3ZA 3B9KB 5HD8C 2VR8A 2WXJA 1VADB 3C8HA 3QDGB 3BXNA 5J9PB 1HEZA 4YDLB 3CWGA 3AAZA 1NLBL 1OF2A 1DQVA 1IC4L 1N3NA 4QTIH 5BUPA 3BP7A 3CG8A 1ECZA 5L2KD 2ZSVB 1MPAL 1EHLL 4BCYA 5EZOH 5IREA 1JZ8A 1KB5B 3B56A 5DJDB 3ESVF 1BEYH 3MRMA 2VITA 5EF1A 3BZ4B 2EUVA 2EIKB 3HJEA 1YO4A 1OP4A 3GMRA 3ROOA 1CI5A 1QEXA 4Y5YC 1E5CA 5I1EL 4PW4A 1W16A 3W0WA 5I0ZA 3ZMNA 5D6DA 5AKSA 4MKMA 3RY4A 3MR9A 4GP4B 5ANMB 1XH3A 3I9AA 1DE4A 2W59A 2R29H 3ZKXB 1DYZA 4NM4H 1SOKA 1K4CB 3BZEB 3H9SA 4G6ML 2TSBA 1C5DB 4DAGH 4OKDA 4JDVA 2VLRB 2HJFA 3RNQB 5F71A 4Y2NA 1FL6A 1I9RH 3UBXI 1INQA 1G6RA 2DH3A 1PTZA 1NBVH 2ICWI 4Z7VE 3N1FC 5FEBA 1WHPA 2XNAA 4TULL 1H3GA 4JN2A 3AT0A 4HJGB 1OK0A 3M7OA 3DUUA 3KEHA 3SB3A 3O3BA 2QQNH 3QG7L 1JHTA 4NKDA 2WXQA 4YHLL 5LB1A 1IE4A 5CJXC 3BKCL 1AHMA 4K3JL 5I1LA 4X4YA 3K8MA 2IBGA 2C3GA 2A6DB 4P57B 4X7TA 1NBZA 3FRPB 2G75A 1P7KB 1TJGL 2IH1B 4JQIL 5IROD 2VR3A 1U8CB 4F1SA 5KYXB 2AABL 2ZCHH 4UV4H 1RZJL 4WGKA 4HYTB 4YHKH 1KWGA 3KBHE 3SDAC 5GRXG 4IJTA 3SDDA 3J27A 3QDMD 4MJ4A 1L7IH 5JPMA 3I9GH 4L3AA 2B20A 1MHCB 5DJ6B 3QFJD 1KLUA 1QQDA 3CHPA 1QNZH 4ZMNA 1AOZA 1OAXL 1BYPA 2FWOA 1OOWA 2LU3A 4N8VB 4F57H 2PYEE 3S3PA 2EAEA 3L3JA 4AITA 4A6YH 1EK3A 3I6LE 2HT2C 4MCMA 3HUJE 3FO2A 2C3XA 3CSFA 4OIFA 5IQOA 1FA4A 4F37F 1HNYA 4RAVA 4A38A 1SN2A 2VB5A 1NICA 2FJHB 4B9KC 1FORL 2V2XB 3HE6A 1RSYA 3KGTA 3WO3B 2FWUA 1TTCA 2PO6C 3GBNH 2BSTB 1IT9L 3GMQB 2O26U 1USZA 2X4QB 1QUPA 3IDGB 3VW3L 2Q7NA 1J0YA 2DQDL 2W60A 2WVVA 3MCG1 4K5PA 3VTTA 4O02L 4XBPA 3ARXA 1WE5A 4XRCB 3S35L 1T83C 2ZG2A 1FLRL 3SGKC 4DN4L 1EEZA 4Z95H 5KJRH 2H5UA 4LDOB 4ZQKA 5E8DH 5KAQG 3ZW3A 1ZIAA 1RUAL 3GRBA 3P9LA 5D8JL 4LLUA 3A6CL 4LCCA 3ZL4L 2VJ8A 3EBAA 1FIEA 2BIOA 2F9BT 3P2BA 4FCAA 2I25N 4NYLB 3WN6A 4ONHA 2Q10A 1MY5A 2YD8A 4DKAA 3TZVC 2FX9H 5BVPH 2E4FA 3Q8FA 4KUZL 1J9TA 1HK6A 1MCBA 4LDCA 5PCYA 2GI0A 2EJ1A 3GTVA 1CGVA 2EH7H 4JJ5A 5D5MA 4FABL 3KNBA 5L2KA 4P2RE 1G5AA 1IFHL 1PQZA 1LQSR 1U8HA 4DQAA 2EDRA 3MCLL 4MNHA 2B16A 3HBZA 1AFVL 5C0AB 4Y4KB 5I18H 3H0TB 4Y0GA 1BF2A 2CQVA 2WUCH 3CN4A 1ZTMA 5IY5B 2LLGA 2K4WA 2EEXA 2D2OA 1X5ZA 2A6IB 2FJUB 4Q58C 2EDXA 2H2SD 3GIZH 4QHKJ 4C8XA 3X1EA 1M2OA 1B2YA 2ZOUA 2PXYD 4X7SH 4JFWA 5FUCC 1RZKH 4RZCB 1KYDA 4L1SA 2EDFA 2R0LL 5T8IA 5IUCA 1AQDB 2UWEA 5EU3B 4WI0B 3AXHA 3PWPB 3LKPB 2BHFA 4CU6A 2ESVB 1KOAA 3P9MB 5K9QG 4IRJC 3BKYH 1AD9B 1Z9SB 3RWIA 2IDSA 2XC8A 5FK9A 4I1RA 3BZ5A 5FDYA 5CZRA 3EJZC 2IGFL 3D25A 4S1RH 4Y16D 4RESB 3PF2A 3MJWA 1XEDA 5J6SA 4Y5YA 3IFLL 3IXTB 1RLWA 1NGQL 3HEIB 3N2JA 2E7BA 3EYOB 4BA8A 3L2MA 2WB1A 1A6AA 3HLAA 5IROA 2XV6B 5EIIG 3D9AH 3NIFF 1HYRC 4QWWC 3V0FA 1KIPB 1E8WA 3BN9D 3FNKA 2YK1H 4EKJA 3ML9A 1OGPA 5EA0L 2VXSH 3GSQB 3KYOA 1LMKA 2HVBA 2AJSL 1I3VA 2WCSA 3QFJA 4PJAB 3OKEA 1JRHI 3B83A 3EJZD 4MCYA 5BQ7A 1KN4L 1BBDL 3KVQA 2JB5L 3D7PA 1QPKA 3BZFA 1CBVL 3QJQB 2VQTA 3RVXD 1QSVA 4OZHF 4B97A 1I8IA 2BS9A 2ZUQC 5IQ9B 2YGVA 3EOTL 3IMTA 1FVDA 5B8CC 4B41A 4HS3B 3S0PA 3TWCL 1F6FB 5D7IB 2VDOH 2VERN 4YUEL 3SDAA 1A6ZA 3OVUB 4JBSA 2Q5BA 1YEIL 1T21A 2VYRE 3CJJA 1W72L 3QNYB 4F15C 2UWEE 1ZANH 3OR7A 4K9EH 4MQSB 3TA4D 3CZSA 4MXQC 5DRXB 2DYRB 5CLYA 3NCEB 1FN4A 2GW5A 2J72A 3QUZB 1JZ6A 3GRWA 1J9SA 3DVGA 1I3UA 3BAEL 2R0WH 1ZVHA 4LAQH 3DWTA 2ZTBA 1OAKH 5I0YA 3JWDC 1N5YH 1A8ZA 2R0ZL 3MV11 3N44B 2B59A 1AD0B 5FOBA 3WFDH 4NXKA 3T65A 1XH1A 2CG9X 4DGIL 5FDWA 5EEWA 2PO6A 3L3GB 3N1MC 4XHQA 2QPSA 1I8AA 1I1AD 3NZHL 2IC2A 3DROA 2JB6A 1JCKA 3H3KA 4MHHG 4O51B 3WD5H 3SGKA 4XMTA 2JJTC 2X87A 3QDME 4FEMA 2QV4A 3MNDA 2PW2A 5GGUA 4JFVA 3U48A 1HJBC 3P0YH 3ARSA 5EBWA 5F1OB 3QFJE 2Q8BH 2PXYA 4K3EL 4LP5A 4YPGB 2MHAA 4U1NB 4IU2B 3EFFA 5T5FH 2FUQA 4UNUA 3TZVA 4Y9CA 3O2VH 4YHZL 4NRYA 1PFCA 1EDQA 1SEBB 1ZXQA 1MCHA 1J86A 3INUL 4ZFZA 1HIMH 1ETZB 3O4LB 4HJSA 4I2XE 3ABLB 1EJOH 4NC1C 1HCVA 3EZJB 4WCYH 2DQHH 3RBSA 3RKPA 2NQDA 1G9MH 1KXVC 1N12A 2EO1A 4JFSA 1ITCA 4PRPD 4Y16A 4JCWA 2X0UA 3BUBA 3A67H 2BC4A 1AGCB 3P4MB 4S0SD 1EEYB 3F05A 2IO5A 2F5BL 1E3FA 3WL9B 4AXWB 3ZHLA 4E9YA 3KS0J 4N86A 2AZUA 3A22A 3B3IB 4OFYD 5E5LA 3PDOB 3LB6D 5EC1B 5HGAA 1IKNA 3FBQA 4DOHB 1E40A 4S1QL 4AZ8A 2ORBL 5L8LB 3TEWA 4BWUA 4OLVL 2OSLA 3V2AR 2WW8A 3BEVB 3TYFB 1UOLA 3FO0L 3WMQA 4ANVA 2J12B 2V7NB 2FB4L 1JSYA 1BBJB 3B7TA 4IRJA 3OMZA 1KBPA 2N0KA 3EXLA 4P05A 1IO4C 4PRID 1KEGH 4PJ8D 1E5ZA 2W07A 1TZHA 4NQVB 1I85C 1DJWA 4QHUA 3AQXA 4M7LH 2D4DA 4TSCH 4WUKL 5GISH 1CYGA 1FYHB 4PV9B 2FDBP 1KCUL 4WJ5B 1KULA 5EUOB 2O5ZL 3FQTB 1PZCA 4JFOB 2HMID 4Y4HB 5FO7B 3UTPD 5FR3A 4EI5D 3G6AB 4UMSA 1Q94A 1Y0LB 4XO4A 4FL4B 4XCCL 4ODWB 3JWNC 4Z3EA 5ISZB 2V9RA 4JHVA 5L2JB 4BBWA 3VXUD 3T6WA 4LPYA 4F7EA 4WSKA 3S4SA 3V4VH 2P8PA 3IJ9A 4PMFA 2V9TA 3VD7A 4AX3A 3MRHB 4EDXB 3L3DB 4Q9QH 2XQYA 4U3SA 1LHZA 4OCYL 1TMQA 5CHNB 3NJXA 5AUMA 2N1KA 3NA9L 3AUWB 4XVTL 4E9VA 5AG8A 4JFDB 1TITA 1P6AB 1M6OB 3BFOA 1ET5A 1GC1C 3N0AA 1WAAE 3DI2B 4NIKB 4KK6C 3DGDA 4AOFA 1RZGB 2B1OA 4WK0B 1EIBA 1TQSA 4JDZA 1DO6A 1CGYA 4ODUB 5ESQB 5FX3A 1ZGLP 4JRYB 4AUYA 3H7BB 2QPDB 5D1QC 4G8IA 4N2DA 4R7NB 3CMOL 3MLRH 1QRNB 3V5DA 3ZMRA 3VAEA 3ULSA 3VD2A 4U0RB 5KBDA 1CLYL 1E2VA 1E2ZA 2X4TA 4FULA 2Y23A 2BERA 1I1AA 5C7XL 2WGNB 4R7DB 3NG5A 1MKFA 5AKRA 4D0DA 1DDHB 2WLLB 4XNUL 5GS1B 4EO5A 4PTUA 3VFPB 2HT3C 4N2IA 3KJ4B 4AMWA 4LRNH 2F53D 2NX5E 2Y9RT 3MDJA 3BPNB 1XDTT 1WEJL 4QO1A 2Y07L 3H2PA 3R1GL 4NQDD 2EUXA 2XKNA 4LNRB 3PLYA 2XI9A 1PAMA 2CNZA 4YC2B 4GSXA 2ZYSA 1T7WA 1MUJB 2DMGA 3WOVA 2D7TH 2EO9A 2YARA 1YNKH 1KB5H 2WQXA 1ADQL 3TIDB 2AEPL 1AS8A 4LSSH 2ADJB 2BDNH 3D0VB 5HVGB 1BPVA 3MROA 1XF3B 4AMKH 4N25A 1ZJBA 2NY3C 1O75A 5LLIC 1SXSA 1AACA 3L9EA 1R24B 1OHZA 5EEVA 4XVSL 1WLHA 4PRPA 4CUCA 3S8GB 3G04B 5DC4B 4OKVA 2HT3D 4DGVL 3OC5A 5CBEB 5H2BB 4HLZG 4PTTB 1CTMA 4C83A 1P7QD 2AK1H 4OFYA 2WV3A 2WVUA 3ULUF 2X70A 4UOZA 4GG6F 5HGBB 5F3HB 2DEWX 2ZAGA 1XIWC 3IKKA 5D7IF 4LQ1A 1Q9LA 3BO8B 4RAUA 5HTSA 5DD1L 1M57B 1PNDA 4GAAA 1HDMB 4POYA 2OI9C 3E1ZA 3RTQD 1ETJA 1RKRA 4Q9CA 3OJDB 2JKJA 3WTUA 4LOFA 3UGEA 1S7XB 4NNPH 1N5AB 4P04A 3L54A 4PJ8A 5F9WC 1DTUA 1UASA 1A9BA 1AZRA 2JJVA 3NVQA 4JFED 3TT1L 2GTWB 4HIXH 2XG5A 3CXHK 4FYQA 1FL3B 1PYWA 5GGQL 3E6HA 2DQCL 5LCVA 5EH1A 3QH3A 4OB5L 3V8CA 4UAOB 3ZDZB 1N4XH 4QKXB 1NGXB 1QASA 2ALWA 3MLYL 5TE7L 3M8OL 1VJSA 3UXFA 2NY2B 4NAQA 1SDDB 3R0NA 4DP8X 1AQHA 3BE1H 1D5BA 3IDXL 4CDGC 4DPRA 2IIJA 3N44F 5DQJB 2CIIA 3MUZ1 4PRDA 1KPVA 2UVEA 3F01A 4ODTH 1KEML 3S2AA 5I71B 3C5ZC 4PY7B 4BZ1A 1P5UC 1TO4A 3CHOA 5AD0A 2ZXQA 2QPUA 3SO3B 2CR0A 3FH8A 4EN3C 1OLZA 2G0KA 4TNGA 2F8IA 1HOCA 3U4EB 4ERSH 1R17A 2IXQB 2X2UA 3MV8E 3BW9B 1XR8B 3QNXB 1JV5B 4CBZA 3L4ZA 4JM4H 2AKRB 3FCSB 1T2JA 1SXZA 5BOPA 3G5YA 2E7CA 1VFBA 5JHMA 3WLWD 3PQYB 5TK4A 4E9LA 4K2UL 1KN2L 2J8UA 4ZUVA 1VCBC 4B3EA 5CEZD 1PCSA 2TRYA 2K7PA 4N6RA 3BAWA 5D4JA 2P9RA 4PRPE 1LGVA 5JLZB 3WIIL 3F58H 4HKXB 4OGXL 1PPIA 4P3CL 1LE9A 4PRNB 1A9VA 4IBYA 4LOUD 4MAZA 5IVZA 1HXMA 2I5YH 1OSPL 4P06A 5E2VL 3SDXB 4JB9H 3UZEC 4EN3D 1NC2B 4UTCA 3AMLA 3LEVH 3RWDB 4V1DA 2NW3A 5F7UA 1YCSA 1J10A 1XD1A 2BNQB 2QR0B 2C3WA 3IDJB 5MEND 4NP4H 4HFWB 5D7LE 5I26A 3L1FA 4AGPA 2F53A 5A1AA 1GMIA 4MD4B 5K9OA 4JGMA 4EKXA 4WUUA 3FKUS 5D7JC 1B2WL 1JP5A 2AXJA 4PRIE 5E5MA 1GS7A 4APXA 2EVIA 3AVEA 1C8PA 5CLTA 3CVHL 43C9A 3CFKA 5JR1H 1KTDA 3CSGA 5D1QA 3HS0B 3T8XA 2I69A 3U83A 3UCRA 5A2KH 1DLHB 2VISB 3D0LB 2GC7C 3H3PL 3ARDC 2V2WA 5DD5L 4HV8A 3AQYA 3LS5H 5AW4B 3RIKA 4PD4J 1WISA 4G1MB 4OJFH 1CD9B 2Z92A 3DPDA 4LDLB 3MRQB 4IHOB 5CXPA 1EZSA 1HH9A 2XIIA 4XGZB 2PABA 2YUXA 1D9KD 3S36H 3UYPB 1KT2A 3VXUE 2ED7A 3TJEL 4DW2L 4Q9RH 4YHNB 3BLBA 3B1UA 4G6JL 5EUOF 3RE0A 2A73B 4FJ6A 3UROR 1P7QA 2I07B 5D7JD 5LN4A 1UADC 3HI6H 3SBPA 1W6WA 4JPWH 4X83A 1MG2C 4HULB 4UM9A 3TO2B 3EGXA 4OUUB 3T77B 2RBLA 2E74C 3ZE1B 4R0LA 4AKPA 2EDNA 4G6FD 5HHPA 2WZ5A 4AH2B 4ONOA 1CFVH 1PG7H 2FWLB 3RTQA 5J13B 3HNVH 4QRSA 1MCCA 4LVNB 2X2YA 1QG3A 1GAFH 1TVHA 2ZXDA 4MMZC 3OMAB 2WXLA 3EH4B 2Y7SA 2Y5EA 3P2TA 1YMHB 1HSBB 4JFEA 4OT1L 3U1SH 3VXRB 1Q0YH 5F3FA 3U7WH 4OU3A 1SRDA 1PZSA 2CLZA 4X6EB 3MOAL 1HCZA 2IH3A 2CK2A 1HWWA 2DKSA 3UTZA 3VD1A 1NMBL 5DEZA 5KYNA 1CXFA 4L29B 1NGYA 1SFDA 2F53E 1UD5A 1V7NH 4HBQA 5AVRB 4KI5C 1FGVL 2CGZA 5AOMA 4NQDE 4XMXA 4K07A 1ASOA 4L3CA 4LVHC 4F9PC 4MXVE 4OF0A 3QUKA 2DJUA 5MHSE 5KVFL 3CUPA 1PD0A 4JX0A 1QSEB 5LBGA 1OTSC 4DFHA 3LH2H 3VQLA 1S9YA 2RTTA 4M9PA 4YLCA 1B3JA 4DZBA 1T20A 5TFSH 4F24A 5E23A 3EGSB 4B6ZA 5IEHA 5JQIB 4ZXBD 1UKTA 1NUDA 3KXFD 1JPGA 3HMWL 5E99H 4IMLB 3TVMB 2KLSA 2P8MA 1ORSB 1TIUA 1FFPB 2FYYA 4RAHA 2YD7A 4QPEA 5L7XH 1P0SE 2P24B 4AGLA 4JANB 2WWMD 3U46B 3RY5A 2GK0B 5CCKL 4JFXA 1DVFB 4ZUSB 4X5XA 3C8DA 1NAKH 3QUML 4KI5D 5J3HD 2ODIA 1UZ6F 3D2UD 1P5UA 5KWYC 3U2IA 2ATKB 4EN3A 3WHXA 3IT8D 2KDYA 3VRLE 2V17H 4AL8C 1U42A 2JQAA 3ZKMC 5MENA 1OTSD 1JHKH 4GI6A 4Z7NE 2R8SL 2QZ5A 2X1XR 4L8CA 2A9CA 3K0WA 2KZBA 3CVBA 3KLAB 1WUNT 1R3LA 2FQDA 1MVFA 2MOVA 2E27H 1MFDH 1KCVL 1U8LB 3QUYB 4PJ7B 4W81A 2AV7A 1R3JB 1VERA 2BIQA 4GSQA 3LPOA 2DD8H 1NEZB 4GAYA 4BDVB 1I8KB 5KZCD 2CDEB 3GMOB 5I8CA 4XPHH 1XXDC 4UIKL 4LMQI 1YHPA 3BZDA 5T1KD 5E2TH 1BXXA 1JF1A 2Z0UA 4GRWB 5J11B 2FQFA 4RVBA 4U1LB 1ZHKA 4XCYB 3T2PA 4XXDB 5F93C 3UZEA 4QT5B 3P11L 4LLQA 2GTQA 3QZWA 4YBLB 2LW3A 3E7JA 4DVBB 3TA3D 1JERA 1MCIA 3GBLA 1MPAH 3B1TA 4NIYE 3O6ML 4UV7L 2AMUA 3OL2A 4N87A 3OKDA 3ZDZF 1EHLH 3E38A 3CFMA 3IKCA 1URIA 2FT8A 5D7JA 5FYKE 4HAKA 4WWPA 1Q0EA 1MCFA 1YJDC 2NCEA 1D6EA 3MRLB 4YDKL 1TU2A 3OJVC 5KVDE 4PS3A 4G8FB 2ED9A 5GHWH 1AE6H 2DM2A 4LASL 1RPUA 5CEZE 2O4EA 4FXKB 3WEMA 3JV4B 3NRFA 4MBRA 1J8HB 4IOFC 5EBMB 3S37X 4CA4A 4XTRC 5ADPL 1QBLL 4ZX4A 4R26L 2NW2A 1E5BA 4YDMA 2MPVA 3QHTC 4I18B 5SWQB 3BUPA 3Q2LA 3ARFD 4LSDA 3PL6B 5AB1A 2IFFL 4TTDD 4JZNB 2XWRA 4K55A 1TZ8A 4TULH 2ZOLB 1PKQE 3NUKA 5AAMC 3MRCA 5CR8A 2GSIB 1YECL 1S5IH 1WGVA 4G1EB 1T3FB 2DQMA 4YHLH 4BH8A 3QG6A 1Y7VA 1YEGH 1KIUA 4AWJC 3RVWD 2JI2A 5DVKA 2BIHA 3B7RL 3LXUX 3QI9D 4IDLA 4Z7WE 4PWKA 1TKWA 1CG9A 5L4MA 3SDXF 1TJGH 4JQIH 2DTSA 4JRXD 5GS2D 2X6UA 3MU3A 4PBWD 1T5KA 4IOFD 2DBJA 4IU3B 3HZMB 4MMZA 1MCWW 4YXHH 4CAGA 3EHBD 2JCWA 1BX2A 4D0CB 4MAYC 4N9GB 4UT9L 2AAAA 5A2CA 1EHXA 3KYNB 2X3BA 2X10A 4ZXBA 1TEGA 2CR6A 4KO6A 3ULVC 3V0AC 2Q0ZX 1OAXH 3ROLA 3JQOB 3DYMA 1NOFA 4TUOA 1UXSB 4ZX3A 3PABA 3FUNA 1AZZC 3QHFL 4UDUB 2LU4A 4HJJL 4GIOA 1P5VA 1TZGL 9PCYA 4YBQD 1A6VH 1UATA 4OI7A 5CNHA 3EBIA 4HX1A 4MHHI 1M7DB 1BZQK 1ZE3H 1A6TB 1ZLSL 4N0UB 5LO7A 4QJ5B 3OAWA 3CX5K 1FORH 3BCDA 4HWUA 3JWOH 4PREA 1SXAA 3ZSTA 5CD3B 5FHBL 1KCKA 5KANI 3I6SA 3O41B 4XMKL 4B9JA 3NBNA 2DQDH 1AVAA 2WLZA 1ACXA 5DZLA 1A6UH 3P02A 4AUUA 1YEKL 3LRHA 3ELQA 4X8JA 1P4UA 3S35H 3QQNA 4LIQH 4DN4H 5CWSA 1SYVB 2CUHA 5I75C 5IKCA 1QFWL 3LIUA 1WD8A 2Z1KA 4XBMA 4LKXA 1RUAH 2HH0H 1EBPA 3ZE1F 2JXMB 3QJTB 3PWJB 2GBAA 4RSVA 3GMPA 4IOIA 3ZL4H 4F8QA 2AXGB 1C7TA 3DETD 3PGDA 4Q6KA 2K6YA 1W8EA 1U0QA 4DO5A 2VZVA 4NDMA 5I15L 2XQBH 1VCAA 3B9EA 5MEPA 1E5AA 1HE7A 4MNQE 2EXWD 3VI4E 2C4FU 3TA3A 1J8RA 4GAGH 1IFHH 2NY1B 1V3JA 1ZTXE 3RJOA 4N2AA 3ARBD 5D1XC 4UTAA 5IVXE 5IEKA 1X5XA 1EDYA 1K2DA 2XZCL 3O3AB 1OLLA 3KWWB 1CDCA 2F8OA 2GVYA 2FECL 1IVTA 3BAJA 4HIEA 4IJ3C 2XWXA 2BVTA 3QIWC 4BK5A 3HZYB 3VDBA 4Z6AT 1UT1A 3KXFE 1MJ7H 3I84A 4LDEB 3SD2A 4AM0B 1ZT4B 3QHZH 3IVKB 2CLVA 3BMVA 1KZYA 3MOQA 5L4JA 1W0YT 1Y1DA 1VLXA 4F7MB 3MRKA 2OMZA 1Z5LA 3CLFL 4AYDC 2W92A 3D06A 1BMZA 4HCRL 2EIBA 4JK0D 1S7VB 1WYJA 4NJAH 5J12B 5KSAD 2IGFH 2V5TA 4OJEH 1QWNA 4PJBB 2P5ED 2EZ0C 3RLSA 1ND0A 3VM7A 1ZGLA 1BGXH 1CDUA 1GGBL 5AALA 2WSKA 3DVNA 1RY7B 3IFLH 5BCAA 1I7UA 2QADB 2BZDA 4WO4C 2WWKT 4RWHA 2N1TE 1JK8B 4W9HC 4I5BA 2NXZC 1FO0L 1YNTB 2FBJH 3WE6A 2H32A 2YMOA 3NJLA 3EYSL 3HG1B 4JRXA 4MJ5A 4OV6F 4JW3A 4PGJA 1IEAA 3ELAT 4LVEA 4WI7A 5I1KL 3FC8A 3TCLA 4PYHA 1E67A 4APQC 2QQKL 2QSTA 2WBJD 4PJ7F 4J3OF 1ZIBA 3FT3B 2UXFA 3U6RA 2BVOA 2PYFA 3ZE0E 2VRAA 1MSPA 1IX2A 2F54D 1A66A 1BBDH 1U3HC 2O6FA 1A2YA 1GPOL 2EZ0D 5FKPA 5BO1L 3MKGA 2A74A 4RA0C 3QUGA 5FYJH 1DUZA 4LQFH 4GRWF 4MB3A 1KBGH 3MRIB 3B6SB 3ETTA 3NIDE 3VJ6A 5C07E 2NXZD 1LK2A 3O3EA 4X6CF 3QEUB 3P77B 3GNML 3DIFA 5FC9A 2A9NL 4YUEH 4AQ1B 2OZ4A 3BWAA 4XMLH 4L8BA 4YSRA 3ARVA 4JY6B 4MAYA 1W72H 4LT7A 4ZOAA 3EXJA 1DJZA 2TRHA 4G5ZL 1UM5H 4ZPTB 2GKIA 2WQSA 4R97B 5CKAA 5IHZA 2HCZX 3GXNA 2P46B 4N8CH 1SJMA 1KV7A 4AV4A 1N26A 4P4RA 4NT6A 1T4KA 3UPAA 2AK4E 2BXZA 1OTTD 2OR9H 3LPWA 5J6HB 4RCAA 2FSDA 3OC8A 1DANU 2H41A 5AOLA 3KR3H 4FQ2H 2R0ZH 5BW7C 1AXTH 3FTUA 1MCDA 4HOWA 3ZHKA 1R4XA 3ZE2B 1R9FA 4UB0L 3B2VH 4DGIH 3P4LA 3S5LB 3NCCB 4LFHG 1C12B 4MJ6A 2IADA 1Z0MA 1N67A 2WINA 5I17B 3ARBA 5FYLD 4GG8B 4JRXE 4OF6A 2PPDA 3GI8H 3WS3A 3STZB 1P4BL 3EOBB 2OYMA 5TH2A 3SQOL 1G7LA 5E4OA 1WCQA 1BVLA 1SJHA 2LU7A 4YNYA 2D0HA 2H0JA 1S7QA 4ZMTA 5IJVA 4L4JA 2CBPA 4N0CC 2W0LA 2XTJC 3ABZA 1ONQA 1N59A 1UQSB 4XCNA 3PV6B 2V5YA 2VN3A 2OPCA 5I6PA 4S1DD 3TWYA 1A7BA 1EAQA 4XO3A 5T3ZD 4ANXA 1KLFA 4IKLA 3V4PA 4I13B 1XX9C 4N2NA 5BMFL 4XI5D 5LAPA 4FFTA 3UAAA 5IMMA 5KSAA 1FFOA 4PJGA 5KVMC 2P5EA 5JIQA 4P3DA 1LEGA 5LAXA 4QOKB 2IAMB 2FLMA 3OHXB 3D3VB 4N8PA 4KFZC 3MV7B 2WQVA 4U7SA 4Y4FB 2WQWA 4FGMA 1YMMD 4N20A 5TGBB 3L4VA 1EZLA 3DX2A 3GHEL 3EYQD 3VI3A 8CGTA 3UAJD 4MA1B 2J43A 1J1PH 4M93B 3FO0H 1B0GB 5K59F 2NNAB 1EJ8A 3TP4A 1HINL 4LXFA 4WK2B 4A2EA 5T1DH 1YNLL 1V54B 5DS8A 4AUJA 5DC9B 3FTGB 1LNUB 3EF4A 1TQCC 5DJCB 1VFOA 2NQ3A 1KPUB 5FA3A 5FYKU 5GGTA 3TBSA 1E4XH 1FNAA 3OLDA 4GI9A 1BQRA 4J8RB 5E1HB 5HDBB 2F54A 2UY7B 3KPRA 4WUKH 4J6IA 2NR6C 4ZX6A 1L0XA 2X1OA 2HUHA 3LQZB 5SV4A 2EC8A 2C9RA 2WSDA 5DVMA 1CL7L 2O5ZH 3Q3GA 1F97A 2OMBA 4BHUI 5JIIA 2FHBA 3PNRB 5E6ID 4G80B 5FOJA 5EEXA 1AXSA 1UG9A 1SJVA 4JO3L 4KXDA 4WFEE 2CHZA 4M6NL 2QMJA 3R18A 4B0MB 4WDIB 4P9ML 2NMSA 3TH3T 4APQA 2WXRA 2EIJB 2HVJA 3ZKND 1EUTA 2P4AB 1K8DB 2VLKB 5A6IA 1A25A 3NA9H 3QQXA 3QEGL 1YEJH 2VDPB 1HHHB 4C54A 1U3HA 3ASOB 3VSUA 1RUPL 3GYRA 5JW5B 1L9OA 2NR6D 5GS0C 2JLLA 3L1OL 3U79A 3RUGE 5DC2A 4Z8FH 2WXMA 1H3PH 1U8PB 3IDYC 1JPEA 3EYUH 4CRPA 3A4DA 4XX5A 1MI5B 3CMOH 4FTVB 4JMXA 3REWA 4C56B 2YQ2A 3ATEA 4J3OH 2YA0A 1SYSA 4FOMA 1BLNB 2PCPB 1D5MB 5AOKA 1JGVH 1KXTB 1DJGA 5B1CA 1FSKB 3O3DB 5C7XH 2X4RB 2GJZA 4WWKD 4YO0B 3DDFA 4F7PB 1I9IL 4J8QA 5ESVB 4PJBF 4I0PC 3K6FA 1S6NA 1OGTB 1CDBA 3WFHB 3WNOA 2XKSA 2XPZA 5D2NE 1JWMB 1L5GB 2IPKA 1GHFH 2Y07H 4YDVA 1IGYA 4FFWC 4LE8A 3IJEA 2IBZX 1LYQA 2JK5A 3QE5A 4D8PA 1U8JB 3L7EB 3TN0C 2Q7YA 1R46A 4HS6A 4LHQB 4W9GC 3VMOA 1MDAA 3VXTA 5IR1A 3HNTH 1ADQH 5GRYA 2DLTA 2AEPH 1KXHA 4OQTA 2VXUL 3PJNA 3O2WL 3VXSE 3T09A 4LLWB 5H8DA 1GYUA 4HXBH 2AEOA 4XNXL 4TPRL 4N3UA 5CR1A 2IGLA 4Y1AB 3MJ8B 4GKSA 4P4KB 4FLHA 4XVSH 4HKJB 3MLWL 3B7SA 5E56A 4NNYA 2IMNA 2Q8AL 1WHOA 4M61B 4WNQA 4GQ9H 3TIEA 3DDGA 1KTRL 4JFPB 3TNNA 3OJ2C 5CBAB 5HHVH 2C1OB 2B1AH 4XBGA 2J6WA 3C6LD 1BFTA 5EB9A 4FFWD 5EOTA 1YMMA 1WS7A 1P6WA 2B15A 2KLRA 1FF5A 2LLNA 4HJ0D 2JKTM 1I7ZA 5ILTL 1JTOA 3FUIA 3IN0A 4IIQC 4OZFB 1NFDA 3MPCA 2BY3A 2VIRB 4BQ6A 2N01B 3HFFA 5DUBA 1INEL 1KJMA 3NSYA 4S2SB 2DAVA 3IGFA 1E65A 3IPBA 5DFVC 4DUXA 5GSRB 3TT1H 3EDEA 2CU9A 5LJYH 5BV7L 2P1YA 5E9DD 3MNZA 5AL0A 4IDJH 5F6IB 4MRBA 3CN0A 1OAQL 4AYFB 5KW9L 2DQCH 4IK6A 3DECA 4G7SB 2O5XL 5TE7H 3SE9L 4OCXH 1AG0A 5E6IA 1ZHLB 1QEWB 2XTLA 4MDJA 5B7MA 2ZCKH 1GGIH 5D96B 5JHAA 3LZLA 4WEBL 4G8EB 5I30L 4OI8A 1CI3M 1CR9H 1A3LL 1DJXA 3ZE2F 2IDUA 1ZA3A 4ZX5A 3RIAK 1KEMH 2R2HA 2M2DA 3AWEA 2WLIB 5HYIA 3DX7B 2V6HA 1PX8A 1ZSDA 5KOMC 1NMCB 2UYLA 3OKMA 1JYVA 1U8IB 1EANA 1VA9A 3C08L 4UQCA 4XP6L 5KG9A 1E50A 4BZ2L 2OMYA 2V37A 3VWJC 2BVEA 4Z7OB 1WK0A 4WHYG 5DFVD 4CVZB 2FJGA 3DXAE 2VCOA 3CMGA 5T3ZE 2OYLA 2D31A 2NR6A 2IDCA 5IK3B 35C8L 2JVUA 5IW6A 4M5SA 5DRWA 3HBQA 3ZL2A 4B9GA 5J1AB 4KQ3H 3DV4B 3WLBB 1YAIA 2IFGA 4UBDD 3ATFA 2QQLH 1SLVA 5D93B 4N2EA 1YEFL 4QXUL 2BOBB 3TFKC 5CN2A 3AB0C 2F74B 2OMVB 4GQQA 4PV8B 3KCPB 5F6HI 4JR9H 1SBBA 4H5SB 5D6CA 3HAEG 3ZLQC 3QDGD 4MAUL 2BCMA 2QHLA 2X4PB 2ZKWA 1OL0A 2YPLB 3NDYE 1DQKA 5DU7A 1B2WH 3MJ9H 4OGZA 1O9VA 4YEEA 5DGQA 4KKQA 3CVHH 2J5LB 4M7ZB 1Z1WA 4PGCA 3Q44A 4Z7UB 4NZUL 1PL3A 5KS9B 4XOEA 1RI8A 1TYEB 3WEBA 1BPLB 5F1NA 1TXKA 4F7TA 3VGFA 2P7TB 2ZG1A 1KENL 3GMLA 5KAQF 4P48A 1A0QL 4AG4H 4MMXC 4FYTA 1XGRA 2F2HA 1QR1A 2MKWA 1JF5A 4HUMB 1E4KC 3D6GA 3S3BB 4EBQH 5KBNC 1R5IB 4HLJA 5HDBF 2R2BA 4CMHB 3KW7A 1BVKB 2VN7A 2ADFH 3DJRA 1DBML 1QSFB 4I0PA 4OJDH 4N85A 5HHNA 3UC0L 3TJEH 3FHAA 2LVEA 3BIAX 3RDTC 2IBZY 2VLRD 3U2JA 1KCLA 2MNWA 4MQTB 5DUJA 3WFCL 2YFOA 1ZT7A 3C6LA 2LR4A 4CMMB 3QULA 5BXFA 1HTYA 3HE7B 1LM8V 3F3HA 1GTNA 1C8QA 4TN9A 1CDJA 4XMWA 1T1WB 4N1HB 4GKNB 4XNQA 3CFBA 5EU4A 1O0VA 1J0IA 2JJUA 4U6YA 4BSVB 3A3YB 5D7KE 4X8XA 2EQDA 1OP5H 4I4WA 4GIPD 5TDOB 1S9WA 2D7OA 3RX5A 3LX9A 4U33A 5J5EA 3DO7A 1A3QA 5HGDA 1T6WA 2WJ7A 4DK6A 4OT1H 2WLYA 5HJDA 5A2AA 2GK2A 5I1HL 3PIQB 3BI9X 5E9DA 4HUVA 1MNUH 4V2CB 2OMWA 2AI0L 4I87A 3V5KA 3OMIB 5I9QC 4RDQG 4XXCC 1JGEA 3MLUL 3PHOA 2X2IA 3H53A