4GEIA

N-terminal domain of vdup-1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
144
Chain Sequence
b'KIKSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCAQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-interacting protein
molecule tags Protein binding
source organism Homo sapiens
publication title Structure of the N-terminal domain of human thioredoxin-interacting protein.
pubmed doi rcsb
total genus 22
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4geiA00
2WTRB 3GD1C 2R51A 3GC3A 5F0JB 3P2DA 3LH8A 3UGUA 2FAUA 2WTRA 1JSYA 4J2QA 1CF1A 4LL1A 4JQIA 4P2AA 1ZSHA 5F0MB 5F0PB 4R7VA 4ZRGA 1G4MA 4R7XA 4LL4A 4GEJA 3UGXA 4GFXA 5F0LB 4GEIA 3LH9A 1AYRA 1SUJA 1G4RA 3LHAA
chains in the Genus database with same CATH superfamily
2AAAA 3KL0A 2FUTA 3T1FB 5CHNB 2WLKA 3NPZB 4Z7NB 5T3XD 1HZLA 1ND0B 3PWNB 4U6HA 3TWCH 1ND0A 4BQCA 2CXGA 5AW3B 4QHLA 2JQAA 2QEJA 4BZ1A 1ROWA 5C0BA 3T0BA 3NIGB 4YEEA 2F54D 3B7SA 4R7XA 1BGXL 3BYYA 5JNYB 2NW2A 3K7UA 4JAMA 5E1AB 3V4PB 2V37A 1L9SA 1FSKC 2P3YA 4H8UA 4L23A 4BM7A 4L4JA 4J3BA 4NSKA 4X7TA 3I3EA 5EWIH 1DN0A 1AZVA 3I75B 3K6SA 1JNHB 1ASQA 4G43B 1IFHL 5TK2A 4JVWA 4XP1L 4HSAC 4S0SD 1E5ZA 3NACH 4HUWB 3HE6D 3PGFL 3RNKA 1FO0A 3S35X 4PJHB 4YL9A 1RIVL 2HG5A 1ZS8A 5D9SA 1P1ZB 1A6VH 3ZQ9A 2DMHA 2JCCE 3KJ4C 1KC5L 2ZZUT 3AREA 4YXKH 3DUHA 4IW4C 5K1JA 5E2TL 2W0PA 4N2NA 4N1HB 4UM8B 2FNBA 3OHXA 1RQ5A 2A3TA 2B1AH 2CJTA 5D70L 4TOYH 1JDDA 1XGUB 4B9ZA 4P46D 1LEGB 3ZGIA 1H0DA 2YPKA 1I1CA 2KZWA 2OTWB 3IKCA 1ZWIA 2OYMA 3KPQA 3LPPA 4LCYB 4W81A 5F6IC 4M1GH 3KWVA 3V7AG 2AK1L 3GIVA 3VSUA 2WBJD 5EBMB 3AQYA 4JL2A 4MS8D 4HZLB 2ZUVA 1CR9H 2NCEA 3DK2A 3BW9B 4ABUA 4MLIA 3Q48A 4FN0A 4MD4A 4WO4C 1P6FA 1RZ7L 1D6VL 2G75B 2WXQA 3BISA 5E5MA 3V6ZA 1OGPA 5E1QA 1HXYA 4XMXA 2XWBA 4QY8B 4R96A 4XB7A 4DKFL 1Z66A 4A7GA 4YE4L 5DS8B 1WGVA 2OMWA 2DQEH 2DQCH 3ZR6A 4JM2F 4M6MH 1J5HA 1Z9OA 5KSBF 4FQXD 2YEZB 4APXA 3QORB 4ORGB 4TKWA 1HU8A 2ZP9A 1JMXA 3CX2A 3UZEA 4DPRA 4PD4J 2CKBL 3SDCA 4BDVB 1LHZA 1KB5B 1J9CT 1T7XA 5CGTA 1UHVA 4I5BB 2JIXA 3BAEL 4OJFH 3D25A 3R1GL 5HDBE 2OR9L 2VDRH 5IFJB 1EXUA 1ED3B 2W88A 4NJAH 1P1VA 3PWJB 4O02H 2WNWA 1TVBA 4M1CD 2FX7L 4LSPL 4YN3A 4ZMXA 5KSUB 1SVCP 4LKXB 1I8UA 4NUJA 1L6ZA 1JVOA 1AIFB 2F74B 4PPTA 4NQDB 2PP8A 1TZIA 2WPGA 4G8GD 1Q0YL 5AOMA 5LNEA 5D5MB 3QEHA 5E70A 3VXRD 4EVNA 5DMGD 2TAAA 2P24A 3AG3B 1OEZW 1XR8A 3VFNA 2VQ1B 5JHDB 3D4ZA 4NEHB 1WC7B 3W82A 1HK6A 5EDSA 1IAKA 4HT1H 3NCYS 5T1LB 2WN2A 1E8ZA 3TBTA 3F04A 4HIEB 4XBGB 5TPWH 4AM0Q 1D6VH 2JF1A 3ARQA 4HUCA 3D9AL 3FN0L 3SHSA 2WLIB 3P4NA 15C8L 5F89B 2J21A 4XC1L 4ZPVA 4FNPA 3OSKA 5E08H 2G4GA 4F57L 3TT1H 3V6OA 4RISL 4K94L 2YKKA 3FS9A 4MA3A 4MZ2A 2OJ1A 1BD2D 3FO2A 1PJWA 2DW5A 2DLIA 4H8VA 5J6GA 4S1DC 3NJVA 4C4BA 2N0MA 1DANT 1GOFA 2J1WA 3EBIA 2CKBH 3MA7A 2CUHA 3GO1L 1KACB 1BXVA 3OKNB 5GRYA 4NKIL 2OCJA 2VB5A 2P8MB 3WHXB 1BLIA 4OJFL 4XNZC 1K5NB 3RFRA 5MI0C 5DEFB 4KRPD 3R1GH 3IKKA 3BJLA 4Z7WB 5F1IB 1MLBB 4UOW1 5DHVB 4L0PB 3BO8B 1CBJA 2LU3A 5J5EA 4F8OA 5JHLL 1INEH 4XP5L 5EU7C 1RZKL 1NFDF 4DETA 1V3KA 3VO0A 4E9QA 3N85L 5EFIB 2DH2A 2R29H 4UM8A 1A4KB 1X5FA 1ODUA 2B16A 4WU5B 1UQSB 5DWPA 4AEEA 1MFCL 4U6YA 1YEDA 3M1BB 1L7IH 3CFBA 2WBWB 3S3DB 1YY8B 1M7XA 3TFBA 3TESA 2QPDB 1NM4A 2HMIC 1EZSA 4XTRC 1CURA 1EAPA 3ETBF 5CJBA 3TO4B 4GW4A 3QIWB 1WWAX 2ADFH 4OLZH 3CVBA 3TO4A 1P4LA 1CU4H 3QO0B 3FSWA 3S5LG 1C5DB 1SYVA 1UWEH 2J56A 2YRPA 3SBPA 5B38B 1L9TA 2H1PL 5JZ7D 1OAQH 4XMVA 2ADIB 1B0GB 4AXWB 5FDWA 3UJJL 1M3JA 3IEAA 3D2UA 3L7EB 3OLIA 2X70A 3CVHL 2ZKWA 4ZUSB 2ATKA 2IV9A 4W9HC 5JORA 2ZPKL 2MKLC 4QRRD 4I0PC 2J25A 1UM4L 3FT9A 5CJOL 5J6GB 4HWBA 4DVBA 2XQBH 3Q6GH 2AZUA 2VDOB 4RX4A 4WO4A 7PAZA 2CGRH 3U9UB 2E47A 4FNUA 1G5AA 4PGEA 4KZEL 3GSRB 3IMTA 4ODWB 5AENA 1HWHB 3NSFA 2FECI 4Q7DA 5HI4D 1KXTA 3FTWA 3LIZL 2HTLD 3B5GA 4FG6C 1K5NA 3F7VA 5T1LD 3ARGA 3MUY1 4Z7NF 4NM8L 3QNZA 4K7PL 5I9QB 2FECL 2BHYA 1PKOA 2NNRA 4N8VA 3PY9A 1G6RA 4UIMA 4S0HA 5IBUB 2ZWSA 4Y5YA 4I3RH 3OHXC 2OBGA 3UFIA 3WLBB 1IFHH 3MNVA 3WLBA 4EUPG 1JV2B 4NQCB 4Z3JA 2IH3A 2WBJC 4CNIA 1W0YT 2ITFA 3ARFB 1KTCA 1T4KA 3ARFA 1OV8A 1GC1H 1M7DA 2X0UA 3FFCD 3WI9A 4CGUB 4D9QD 1VADA 1COBA 4DGIL 5GS0L 5GISL 3QFDB 4TNFA 1TCMA 3QXAB 4ZS6D 5KVFH 4TTDC 3W5NA 1IKFL 4QTIH 4I7ZC 4TXVB 1CU4L 2BSED 5DZAA 1KY6A 1THAA 3NFPB 4JZNB 2IAND 4NQSA 4LLVA 3UJIL 3RPIB 3ZHKA 2MNUA 2G3NA 1OAQL 3H9YA 2AVGA 3W57A 4DPBX 4QNPE 1YYCA 5I71C 5B7EA 3HCVA 1CFQB 4CSPA 3BUYB 4JFZL 3QUXB 1S7VA 1MCCA 1U8QA 2NXZD 2A1WH 3MCKA 4N24A 1J86A 4M1DH 1GGIL 4HCRH 2M2DA 5DZVA 3JT0A 5FO2A 2B9BA 1ZT1B 2CHZA 5CKAA 4JO2H 3OXSA 1HYRC 2ZNWA 3RTQC 3VWKB 1U6AH 2E5EA 4IU2B 2R1XA 2Z8VC 1DBMH 4H1LG 1VFMA 3SE4C 4F7EB 3QQ3B 3NBNA 4K7FB 4OCYL 1ZLVK 1ORQA 4MJJA 4X98B 2V2TB 4NM8H 1ORQB 4K7PH 1CN4A 4ONGH 3DJRA 1EANA 4UOW0 3F7VB 3K72A 4IK7A 4AJWA 1V05A 4HFWA 1MRCL 1HQRB 4KRPB 3CHRA 1OCWH 2BVTA 3ESUF 1YAIA 1K5WA 2CE6A 3MNWA 3S6CA 4JM2B 4OCLC 5IMMB 4H5SB 3VUAA 4XBEH 4ZFZB 4LSSL 3X14A 2XXCB 3K0WA 1KYDA 1LMKA 3F12A 2NSMA 4PYHA 4MASA 3WY2A 2WLLB 4LKCB 5CJQH 5D6CB 3VFTA 1E2VA 1NGQL 4PJDE 4KH2A 3D30A 2CK0L 1DEEA 3CVDA 1YUHB 4NT6B 2X05A 3UJIH 5IFHH 3H8NA 3VMOA 2FX9L 1Q1JH 3BLPX 5F88A 5MENA 1AY1H 1LO2L 1RH8A 1AXTL 1N4XH 2N7AA 1CG9B 1QW9A 2EYTB 3VRIA 5I30L 4PB9H 1MIML 4K7PX 1GGIH 3Q2VA 4HCRL 2I85A 1OGAE 4X6FA 2FCBA 4ERSH 5FUZH 3DECA 5IHHA 4JB9L 2EDWA 2FL5A 1RURL 4NYLB 3BCDA 2VLRB 3LYRA 1E5YA 1QLFB 2FB4L 4UTBA 3ZR5A 2NOYA 1WDAA 4RH4A 2Q7YA 1YMMA 3G6JF 1PJ9A 1JK8B 3BAJA 3GBML 4HUMB 1F18A 3AB0B 3L7FA 3T0XA 1KXTB 1ZGLP 4NRZB 2V2TA 2EKJA 2VERN 1KLFA 4R0LA 3RZCA 4R2GB 1RHHB 5FUCE 4KX8A 3PDGA 4NWUH 1HT6A 4BD4A 3N44B 2ITDA 4GBXC 2IBGA 5C0IB 5E23A 5E94B 3KDPB 1KLGA 2WXMA 3GO1H 4PRNB 3G3LA 4PP1D 3VD9A 2KLSA 3P4OB 3X17A 3SEPA 4LCWD 3P1VA 2I32A 3NIDB 3RHWF 2IH1A 3L4WA 3IU4H 4OCRL 2BRRH 1V27A 1EGJH 1XGYL 4ZT1A 1AYRA 3D51A 5C0BE 5DVMA 1NBZA 3KL5A 2OSYA 4LCIL 1FF5A 1H9VA 4GG8B 3C5ZB 3IDMA 1CICD 3FFCB 1R9FA 1S9XA 3QB7C 3ULUF 4OGAC 3TCXA 4O00A 3NPSC 3PHAA 3CMOH 3DX8B 4URKA 4I0PD 1HXMB 2NR6D 4YDVB 5IW1A 5BUPA 1GC1C 2PO6B 4XP6L 1E5AA 2LTQC 3OZ9L 4AENA 5FUZL 2I27N 1G9NC 3O3BA 4TLUA 5D7IA 3EXLA 4E0RA 1RURH 4F7PB 1NDGA 2DMKA 3NA9H 1H3PL 4NNPL 4OLZL 1P9MA 1ITBB 5EEVA 5E2WH 3BH8A 4OJEH 2UWEA 1UKTA 2BWQA 4KX9A 4CN1A 1SJEB 4Y9GA 1FNAA 4OZIE 1ZCRA 4N5EC 3S5LA 3E6HA 1JZIA 4ECNA 5I8CA 2CLZA 1JWMA 1QI4A 2EEFA 4I0PB 3E80A 4H20L 5INCA 1S9VA 3KBEA 4PJXA 3UTQA 4X2UA 1NAML 3P30L 2E7DA 3CFCL 1DN0B 3HMWH 1W6WA 4GRMB 4C57C 5ICUA 1FE8H 1J05B 5A3IC 4QCIA 5A2JH 1C12B 2XU9A 2C34A 3M17B 2XX0A 4RMVA 4DVRH 2Y7SA 5AW4B 2EE0A 2V9UA 3F58L 2YLKA 3ISWA 1GCYA 3RDTB 1TCRA 1Y0LA 3TEXA 4JO8A 4KDVA 1RPKA 4GKNB 1KTJA 2DQIH 5GS1C 3SE6A 4LEOB 4HIIA 2VITA 1CXLA 3HE6B 3TVMB 1L6PA 4XP6H 5KSVB 4U1HA 3FU9A 1IMHC 3OZ9H 1IM9A 3CFEA 2R69L 5IF0B 4QTHB 5D7LD 5KVEL 3IGKA 1BVZA 4UU9B 5DMJB 5CZXC 1D3CA 5JPMB 1IKFH 4QTIL 1MW1A 1B2YA 1M1XA 4XPFL 1KIRB 2ICEB 1CF1A 4X8GA 2CNYA 2FBJH 1LNUB 1CDYA 4PI2A 4D7BA 2XBZA 1ES0A 2EO9A 2G0KA 2ADGB 2AC0A 4QY8A 3FRPG 4R96B 1Z1WA 5GGRB 2UWEB 3EDEA 3C9NA 4P04A 3BGFC 4X8CA 1URIA 1CFVH 3L1OH 5I8OH 1A6VL 1F1AA 4QWWC 4H2AA 2PCFA 4QXGL 3GZPA 4OKDA 1JGEB 2FH8A 1T89C 5H35A 2F9BT 2ZSWB 4Q56A 4FA7B 4FQ2H 1PU0A 3EJJX 4B5ZA 3U82B 5FM5O 5HJ3A 5FGCE 3VXTA 2XDHA 1JNHA 2G3XA 3MR9B 4YQXL 2NPLX 1KB5A 4OCYH 2PXYC 1JWSB 4YOKA 4KMQA 2D03H 3ZE1E 1DEDA 3MGOA 4OLYL 4A7SA 4D9LH 1OM3H 1J8HB 2GUOB 1TJXA 3FONB 1NCWL 3C08H 1QEWA 3AREB 4K3JL 1RZ7H 3CSBA 4OQTL 2IGFH 3NIFF 5L2JB 4R6UA 2ED6A 5JIIA 1UXSA 2OMTB 4DERA 1T4WA 3MCG1 2IOIA 1S7RA 1GYUA 1BVLA 2QMJA 3CLFL 4YE4H 3CD4A 4KDTA 1AP2B 4OZIA 3BE1H 1H0DB 3IBEA 5KVEH 4KI1A 4M6ML 4BUQA 1FAKT 1K3ZA 1NMCC 2AANA 2FLBT 3IT8D 5FYJE 2UY6B 1GJWA 1R46A 5F7EH 3KPPB 1JUFA 5DYFA 3U79A 4U1JA 4XMTA 4O5LL 4PJXE 4KITB 5KS9B 2DYRB 1FC2D 1XR9A 2I26N 3GHPA 4PV1C 1N59A 4K71C 1RUPL 2RIKA 2KH2B 5MENE 5L6YH 1AY1L 4TUJA 1LO2H 3O8XB 5IB4B 3WKMH 2WBJA 4JZJB 3WIIL 4X7EC 2V8LA 1TQVA 2GK0A 4KXZH 2ZUYA 3G5YB 1U95A 5FYKU 1EBPA 4JFTA 4Y5YC 1A5FH 2IADB 2CRIA 1JGEA 1G7QB 2FE0A 3I50L 5E8OA 3RWIB 1QLEB 4HKJB 3ABLB 4TNGA 2AXJA 1JZEA 3CUPB 1AHWA 4XMPL 1AGFA 1WZAA 3DNKA 1KGJA 4GEIA 4NM4L 5FYKE 3JQOB 2P46B 3H2QA 3C08L 1SY6H 4I9XA 3T2PA 1CICC 3T5WA 3D50A 3MAWA 3NH7L 3J8F7 4DCQB 4YXLL 5D7SH 5DZLA 1A7PH 3VG0L 2C1PA 3AMKA 4ACPA 4JKLA 3V0DA 3QRBA 3B3IB 4UTAA 4F57H 5L9DH 3DX6A 3ARDC 4JFEB 4J5VA 2YR3A 3EHBD 2ATPA 1UEYA 5AB9A 4R8WL 4PJ8B 1R5IB 3K71A 1D2PA 1BM3L 4MGXA 2WKGA 3GPSA 1I1FA 5F7EL 3UGXA 3TO4C 3T2OA 5MHSE 1N67A 3HUJF 1F58L 1WUNT 5LBSA 3VGGA 3OLDA 5KYYB 1BMGA 3KLAB 4IRJA 1RUPH 3LHAA 5F7DB 2XN9E 4BQ8A 3L5XL 2ZUUA 5LGHL 3DRQB 2K8QA 1NIAA 3HNTH 1KGCD 3DRQA 3BVNA 5KVGE 3QWQB 2A77H 4DN3L 1PKQB 4NENA 3VGHA 1KGIA 4G42A 5B1BB 2FX8H 4HBCL 4AL8L 4PU2A 4KI5E 3RWHB 3FTZA 5HXMA 2IQAB 3S5YA 5E0QA 2W95A 2VQ4A 3U7YL 2R29L 2X2HA 5H8DA 1GCFA 3FCUB 4JZOA 4YE0A 1BOGA 1Z3GH 4JG5A 3D69A 3TPUA 1INQA 1M6OA 5H4YA 1S3RA 3CFDB 1SY6L 3PP3H 4JFHD 5DYOB 3C87A 4EN2A 3O11B 3VI4B 2YEQA 2F7RA 2XCMC 3F6LA 4MXWH 3NCJL 1QEWB 4GYBA 5AVRB 2YIHA 5MEQA 1R34A 3OXRB 3O8XD 3QDGA 4WI8A 1A9EB 3D8MA 4HXAL 4BQBA 2P4AB 3RKPA 3ZKNC 4H0IA 3JYCA 3CVHH 5HTSA 3EGXA 5F9JA 4G5ZH 5K9OB 1X5IA 3IJHA 3SQBB 2GBUA 2VZ3A 5D93C 1VCBC 2E7MA 4ALAL 1P5VA 4DUXA 3UJTL 1N59B 1KIQB 3FU3A 1P4BH 1P4IL 3MSPA 2YPVA 3QQ9C 4U1IA 3L95A 4PJIE 3SCMD 1QWHA 3IFPB 4UMSA 2YHGA 3B1UA 5HYQB 3U0PB 2X4RB 1QAWA 1NWPA 4HYTB 3WFDL 4EUPB 1OOAA 4F91B 3OKOA 2EVFA 3X3GL 3QXWA 3NEOA 3WTSA 4M61A 3ZMRA 3L54A 3VI3E 5E1GA 2TSAA 3COOA 4MJ2A 2A9MH 2DRUA 3VWKD 3T4AC 5CU5A 4D94A 3K1KC 2VJ8A 1EEYB 5E1HB 2KLTA 4HJ0C 4Y4HD 2NDGA 1L0YA 2OTUA 1YC8A 1NFIA 3FRPB 5ADPL 3ZHLA 2Y1ZA 4IKLA 5AAWC 4V1DE 4R7NB 3WBDA 1TIUA 4EIZC 1U36A 4YHIB 1CBVL 1XB8A 1GKOA 3D0LA 1X5MA 1YZZA 3DGCR 4WSGA 1S7SB 1BEYH 1PZSA 1F6FB 3AY2A 2H0EA 5SWZD 1CE1L 2BNRE 1A6AB 4XO4A 4M1DL 1DVFC 4BRVA 5L0QC 2CM6A 4Z6AT 4G9DB 1AFVH 5F7UA 4DEPC 1F4AA 4JRYB 1OPOA 5C07D 4AE0A 1BXUA 2ZE0A 2KDGA 3H2PA 3UPAA 1JF1A 4ALAH 2ICWA 4GIAA 4F37K 4MNGB 5DLML 1WTGT 2DQMA 1CFSA 3PFUA 3IXTB 3NN8B 2EQDA 4MRCA 1R3JB 1PL3A 2P7TB 2VXTH 4HD9A 2J7LA 2VR5A 3THMH 4CADA 1KCKA 4L5FE 3VE0A 5DZNA 1PAMA 4ZMZA 5C2BH 4NHCL 4QOKD 1QPXA 2WIMA 3S3SA 3CVHA 1K4CB 3KHQA 4KO9A 3FF8A 3TZVA 1J87A 4MA3B 4PYGA 4MB3A 3RE0A 5E5UB 4H25A 5EIIB 5AVVB 5BOZG 3VXSB 1M7IA 1MELA 1RIVH 43CAA 2AABL 4IOFC 5EU3A 5K9JH 2WXHA 4Z1PA 4M7LL 43CAB 2FTAA 2DM7A 2G60H 1CLZH 4JFQA 5ADPH 5INDB 3T8XB 4OU3A 4CSZA 1SOSA 4QRTB 1DBBL 2G2RB 4WW1A 1XXDC 5LCVA 4ZAKB 4FQXC 1A5FL 4WI7A 4WENB 1AD0A 4GI6A 1G1YA 2Q87A 1S78D 4G1MB 5E2UL 3ECWA 1RZQA 4YHIA 5I1JH 3BP5A 3KCWA 2PYFA 4YFLF 4X0NA 3NEXA 3FQNB 3T77B 4JHWL 2YEVB 4KGLA 1CO1A 4U33A 2Y1VA 1F56A 1DJHA 2F1BA 2K6WA 3MRFB 5F9WC 3TEUA 1RZIA 4FX5A 1Q9LB 4U3SB 4E5XG 5EF1A 3W11C 2X6VA 2IFFL 3KNBA 3B5TA 5HVHC 1RK7A 3QWNA 2KBGA 1P7KA 4CJ0A 3Q8FA 1BG1A 1QSEE 1U0QA 5FR3A 3O41A 2H1XA 2E7CA 4RIRA 3N44F 1AQKL 4G82A 2A6KA 3O6MH 4WV1A 3VW3L 1QLEL 4HIHA 4JGMA 5EZJA 4HV8A 5DI8A 3FHAA 5C0BD 2Q86A 5DGQA 5ESAB 5C2BL 1U8HA 1BWMA 4B0MB 4N0CD 1NIBA 3T4YB 5DVKA 3AT9A 3DHUA 4QXTA 1FO0L 4QLWA 2IJ0C 4NYLA 3UAJA 3SPHA 3D0VB 3EJPA 4XVOA 1AMXA 2X6UA 3F64A 2NY1B 3C60C 4XVJL 1NMBL 1WAAF 4OCRH 4K8RH 5A16B 5TE4H 4DPCX 1KFAL 5AW7B 3A6CL 5IFAL 2PETA 4PBDA 4X6DB 3X12A 4Z3EA 2B9AA 2FX7H 4M8RA 5KG9A 1V3JA 5SX4H 2VR4A 1DVZA 3HI1B 5CCGE 2Z8RA 3RHWK 1T1WA 2A74A 3WENA 1N10A 3HS0A 1E42A 1HHJA 1K8DB 3L1FA 3GM0A 1Q0XH 4Y16B 4FF9A 4XPAL 3HEIB 3VX1A 5B8CC 1T03L 4DP8X 4L9LC 2ZG1A 2OSLA 4RAUB 4ONFH 3B2DC 2J71A 2ZICA 4C56A 3NGBC 4LIQL 1Q9OB 2GY5A 1PNDA 4GKSA 5EA0L 5F93C 5CJXC 2COVD 1H3PH 5KJ4A 2IDSA 2RTTA 3KM2A 4GUPB 3BFQG 2H32H 1TCRB 1Y0LB 4PJFA 5DJDB 2G3MA 3P3YA 5IBLD 4PJFB 3FFCA 3GJEB 4K94H 1W9XA 3EYUH 5D6CA 1G9MC 3MFFA 1KCBA 4JFYB 3HE6A 1D9KB 5HDWA 4YR6B 3RGBA 4EJ1C 4YDVA 4P2OC 2HUHA 5DFVC 4CADB 3NIDE 3UROR 2Z65C 5EOTA 5IIEB 4ELKB 3BLBA 1CFQA 2XQYA 4ZPTB 3FQRA 1GY2A 1X5JA 4NRYA 1GGUA 1VFBA 4XNUL 4L4VA 3QUXC 3B2VL 2WBXA 4P46C 2YXFA 4FQ1L 3DGDA 3QQDB 1A7RH 5BV7H 1X3DA 3LEVL 3MV7A 3Q3GB 3B34A 1G1KA 2OYKA 5LXVA 3QORC 3E6HB 1IQDA 1INEL 1RZKH 4FA8A 2FWUA 4FL4C 3N85H 4NAQA 2GBVA 2XXGA 1FVEB 5EWIL 1Q0XL 3HI6L 3QZBA 4RGOH 2FQDA 5DHYA 2WSPA 4I9WE 5F7BA 3ZKND 3K2MC 3NRQA 4XP1H 2YK1L 1Z5LB 3S8WA 3FBQA 3PGFH 4PM1A 2R51A 3B83A 5IQMA 2Y3NA 4D9RE 2HTKD 2B39A 3R0MA 2QELA 1LDPL 4BFFA 4EN3C 3NT0A 1II4E 1XV8A 3HBQA 4J8RB 1QFHA 1KENH 1PEWA 4PS7A 2P28B 1XIWA 5T33L 4XPFH 1ACYH 1A7BA 2YPLA 2FT8A 4MYPA 4PJ9B 2CIIA 1FFTB 3MLWH 4L3CB 2CK2A 4WIQA 2LABA 5D71L 2XN9A 3CPUA 1WJ3A 5I8OL 1GGTA 4PJ9D 5GRJL 3ZTEA 3HZKB 3M86A 4X6CF 4XN5A 4DEPB 4RMQA 4AT6B 1O9ZA 4J3UA 3WJJA 1R3KB 4O58L 4NO2B 2HFGL 4Q6IC 1JZ8A 1QFOA 2PYEE 2ICEA 1A7RL 1SQ2N 3ZO9A 5HYJB 1AKPA 2OMXA 4ZUWB 3WSQL 1FHGA 1S9WA 1T20A 3C75A 3MN8A 3BVXA 4MAYA 1JHTA 2ADGA 2HN7B 2NXZC 4D9LL 5FYJD 1HQ4B 4FHBD 4LESA 1AGCB 4PY7B 3QNXB 4LSTL 4QRFA 1SVZA 3LH8A 1RZKC 2ARWA 1YEJH 3CLFH 3L45A 4XT1C 4F1ZA 1NUDA 1SVBA 3BAEH 2A6DB 3KLQA 1J9SA 3DX9A 2OSLB 5I0XA 1EJFA 1JXGA 4CVZB 2VDRL 1U8IB 2OR9H 2UZPA 5I1HL 1KENL 5E4EC 5CCKH 5F6HJ 4X5LA 1DBBH 5GZNA 4FQJH 1ETZA 1IVLA 3EFOB 5D9SB 3JWNC 4I1PA 3MV8D 1IJ9A 2H6PA 4DN4L 3NRFA 2WTOA 3DMMB 3RWJA 4YXHH 3MV8A 5EC2B 2EADA 3QJQB 1QASA 3ZRCC 2UXTA 4MFHA 3KYNA 4Z0BL 2QBWA 2VXQA 4KWUA 1I82A 5JLZA 3MACL 4Y7OC 4NN6C 3W56A 4LOVA 3F7YB 2PTUA 3MROA 4EUPH 5T3ZE 3B43A 2HFGH 1ZEAH 3DXAB 1G7JA 1X5AA 2K78A 4P23A 5TPWL 3O9WB 3HKFA 3FT3B 4JQXA 5I0ZA 1J8HE 4UQ3A 3FQRB 3WEMA 1MZYA 3BSHA 3KLAA 2R27A 4JQVC 3V7AE 2HFFB 3OBAA 4Q9QL 4RISH 5F9WB 3PPSA 4JW3A 1KCSH 4MDIA 5IROC 2OI9C 3FOMB 3KEHA 3RNQA 1FVDA 2A5UA 5BS0A 1ZPUA 4TUOB 4I0CC 1RZPA 1X6LA 4L2LA 3KWWA 3TYGH 4AX3A 1U8KB 5D55A 1SHWA 2W0LA 5D6DC 2DIJA 1FVEA 2NW2B 2WVVB 2ENPA 3A67L 4I77H 3V4VL 1FNFA 3QZMA 4PJXB 1TNMA 2R4RL 4K23L 5J6SA 3EDFA 4LLQA 1JGDB 1S9YA 1PZBA 1Q38A 3DIVA 3MTRA 4N2MA 3A6CH 5IFAH 3A23A 3FB8B 3RZWA 2YBRB 4KHTL 4XP5H 3ARBD 3P0VL 4P5RA 2JI3A 3X1NA 2LVEA 2WB1A 3LRHA 2G3ZA 5GGSA 3VDAA 3QJXA 3SJVB 3U1SL 3ARFC 1VERA 3RWGB 1KGYE 2YMXH 5E8NB 1EXUB 2J1ZA 2FZ3A 4O51B 4FHJA 2VN6A 1CLYH 3CSYB 4PB9L 4YH6A 4G7YH 4RQQA 4ERSL 4GIOA 2FSEA 2PPFA 3BQUB 3ISYA 2NNCA 2Q76A 1REIA 3LPWA 5A2KH 5DHMC 4F33B 2CO6B 1AR1C 1EGJA 1PGRB 1NAMA 3OLEA 3AGVA 1YQ2A 4MVBC 3DRTB 5EH1A 4MMZB 5FM5M 3BPCB 5HI3D 2BC4A 5IHBA 4G8GB 1C7TA 2H1PH 4WUKH 1MNNA 3LPOA 1PTZA 2PO6D 2BK8A 2VDQL 3FU7A 4OM0H 2XWBB 4HPYL 4PJGF 4JFEE 2V2XA 4TVSa 2G9KA 2YAOA 1DL7H 2G75A 5BO1L 4IOFD 4TM9A 2N3JA 5CUSL 1KLUB 1EWHA 4YVNA 3IB4A 2HCZX 2L8AA 4UUJB 5EEYA 1G7IB 1PD1A 2ZXDA 3LIUA 3L4UA 4GP8B 5F8RC 3QS2A 1U91A 4J6RL 5FYJU 1IKNC 1DVTA 1E2WA 1AACA 3SKJL 4LCIH 2CWRA 2FDBP 3R8QA 4KHTH 1D7BA 3E3QC 3T3PF 2BCKA 3G5WA 1OP3H 1RI8A 2R1YB 2GFBB 3M6DA 1PKQE 3RY6C 3Q2NA 4I3RL 3ZHNA 2UYLA 1QA9A 4RGOL 5DJXA 1HEZA 1FZOA 4IS6A 5DJAB 3MGOB 2NSXA 1CLYL 4PS3A 3ULUE 4IBZA 3KH3A 5E4IA 1QRNE 2IPUG 4XE0A 3DURB 3L5JA 5F97E 1KGXA 4WFED 1CDHA 4P4RA 5DQ9A 4WKZB 3ZL1A 5CCJA 3U0WL 5I18L 2EZ0C 4UAOB 4UF7C 4ZMQA 3GD1C 1BF2A 3NA9L 4TMPA 2ZNXA 1RP9A 4NNPH 1OTUC 2PR4H 2WXRA 1OQOA 1YN6A 1E8YA 4IYKA 1B2WH 4AI7A 1H15B 1M7UA 5E6YA 3C8DA 2A9ML 4Z7UA 1QQDB 1CFSB 3IJYA 3PIQA 3HVNA 1L7TL 1DJSA 4ZG1A 2G9HB 3L3DA 5CINL 3RB7A 4K9EL 1IB5A 2Y25A 1ERNA 2A6IA 1DL7L 3FYIB 4NZRL 4XCEA 5JA9A 3KBFA 3TO4D 5I73B 5BS0B 1W0VB 4U1NB 2X70B 3RA7L 3LNFA 3QEUB 2WNXA 4LDEB 2N0KA 1KXVA 3SPGA 1BPLB 3MRPA 3MO1B 1T1YB 2EIJB 3MLXH 4XN1A 3D3VA 2MMXA 3FB6A 3MRJA 2IADA 4XOCA 1AJ7H 1U93B 5G4OA 1HHIA 1KPUB 4YHYC 4FEIA 1FDLH 1PIFA 4Y2OA 4NPKA 3S3CB 1QZ1A 2YEZA 3ZBMA 3F58H 1AFVL 1KIUB 2J6WA 3EYQD 1I1YB 1JPGA 3ULUD 1KIUA 4Q9RL 3FB8A 1A1MB 1EJ8A 1RFDL 3VNYA 2R1YA 1ACXA 4PRBB 5HPOA 2BP8A 2X5PA 3N42F 4NUGH 2JJSA 4EDXA 4Y5YB 4HZ1A 4BBWA 2VL5B 3HLAA 3MV9B 5ANHA 4DZ8A 1GGYA 2HB0A 2KKQA 1O6SB 3VD0A 4LOUC 4YJZL 2FHBA 4ZS7H 3MRDB 1P5UB 5JIDA 1O6SA 4QO1A 4PJDF 5FV1L 4U3SA 4QRPE 2EUWA 2W65B 1JXKA 3TYFA 1CQKA 3IWUA 5D1QD 3IFOB 5IFHL 1ZJAA 4WFHE 1EEQA 2JTDA 4IKIA 1NUNB 3N91A 2MFNA 1IX2A 1U8JA 1N4XL 2R2EA 4G8GA 5I30H 3SDCC 1MIMH 4FQIH 3K1DA 1Q9KB 3WEAA 3PYCA 1ZEAL 3EO0A 1WV7T 4ODHH 2X4SA 3O45A 4XXDA 2IH8A 2XJKA 3EJYC 4JGJA 4MJIB 2VDKH 3L7EA 2I7OA 4LVOB 4PY8J 1OOWA 1VGEL 4Y5XC 4YC2C 4XRCB 5HHXL 4OLYH 5D2LA 2FO8A 1G43A 4M5YH 2QJDA 1CIDA 5CSGA 5DR5L 1LM8V 3OPZL 1QPKA 5BVJB 3NK3A 4AZUA 3LMJH 4Q9RH 2GEEA 3QUHA 5E9NA 2IFFH 4DH2A 4GKZB 1M9WA 1IGJA 3UTOA 1D5BA 4LLWB 5I6OA 4FFZA 4YPJA 4TYUA 3VVWA 3MRRA 3B9VA 3HS0B 3F8UB 2ZXQA 3ROOB 3A67H 4I77L 4X6BA 1UWXH 4UM9D 5DJCB 3OTTA 4G1MA 3DTDA 1U21A 3QZWB 4OZFG 4XCCH 2G0LA 4Z8FH 2QPFA 2CHDA 1PX3A 1SBSL 2YGQA 5IG7A 1DHKA 4Z18A 3CZFB 3BQVA 4BWUA 2OKMA 3BP4A 4JG9A 4HP5A 2XTJD 3DGGB 4PJIB 1F0LA 1NC4A 3K3QA 3PHOB 3E9TA 1SEQH 4Z7WE 2PP9A 3SDAA 1J9QA 1FZKB 3B9KC 1C8QA 2QADB 2C9AA 4TLTA 5I0DA 1H6TA 1TZHB 1X9UA 3B9AA 4A2EA 3S48A 3N04A 3WJLC 1BDYA 3LRGA 4XCNA 4GMSH 4U1GC 4M4PA 4PP2B 2IALA 5F1NA 2YAQA 5J11B 1J7VR 3C5JB 5FOBB 2VT0A 4MZ3A 1ET8A 1C7SA 3D2TA 4ZFFB 3OMAB 5HPMA 1AQDA 4XAKD 5E2WL 1OIOA 1LWJA 4JG0H 4JGUA 2AQRA 1BEXA 3E8UL 4NN5B 4XPGH 5IESL 1HSAB 3MO1A 1C5CH 2XHNA 1F4HA 1FI8C 2BFVL 2J8HA 3ROLB 3VFUB 3HAEH 4X42A 1QNZH 4K7FA 4ZZFA 1D5XB 2JI2A 3U9PL 4PREB 2EVIA 2AITA 2ZTBA 5I74C 3LNIA 4F8NA 1SN5A 3NRPA 5D1XE 2CLVB 3MBEA 2OA9A 3M88A 2G2RA 2LFEA 1EHLL 2Z34A 3IMBA 4W68A 1MFDL 4MJID 3H6AA 2NX5E 1CF8H 4I1RA 4TQ8A 4LVHB 3SKJH 3UBGA 1XL6A 3CFNA 4Y1AE 5CGYC 4JN2A 3SYQA 3ABZA 2HLAA 4HSQA 2DQGL 3T6QC 4KMTL 5C0AD 5HGHB 3VTTA 1Q9OA 3BIKB 2BSSB 1XIWB 4PJ9C 2ZX5A 2EVJA 3W9DB 5GS2H 1MF2L 5LGJB 4W4OA 3ZUNC 1TF4A 2V2WA 3CMGA 2A77L 3LEVH 2PUQT 4LKCA 4QHPA 1EUUA 2HLFD 3BEWB 2VABB 3RVVD 2D2OA 2DTMH 5FGBC 1W72L 1SGKA 3HA0A 1BQHA 1M1SA 5GHWL 1R24B 4CKVX 1QTYT 3LRSA 1MLCA 5GRVK 1R24A 2GG1A 2P7TA 1CLOL 3W11D 3HNSH 4X5WA 1VEOA 3RBSA 4K3DH 5DQJB 2H2SC 3WDHA 4JG0L 1MCWW 2SEBA 4IMKA 3VE0B 3E8UH 2EDNA 3QDJA 4L4TD 4NQED 4XPGL 1U8QB 3AG4B 4DF9A 2YPLD 1F97A 4HF5L 3FPYA 2XWXA 3MREB 1L7TH 4XI5C 3VFWB 2WN3A 4PRIA 5I82A 1NEUA 3B2UD 4JRLA 1JDCA 1M7IB 1S7UB 2NTFB 3D5OF 3LN5B 1MG3C 5T33H 3T65B 3VXOA 3FU0A 1ZLDA 4LPYA 4AC2A 3JWDC 3UADA 3CFMA 4LHUB 3G08A 1MWOA 2VLLB 1ZHBA 4PGCB 1EXGA 1SLXA 1JI1A 4JRXB 1EZVX 3MUUA 2OR8A 3VA6A 2VDLB 3SDDC 3US1A 1HHJB 4GLRH 3GSNH 5DWUH 4J2QA 4YL4A 5ABDE 4HFWB 2YSTA 3K4ZA 2DQGH 1T80A 1RZGA 3SKOB 3S34H 2V17L 2MTPA 3QUMA 3TF7C 1U3HC 2DYPA 3BP4B 1XFPA 3JTTB 3VFMB 2OXGB 1RFDH 2IBZX 1EO7A 3V9FA 2YFNA 1S5IH 3VFMA 5EF3A 1VFOA 4MTMA 2FJUB 3WSQH 3H1ZA 3ECVA 4R4BB 1CDJA 2YD4A 4PJAF 4E41A 2GJ6E 4O02B 2E7HA 4IBVA 2IPKB 4K0OA 3NP3A 4OUUB 3S0PA 2YD1A 2GTZA 4GMTH 4OD3L 5DD5H 2VABA 3O3AB 3NQIA 3ZZSA 3CHPA 3V95A 5DXWA 1KY7A 3FU6A 4BA8A 1J12A 4O5LH 5JYLA 4IHOB 3LRSB 3HBPA 1IM9B 2QQLL 3CFEB 4OJAA 4E9VA 1RPUA 1HAUA 2P49B 3MKGA 5IJCC 4OV6F 5MEPA 2WYIA 4JMNA 1NEZB 2VH5H 5ABAA 1S4IA 3ARVA 5TDOA 1Z9SA 1CXHA 1MCSA 1CTNA 2QVTA 1E27B 4WJ5A 4YXKL 3I3DA 2F15A 1XL4A 5C0JB 5JXEC 1NDGB 1OAZL 1LO0H 4U0RC 4W9KC 2OW6A 3OGCA 2WCPA 2XRAL 3BZFA 2WK2A 2KZBA 4WSKA 4PJ7B 4KK8D 5IVXB 1AGCA 5FYLD 2FAUA 1FZMB 3JWNG 4PN6A 4N8VG 4L29A 5J11C 4G2AA 5MEND 4YC2B 3PJNA 5D8JH 3ZU8A 2FRGP 2O4EA 3HUJA 4XMPH 2YXMA 4M5SA 5DZPA 2F61A 4H8WC 3VMNA 4LBEB 4P2RE 5AEAA 4P07A 4QRRB 3WN6A 2YZ8A 5DK0B 2V9TA 1R3HA 3DOSA 3OWRA 2ZUXA 1T04B 4ELME 1J05A 2Y36H 4UT6H 1KCUH 2JKSA 3SKOA 1LE5B 4JANB 5CBAB 2ZX9A 3QE5A 2F53A 4NNXB 5G5DA 2AQ3A 4GXVH 3QQ4A 3P4MB 3H54A 3QIBA 1OT1A 1HH9A 5AVTB 5TK4A 2W0KA 3OKMA 3TYGL 2RGSA 2QQLH 1YYML 2V5SA 1MN4A 1U4EA 4V2BA 3GLEA 1QSZA 3RWEA 4K7PY 1E4HA 3K8MA 3RIKA 3H3BC 2XV3A 3IE9A 4LSUH 5LGHH 4LCWB 4OZHB 4P2OB 2HJLA 4B3VA 3KPSB 1Z9LA 4XC3L 5JOFB 2W9DH 4PLKD 5D7IB 4AUJA 5EZLB 4E0RB 1DBJL 2C4FU 3QH3B 3AT0A 4G6FD 1MI5B 2P5ED 4GMSL 4O02L 3TBSA 2PW2B 2KPNA 3G5XA 2Q3ZA 2VM4A 4JR9L 5DUBB 5HGBB 1USZA 2VE6A 5DC2A 4HFUL 3A22A 3MA9H 3LKQA 1ZE3H 2QHRH 2CMRL 4ZRGA 3K8LA 4DO4A 3CSFA 2IQAA 3ML8A 2EXTA 1KBGL 2NNXA 3VGAC 1N6VA 2P48B 3GEWB 6TAAA 4PV8B 4G7YL 4JHWH 1XH2A 4P2QD 4V1DA 4C59B 3POHA 1C08A 1AO7E 1OAYL 3VGEA 5IVNA 4XVUC 5PCYA 3U9PH 2ZKYA 4FYQA 3QQNA 1PNCA 2YBRA 3HB3C 3DX9B 4F7CB 1U3ZA 4WNQA 2QTEA 1KIPA 3WIHA 3EYSH 4GRWE 3EOAB 3VWKC 2PYEB 4YDNA 2X4NB 3OAUL 3RGVD 5I15L 3WAJA 5IJKA 3MRBB 3MRLB 1I1AC 1WFOA 1ZA3B 1X9LA 4B50A 2DWEB 3STZA 4U1KB 1QBLL 1EXHA 3WTWA 3RDTA 3DX6B 5IV2B 3MLZH 2DQJH 1WD8A 4OGZA 5IMOB 4MDJA 1AIFA 1N68A 2F74A 2WMPB 4HW6A 3TU6A 5I6XC 2WO4A 3T3PB 1WFIA 1QACA 4KK6D 4K8RL 4QRUB 2W9DL 4OJYA 1JUFB 3UJTH 4WW2B 4TNVF 1DBJH 1ZDSA 2W94A 4AGLA 1Y18B 2BIQA 4MA8L 4WWKD 4XO3A 5LXGH 5GHWH 1T5WA 5TH2A 5TTRA 3BPLC 3BI9X 1T5WB 5TH2B 2GTWB 2H2PD 3DPBA 3BVVA 2LU4A 1MFCH 4P57B 3VI3F 1VGKA 4QF1A 4P5TC 3OKEA 5DZJA 2OMUB 5DHEA 5IK3B 2AJZB 2WXPA 4GP4B 4FQXB 3H9HB 5IQLA 4CMMB 4P59H 1T0MA 4DP6X 3DV4A 1EQWA 2E3VA 2Z31A 5HHNB 1SRDA 4L2YA 5I2IA 2ZX6A 3O3DB 2E9JA 5D93B 1FPTH 2DJ4A 2HLFC 1CBVH 1M9SA 1TZAA 3T2NL 5FM4A 2BHUA 1X6NA 3WY3A 1A6WL 1QTSA 3MYJB 4WGKA 1FO0B 4LHUG 4LGPB 4FP8H 4KRMB 1JFQH 4WTXA 5D1QC 1ZHKB 2HH0L 2VTFA 3MRBA 3MRLA 2VXSL 1P5UC 2EH7L 5DD3H 4NZRH 4YDLB 1HNYA 2B3RA 2MCG1 4OBSA 1XB3A 4MD0B 4I2XB 3RA7H 3VXSD 3ZE1B 1JTPA 2CJUL 3ARFD 1JWUA 3GF8A 3KW8A 2NQDA 4Y5VC 5I5JA 5C0GA 4PRDB 3DYOA 2BNQA 1Y6NR 3IJHB 1A9VA 1AJ7L 3TA4D 5C0GB 2DBLH 1DSFH 4M56A 3TIDA 5JZ7C 4FFVD 4HDIB 4IJ3B 5KJ7E 1LWHA 2Y24A 3FSAA 4KXDA 4HAGA 3I74A 4HZLA 5KVFE 1P4LB 1OT4A 4LAQH 3ILDA 1ZLWH 5KVDL 4LOFA 1MCEA 1PCXA 3PJSB 3HBGA 4BELD 1ZHNB 2ENQA 3CGTA 4Y4FA 2X4SB 1E7VA 4N25A 4XXDB 4FRWA 4NUGL 1WIUA 3C6LC 3SJVE 2AJXH 4MA7L 3OF6A 4Y5XB 3ZN6A 4MS8C 1GOHA 2VH5L 5D1XA 5B3SB 2HVJB 1LDPH 4KJWC 4DGIH 1T1XA 3SPCA 5GS0H 4YDZA 3T6VA 2AJZA 3SDYH 4O2CB 2XTSA 4NBYB 5MI0B 2CBPA 3UDWA 2O6FA 1OHZA 1ZRUA 5DQDH 1I31A 4ZOBA 1S9YB 4NN7C 2BIMA 1BFVL 3MJ9A 2F7IA 3MLTA 5CO1A 3TH3T 5HDLA 3MMEB 5E2UH 2W80C 3ZIYA 1I53A 1A6WH 3VXUD 2ZXAA 2IAMC 3P3UA 3FRUA 4JCMA 4M03A 2OL3B 2EDYA 5B38G 1U33A 3BD4A 1WFNA 2UUDH 3VFRB 4ICWA 2DIAA 2KQMA 1WD9A 4NUPA 1U6AL 1E9QB 1FSKB 3KYMB 3HG1D 3KGTA 1G6VK 2YD3A 4G11A 5F7YC 4HS6A 4OZ4A 1H3TA 2VDKL 2VLKA 5BZWB 3V2AR 1NLBH 4FABH 4F33A 4YS4A 1DSFL 5CXPA 3RYMA 1N2RA 2IH9A 5KANI 2D8KA 4F9LC 1UT9A 4N2OA 3E8VA 3BZ4B 3ISRA 4J3OG 5L2KA 4UM9A 3F01A 5I0WA 2FR4A 3R06A 4Q97A 4R97C 4HIEA 4XBGA 3UZQB 1O5DT 2WGXA 3MRMB 2GTWA 1G9EA 1NC2A 4LSUL 2R8SH 2JJTC 1IVTA 1WZ1L 5HI3C 3TV8A 4BK5A 5IJVA 3G6AA 4AQ1A 4C4KO 1TVDA 4IRSB 1E4XI 4XC3H 1C9SA 4UDUA 3SGKC 1KJ2A 4XP9L 5LBVA 1CDGA 5DFVD 3D39E 4IU2A 5JHLH 1NGQH 2AQTA 4M61B 1OPGL 4JCWA 5DVLA 3WLWC 1SEQL 3WN5A 1A64A 2FX9H 5D7IF 1LQSR 5L4MA 2CUMA 3C8HA 5AVWB 4LL1A 4NKOB 1FWXA 3H9ZA 3I02A 1T03H 2X4OA 4MKMA 2TRHA 3U30B 4ONFL 3NCEB 1MHCA 3DETD 2QTVA 3K5SA 1AD0B 3NJXA 2JIXB 3GZQA 1NDMB 3WIAA 2DQUL 1HQRA 1V5JA 2DKSA 2F19H 1XGRB 4P3CH 2EDDA 4NI3A 2RFXB 4PJEE 5K59F 3N2JA 4P9HC 4YPGB 5GGTH 5HGHA 5JPNC 3JV5A 4PRHD 4WNSA 2R0WL 3JSSA 3CDYA 5IESH 4NQDD 1ZPLA 1KUMA 1QKZL 3HAEB 3NZUA 1MCIA 4BWTA 4FEMA 3HAEA 3K6IA 2JKNA 4KBPA 4NX0A 1XDTT 1BJ8A 5KAQG 2C3VA 4P5TD 5CF3A 1ZGLA 3MBXH 4PJCA 4FI8A 4X5XA 2R8SL 4Z0XA 3QXTA 3B2VH 1E3XA 2VDPL 3HCVB 1WISA 1DJZA 3H9SE 3VRIB 4JY6A 4KZDL 2NXZB 3IFPA 2MEJB 2FD6H 1FFPA 3MZGB 4N0FA 2VWEE 4L8BB 3OAZH 2GJ6A 1HDMB 4MA8H 5F7HA 2CLRA 3T0DA 4MKTA 5IVZA 6FABL 4Q0XH 2NSQA 5B1AB 5E6ID 4FTVD 3AS0A 5I1DB 3U7AA 3WNPA 4B9GA 3WN5B 1MF2H 3CXHK 5FA4A 2F0CA 4HGKC 4MD5B 5DRWB 3D12B 3GJFK 3US0A 2AEOA 2VLLA 2XN0A 3QUYD 2KL6A 4FJ6A 3HPJB 2VO8A 1T1WB 1TJHL 3V0EA 2V6HA 5IMKB 2EXSA 2F19L 3MRRB 4LDLB 1JZ5A 4ZTOH 3VA2C 4YSAA 3QJHA 4F7MB 1JGUH 4TV3A 2XBTA 4WHTB 1JNNL 4ZODA 4ZFOA 4FLSA 3QJHB 4EOWH 4JO4H 3JWNE 4UT9H 2ITCA 4HIXH 4M62H 1BZ9A 5JW5B 1IAMA 5AB2A 4OLEA 2KHAA 4NO3B 2OAAA 1A6UL 4P46B 1RZIB 2JB6A 4YSSA 3T3MB 3BZEB 1SHXA 5ANMB 1BX2B 1FBIL 4DP7X 2A1WL 2VDQB 4H20H 5E4OA 4OGYH 1UADC 3GJFA 3FULA 5CUSH 4JO2L 1PQZB 3VH8B 2Q5BA 2WWKT 1DR9A 1OTUD 5D1ZD 1CD1A 4LRIA 4B9JA 2A6KB 4BH8B 4FTVA 4Z7QE 4ZMWA 3IBOA 5L88H 5EEXA 2EUZA 1I8IB 1JSYA 4NQUA 1I7ZB 1FN4B 1PD6A 5CSBA 4DIXA 2ESVE 1N6UA 2H0PA 4DQOL 3H56A 4N1EA 2VWEC 3O6FB 1E28A 2P8LA 4EBQH 4MJIA 3REWB 1EIBA 5FK9A 3BCFA 4ODVL 4LAQL 3Q43A 5F9AC 1S5IL 1YMMB 4OKVA 2XQ0A 1U3NA 4JFDD 1U58A 2HJKA 1UXMA 4BK8A 5M94B 3D0AA 3D4GA 1ZV9A 1DCEA 2EYSA 4OZGA 5FA4B 5CIPA 1ZGLM 2RJMA 4I4WA 4OZGB 1D5BB 4P3DB 3QNXA 4QGTA 5I18H 3U0WH 3DX1A 1S9VB 3QP3A 4S1DD 4RX4D 5A3ID 3H0TB 4OD3H 1JGUL 4IKKA 2MPAL 2OMZB 2WNKA 1LD9A 5EF2A 4N2GA 4QYOB 4X4YA 1G1OA 2DB8A 2R69A 3KHOA 3LZLA 1CQYA 4NPYB 4UT9L 4HIXL 2VDPB 1UUSA 3Q9PA 2QVFB 2N01B 2NUPB 5DQDL 3GUTB 1GZPA 3E1F1 3MLRL 1JPSH 4FNRA 1UA6H 1NM9A 1UGKA 2OZ4L 2XG4A 3D6GA 3UG3A 1J5IA 3L1OL 1HHGB 2BDNL 3D48R 1SN2A 1D5ZA 4BWWA 4ZNCD 2X7LB 4Z77B 3MRFA 2B15A 4XNQA 4PLJC 4V1DD 1OAZH 4NHUB 4LPUA 4FQ2L 2GTZB 2EKSA 1B9ZA 1MUJA 2AJ3A 3HFFA 2CO4A 4XX1G 5CSZA 2FB4H 2LTQB 1A4JA 3C6LD 2B8OT 1H8LA 3Q6FA 5CN1A 3N1FC 2MQ3A 1WS7A 1NLBL 2C26A 2QGEA 3ESNA 3EYFA 4IEFB 4MXVF 5ALCL 7FABH 4ZJ9A 4Q9QH 2HVKB 2D3LA 2QGDA 1RP8A 2Q7AA 3NJNA 2OL3L 4GQ9H 1E27A 2B5IB 4KKNA 1UACL 3AM8A 4N0RA 2BM3A 1JGLH 3QIUA 2IGFL 3QPQD 4HXBH 4LF3B 1YEHH 1J0IA 4OLVL 3FHEA 4YDIL 3WEOA 5AKRA 3RVTD 1CXKA 4MDIB 4EPSA 3O4LB 4PMFA 3L3JA 1B4RA 5D96B 1HXKA 2AMGA 2J1KA 3VXOB 3LSOA 2R4RH 4K23H 1EGJL 4X6DA 1T0OA 2BVYA 3QIBD 2GC4C 5C09E 4KJYB 4KDWA 4LT7A 5GGTA 3KS0J 1CE6A 3PL6A 4OVVA 4W9CC 5B7FA 2WUCH 4ORZC 4MMXB 4QUOA 1N8ZA 3K72B 3IDNB 1IGCH 1OPGH 5AVQB 4MMXA 3WEBA 4A2MA 1LDSA 2J6EA 5GS3A 3NPSB 5AVUB 4EEEA 2RB8A 5ACZA 2CA4A 4XMKH 2KS0A 1QWUA 4XXWA 5GPRA 3HPLA 5TDPB 2TSBA 4G8AC 4CAGA 5DJ8A 2IPTL 2JB5H 4PJ7E 5IVXE 5FXCH 3SKMB 5DRNA 3WDIA 2DJSA 4F92B 5IMMA 4FQLH 2DQUH 2OP4L 4I89A 2BJMH 1WEJH 2VUKA 3GS0A 1CLCA 2YN5A 3ZDYB 1JYVA 3MA9L 3ZT6A 1L0XA 2QHRL 3A47A 4KRPC 1Y1UA 4OUUA 2XZAL 1M3IA 2WLZA 4WGVB 2CMRH 3GJEA 3IDYC 4PJ8C 1YUHA 4NKQB 1VGEH 3EBAA 5DRXB 4ELMB 2IVFC 2VW6A 2DJMA 4JFED 5HHXH 1URLA 2XN1A 3EYFB 3OPZH 5KBPA 3KJ6L 3MUHL 3UGUA 4LIQE 3UP1A 4HXBL 4AYFB 3PHQB 3PWVB 1Q90A 3HAEG 3V0FA 3BWAB 3BZDA 4M4RA 5E8PB 4WY7L 1ODAA 1U3JA 4AVHA 5I1LA 1HYSD 5IM7B 3FUMA 1VA9A 2Q8BL 2V2XB 2IGLA 3D18B 2O93L 4Z8FL 5K1NA 1KB3A 3DOHA 2NRDA 3QUZB 2A0LD 1UOKA 4PV8A 4LCWE 5CNHA 1DO5A 1FNHA 1QBLH 4F9PA 2WUCL 1U8OB 1FQ9C 3QJVB 3KPSE 2BZCA 4PG9B 2A6DA 4G1EA 1I7TB 4XMKL 1JWSA 5C07E 1I7TA 2FJFB 5T1JA 2HX7A 1U41A 4G8FB 2PW1B 1UD3A 3VGDA 1BP3B 2MQCA 1F5WA 5H2BB 4I5BA 1DE4B 5C0EB 2EUXA 2OP4H 5H94A 1QA9B 1AZZC 1C12A 4X6CE 1J1OH 2WXOA 2FBRA 5HD8D 4N8PA 4TVPE 4AGOA 2FZ3B 3TLRA 3GRWA 2VW7A 4PP1C 3ZL4H 4CJ1A 5EORL 4N28A 2NZ1A 2FBJL 2FJHB 3SODB 3UTTB 5KVEE 2EO7A 1C5CL 4Y88A 4JUSA 1WZLA 1NAMB 2KZ1B 3FH7A 3V0JA 1IGMH 5IB2A 4ZXBD 2B20A 5C09A 3RVVC 3RX5A 3QQ9D 2B3IA 4BFJA 5EIIG 4L05A 4J3WA 2PF6A 1ZTXE 4WY7H 4QRRE 1MFBH 4PJBF 2A73A 3BHBA 1A3QA 2A6IB 2PW2A 4OR1A 3RNQB 3O4LA 1DJYA 3EFFA 3LOWA 2R23B 4OLUL 4ENZA 4WWKA 3BZFB 1PZ5B 3RWHA 1HCVA 4FP8L 2D03L 3OG6B 4FLQA 3VD3A 3AWGA 1TT6A 4U1MB 4U6HB 2RAMA 2G5RA 4JFXA 4N9GA 3MUJA 5IGXL 3D3VB 1NCWH 5AOJA 1Z5HA 1I8AA 2NY1D 2XYCA 3CN0A 4OQTH 3FCSA 4JM2D 1INQB 5GGUB 1X5GA 2YGPA 2GKIA 4LDCA 4UI2A 1A4AA 4WNQB 4OZHE 5TDPA 3SJVA 1ROCA 2MPAH 3L3OA 4GQZA 5FO7B 3UEZA 4HLEA 1FA4A 1AO7D 2MCPL 2GEQA 4ZX3A 1LEKA 2PYEA 1IEBB 3UBXA 5D7JD 5KVDH 3IU3A 2YZ1A 2PXYD 1YLBB 1E4WH 3S8FB 2YRBA 4QHKI 5GQBA 4MNQD 3STLB 4QXUL 4NUJB 4DT2A 1XMWA 2LLGA 4HF5H 4MA7H 1HHHB 4A7TA 2X9ZA 3TYFB 3TVMD 3L4VA 3P9MB 4QKTA 3WKYA 1KGCE 4FQIL 3ESOA 1L0QA 1RU9H 2CO6A 4LP4A 4LXFA 3MRQB 1A1OA 3K6DA 1AS8A 1RMFL 3GTVA 3M07A 4WHCA 3SGDH 4E42A 5FB8A 4NJ9H 3AW5A 4JFFB 4QRPD 5IKCB 4GW4B 4AVJA 4XO9A 1P7QD 3HRZB 3S97C 5LDUA 1CL7L 2HWZL 3QAZC 5D7JB 3V7MA 2WKOA 3MNZB 3TJEL 3VFSB 2P5EA 3DXAE 4G42B 2HKFH 4WWPA 2AK1H 5IEHB 4XGZA 1J5OH 3CBKB 3JVGC 3OJMB 1GYWA 1EV2E 3KH4A 3V6ZB 4MQXC 1VJSA 4WWKB 4WTZA 2ZYIA 2ZSVA 2V17H 3LN4A 3ULVH 1NCDH 1T1XB 2Y69B 5C6WH 3QUZA 2H9GB 3B9DA 4L4VE 4P9HH 5EIQA 5J89A 2NXYD 5KYXB 5EBWB 4PRAA 5D7SL 3VGAB 1A7PL 1KXQE 1N3NB 5IB1A 3VMPA 3TFKD 3QRGL 2P8MA 4JPWH 5HJ3B 3GSRA 5D96C 4GUOA 4N8UA 4QOKB 4E68A 2XPZA 3M46A 4FG4A 4AV0A 3WIHH 3EH5B 4OZHF 3EGDB 2EE3A 5IQNA 1R5VB 1D7FA 4MX7A 1L9NA 1DVFD 2QT6A 4R7NA 2RR3A 5GGSB 3ESVF 1HEZB 1J8HA 2GUOA 3FONA 4WUUD 4OM1H 4NQVB 1IGCL 3F85A 4LB8A 5EZPA 4DCQA 3FQ2A 3FTGA 1X9RA 3HC4L 2KZKA 2RFXA 2W07B 4OSUL 5I6KA 3HNTL 5IV2A 5I1EH 1CLZL 2DQFA 3I6LD 5E9DB 4XP9H 3ZE0F 1LO0L 3SDAB 3F7RA 2FX8L 4HBCH 4AL8H 1RMFH 1LK3L 4AITA 1YPZE 2IC2A 1OW0C 4NJ9L 3KPRB 4NQEB 1FYTB 5FM8A 4ZYKA 1H6FA 3LD8B 3B3BA 3K81A 2NY3C 1CL7H 2RHEA 4JO5A 2HFEB 3S4SB 3GXMA 3UIZA 3LB6D 3L3DB 2XZAH 1JZ4A 4X5RA 5F1KC 3VSTA 3RX8A 3PIQB 2M1KA 3S8GB 1BYNA 4ETYA 1U8NB 1MCQA 3DJSA 4AEIH 5E99H 3BUYA 1S9KC 1ZVYA 2IIJA 3O2VH 3TEZA 4FGMA 3TIEA 3BLKA 4JKMA 4Y4KB 5FA3A 4P99A 5H37H 3TEWA 4J4PD 2ETWA 4D9RD 1JZ6A 2OMUA 1F1GA 3VFGL 5CMAB 4ANVA 1HOEA 1E5BA 3NCJH 4X7DC 4PWGA 3VD7A 2J8UF 3ABMB 3ZSTA 2JKXA 2C7FA 3KPNA 3O6ML 1XF2A 3BPLB 3U2SA 4Q6IB 4X99B 2JKRM 4NOBA 1EHLH 2IAAC 4QJ3B 4ZNEA 4XWGL 4QRTA 3BP6A 1SY6A 3KYKL 3QCUH 4OF0A 4MHHI 3ATAA 1P7BA 2BP0B 5B21A 5I71B 5EPMB 5E2JA 1YEKH 1BQSA 3EFDH 5FCUH 3EDJA 3CCHB 3D39B 4GFTB 2AXHA 2BSRB 1L9QA 5I6MA 4BCZA 1QSFA 1XH1A 3N43F 3QUYB 3EGSA 4AC4A 1JV2A 1JHKH 3H4FA 4GKOA 4E9XA 3CZSA 5K1VA 2QHLA 2GIMA 2VRKA 2BSCA 3IFOA 4I18C 1CLVA 4Q0XL 4U0QB 1SPDA 5CBEA 4P2YA 1XR8B 4E42B 5FB8B 5J3HD 5DU7A 3G9AB 3RWFA 1PD0A 1L7IL 4BH7A 4HIHB 3UTPE 4FYSA 5C97A 3LPGA 1MY7A 3ALXA 3MVSA 4ZBJA 3SY0B 3O6FC 1NCBH 1QVOB 4L0ZA 3QDJD 4PH8A 3P0GB 1AGEB 5B3JE 5E6SB 1N18A 4JPVL 1JZJA 3OXSB 4E5XB 4M62L 1QLFA 2Z7YA 4WDIB 4WK2B 1CGXA 4NDMA 5CWSB 2XTJB 3QT2A 5M7QA 1U93A 3OAUH 1P7QB 5D2NA 3LKOB 3ZE1F 1XF2B 2F58H 3HW7A 3LKRA 5JOEA 4APQA 5BS0E 4JFQB 2EC9U 2XWDA 5FKAB 5C7XH 2X88A 4A39A 4HUVA 4F2ME 4IBWA 4XXCC 1T0NB 2H3KA 4IGBC 4KZEH 3GKZA 4GIPD 3LN9A 3E9UA 5SWSA 3OQ3B 4XNYL 1WWWX 1DANU 3LPFA 4XMUA 4A2HA 1QUPA 4G3YH 4WK4B 1KYOJ 5SX4I 2ZKMX 2A7BA 2VMDA 1AGDA 4HC1H 4XWOD 4RDBA 2VXVL 5DFTA 2APSA 2GW5A 4HD5A 4JVUA 3TH2T 1T3FA 2ZOLB 3HI6H 3HB3D 3BEWA 1L9RA 4LP5A 2YXWA 4YDMA 2D3JA 1H6EA 4U1LB 5FCSH 2VM3A 4PY8I 3MRHA 2WZ0A 4YBLC 5D4HA 1MFEL 3NG5A 2A4CA 1AHMA 1R3JA 1I7UB 2K4AA 4U05A 4PJCB 1NGZA 1A1NB 3DI2B 1AQDB 4X5XB 3RPKA 1FGVH 3S35L 1RU9L 2QSTA 3DSNA 3CN3A 3FH5A 3BSZL 3VFPB 3L4YA 3OMIB 3BT0A 3MLWL 3NUKA 3LQZB 3MLRH 5ICZA 2QKIA 2QLYA 2ZCHL 4BFGA 3VM7A 1S7UA 2NTFA 4N3UA 5E00A 4Q9BA 3X13B 3EOBB 3EKCA 5I1DA 1JFQL 2EYRB 4Z7QB 1GW6A 3HHRB 5DD3L 1EEYA 2EDOA 4XVTL 3WFBL 3CH8A 3V6OE 4NKOA 4KKRA 4TNWF 1WT5A 1ZOXA 2F7QA 1CE6B 3BRDA 1KCUL 5C08E 3RU8H 2CJUH 4NPYA 3HC0B 3QNZB 2BOBB 3ZDXF 3IJ8A 3QRGH 1DLFH 1CDIA 2MNJB 5SWSB 4XCYA 1NUGA 3K2IA 2OMNA 2Z91B 4KFZC 4G70B 2BS71 4AUUA 1MAKA 2IH1B 2OJZH 3CXHJ 3L3GA 3WIHL 4DZBB 1RUQL 5JQIB 5DF0A 4PIRF 4HOMA 3DHMA 1MRCH 3L3GB 4URTB 4HPHA 1X4ZA 5A1AA 1AXSB 4H5SA 4OLVH 4YDIH 2AKRA 4LZKA 4NUMA 5DJDA 1XCQA 2X1XR 1PMYA 2RD0A 3C60B 5LGKA 5J06A 1D9KA 4K3EL 1R75A 3B7YA 4XVJH 1SLUA 1NMBH 4Z3TA 4AE1A 4PVLA 1KWKA 4Y19B 4NFCA 3RGVA 2X6AA 5I6LA 1MW0A 1ECYA 1LK3H 1YO4A 5HPMB 3HZYB 4PJ5A 2YGNA 2VSCA 3WV0A 1ZLSL 1HOCB 4AIZA 5AWNH 5CLYA 2QKSA 5HYJA 4N2BA 1AGEA 2DWYA 3Q1EA 1Q0EA 3ARXA 1AXTH 4GRLD 1OP5H 3TZVB 4J3OD 5BRZB 2G5BB 4N6RA 4GSRA 2JB5L 3LKNA 5E9AA 3MACH 4FXLA 4FQLL 4AQEB 1K72A 2FQFA 4A6YL 1PZCA 4LIQH 5HDRA 3GI8L 5C71A 3IGAA 2X40A 5EA0H 3RU8L 3ARYA 4S2SB 1B0RB 1E50A 1I85A 3IGAB 2ZWZA 4AYID 5KG9B 4UILL 3NJMA 1A3RL 1CPUA 2CSPA 4IU3B 1ZS2A 4FABL 3GBMH 3L4TA 3WKNA 1LWRA 5AG8A 2YAHA 1AG6A 2R2HB 2VCOA 3L4CA 3EJQA 4KOBA 1TO5A 3AU1B 4JE4B 2EIEA 3PAUA 4JM2A 4CBPA 3AJ7A 1AI1H 4U2ZA 3QDMD 4OFQA 4PQXA 2V7NB 4TUKH 3APMA 1HTYA 1NANI 4R4FH 3UH8A 2BNQE 2GIXA 4ZAKC 4NXKA 2QFPA 1DP0A 3A6OA 3OLGA 4RFEA 2V9QA 3V4VH 3FT4A 2FSDA 1U8MB 1Q9WA 3ZMNA 4UQBA 3KYNB 4LARL 3NCXA 1W15A 2Y7LA 2GI0A 4AZ8B 3AACA 1QR1A 3TURA 2V7HB 2BNRA 2Z8WC 2ZF9A 4AIOA 1QR1B 3UBFA 1D5MB 4IBYA 3Q6FB 2C9UA 3U4EB 1TFPA 4GAGH 3I9GL 3NK4A 2YKLH 5A2LH 3N43B 5AWNL 1S7WB 4WFGD 3RBGA 5T1KD 1UTDA 4J3OF 5JPMA 2VR6A 4GNKB 4AIZB 4D3CH 1BA9A 4NRYB 1WGOA 3V4PH 2GYSA 4W9ZA 4E9WA 1JXFA 4I48B 4DO5A 2NXYC 3MRCB 5F7FA 3RY4A 5FYLL 1NAKH 4BINA 3FQTB 4GI8A 3VYNA 3V0HA 3FTYA 1KG0A 2V3FA 5ERWB 5H4ZA 1U8OA 5GGTL 5H35B 1CUOA 4Z76A 4K15A 1WA2X 3PWPE 1FPTL 2R0WH 3GMNB 3KS0H 2CBMA 3AWFA 2OMZA 3EJRA 3SBWA 5T1KB 3U25A 1KYAA 3GMOB 2DD8L 4LFHG 2NYKA 4JFPB 5ITFB 1AQ8A 4YNYB 2F58L 3ZTDC 2O6DA 3TN0B 3OF6D 3KPMB 4WI0A 1YNTF 3GHBH 3EYOA 3UTZB 3D39D 4B9CA 5HHPA 3GLAA 3BKYL 4YK4B 2GPZA 3UC0L 1H5BC 3OSVA 5EC1B 4IDLA 4GRLB 3TZVD 3GRWL 3U0TB 3QRFM 2NZ9D 2NX5D 4LNRA 1UOVA 5FX3A 3WUWA 5HJDA 2FD6L 4OLUH 1MCBA 4L9LB 3R8BB 3KPLA 4EI6A 4LEOA 3SKNB 2V7HA 4GSDH 4GAGL 4OZGF 5KYUB 5IGXH 5GGRY 3RWCB 4M29A 2MWCA 1SQMA 2SODB 2OQJB 4GSUA 5GRZA 3WO3B 1J8SA 1SUJA 1N7ML 3O9WD 3PWLA 3OC8A 1BYPA 3BAYA 2GB2A 4PJDB 4YLBA 5DVNA 3RIFF 3T0EC 3TBSB 3CDFA 4X9HA 5FW7A 3KDMA 2X4PB 1JZGA 1X7QA 3OGOE 3ILPA 5GSRA 3K91A 1M42A 2R69H 3KDMB 1OSZB 2AEQH 3QO1B 4N0CC 3LXUX 2XV2A 3RVWC 4L8SB 3BP7A 1OE1A 1GZQB 4GRWH 1T7ZA 5CCKL 2IOMA 4EOWL 4JM0A 1B2WL 1GA2A 1AYOA 3S36H 5IK3A 3SPVA 1BBJB 1B6UA 1EFXD 4ODXA 3ULSA 4AYDC 3UPRB 4DKAA 4UZGA 1BFVH 4QXUH 5HI5D 2J2ZA 2WWMD 5DD1H 3UC2A 3ZDYE 3QZNA 3PV7A 2VDLL 5HGDB 4YXHL 1FBIH 3EO9H 2FLMA 3DO3A 3V4PA 3ZK0A 3J7HA 5CP7A 1CTOA 1SHMA 4XNZB 3BKYH 4PJEA 4IMLB 2MOQA 1RK1B 3WFBH 4XX1E 3I75A 3UC0H 3K6SB 2E59A 2JJWA 1F6AA 2APVA 4X8JB 1L4IA 1J0KA 4XVSH 5E8EB 2AFNA 4PBVC 4Z7QF 3FT2A 4YQXH 4GQPH 3EYVB 3X1FA 4DQAA 1IE4A 1DLFL 3TCTA 1DFBH 4WJKB 2HXAA 1FDLL 4MDJB 4XAKE 2P45B 1KCSL 4EBQL 3ULVL 4P9HL 3EDKA 4ODVH 5AW9B 1ZSDA 4OZIB 4LCYA 1VF5C 1FYTD 1XF3A 3RB5A 1LEGA 1BAGA 3QDME 4X9YA 3CFKA 3NCFB 3PWLB 3FFCE 2Y2WA 1DSWA 3LV3B 4G80B 2EXYC 4ZTPL 3WG7B 3LJ3A 1G9ML 3O2DA 1BHGA 5D2LE 3BVNB 2EEBA 1V8HA 4JN1H 4NO5A 4CW1A 1VIWA 2QSVA 1IQWL 4M48H 4QF1B 1FNSH 3O8XA 1NOAA 4M9PA 5DS8A 5J12B 3MJ8A 2XVBA 4AJVA 3G6DH 3HFMH 5D7IE 3UTSA 3FF7A 5L4IA 3U1SH 3H3PH 2OZ4H 2UZXA 1BBJA 1DQJB 3DK0A 1KDJA 2NTSP 3GSVA 3NAAH 4P5KB 3TCLB 2HT3C 4CGTA 5KBLA 2UZXB 2IWGA 5I1EL 1MWAB 2AVFA 5DRZA 1TTCA 4AK1A 3OR6A 1TTRA 3MV8E 4N26A 1U2YA 2BH0A 2JVUA 2XJLA 3ALPA 1SLWA 3ETBJ 4NSKB 2O26U 3UOAB 1OZTG 2ZWNA 5F1OB 1SBBA 3C8KB 1WF5A 4P3CL 4P05A 2ZOWA 3MCLH 4XVSL 1NFIB 2PABA 2UYLB 5DJXB 3GKWL 2I9LA 5ECJE 4GFXA 4MWFA 4Z7VB 4UILH 3Q7JA 4LL9A 3EFOA 3GGWB 1NBCA 2YQ2A 3QUYC 3SDXB 2VZSA 3F65A 2O6CA 5AW6B 4M5YL 4MNHA 2X4QB 1AD9B 5DR5H 5FEBA 4QLRA 2UV3A 2X1WL 2GSMB 4G7QB 2CRYA 2VDQH 3EBHA 5C92A 3QCTH 4HPYH 4LPCA 3EGXB 4GRWB 5IMOA 3QFJA 4QOKE 3HNVH 4EVNB 1FNEB 1KZYA 4CILA 2OW7A 1YY8A 4CA4A 3P9MA 3TBCA 3OAYK 3TIDB 1NC4D 4I87A 1IAKB 1BQLL 1L9MA 4D7PA 2VDPH 4GSQA 2CUAA 3VFNB 1P69B 3NFNB 4R8WH 3QPXH 1H5BB 3P9WB 4JN1L 1YQVH 2HFFA 3DVGA 1W8NA 1S7TA 4N86A 1U8NA 3T3PE 3L95B 3J27A 5CHNA 4TNVK 1F58H 3FU8A 5IJVB 2NY4B 3I9GH 4GPVA 2R23A 4KZCA 5F89A 3CFJB 5CR8A 3VG9B 3EFDL 2QQQA 4YGVB 1UZ8B 1UA3A 1UXWA 3KPRE 4LLUA 1E6JH 4EZKA 2IPTH 1WIPA 3CU7A 5ICXB 3ZRFC 5JHLA 2JNZA 3ZQWA 1CC3A 3S2CA 2YGOA 4X7TB 2OMVB 4ZTOL 3I02B 1OO2A 3GKWH 4R7DA 1JNNH 5ALBL 4A68A 3U7YH 3NDYE 1KJMA 2D9QB 4JO4L 2WWOA 3MJ7B 3GMMB 4N8VB 5CKGA 1BCIA 1A6UH 4B7LA 2IANA 2BFVH 1TU2B 2Q20A 4MYWB 5AW5B 5IFJA 3IU3B 3ZE0E 4CVXA 4M7ZB 3SOTA 4RSVA 5CINH 5CEYB 1SJVA 3KYMA 3BQUA 3EJTA 2W65A 3BKMH 1BFSA 3JWDH 4HGMA 1KBBA 4PG2C 5DSCA 2Z7WA 3VYOA 2ATPB 1XCTA 3SPIA 1FNEA 1ZV5A 1CGWA 5D5MA 2DQHH 1E0OB 3MLXL 1MCRA 4FI7A 2WBKA 1JTOA 2JKLA 2W60B 3NFPA 1ANUA 4JZNA 3ARGD 3K6NA 2IALB 2VZ1A 2WYHA 2OX5A 5F1NB 5T3XE 5JHMA 3T08A 4GRLC 3BXNB 1SXBA 2UWEE 3QO0A 1VESA 4HS3B 3UBXI 4QXTB 5JW4M 5MERB 1CGYA 2B59B 3VGBA 1MRFL 2VLMD 4W9GC 4G3YL 1NOLA 3QEQA 2J1YA 4H25B 2V0AA 4WFGE 4KNQA 4UUJA 1UZ8A 4G7RB 4IIZA 2DTML 1I8LC 5IHWA 3U4BL 1MWAA 5DRZB 1QUNA 5HVHB 4APXB 3ZL4L 1DUYA 3V4UL 4ZS7L 1OAKH 4DGWC 3QUXD 5EORH 3U9UA 2ZCLH 4ZXBA 3QXDB 5DEZA 1IGIH 1HL8A 3H42L 3MI6A 5DDHB 5BW7C 3S4SG 3HE7C 2IDUA 3QXDA 1LEIB 1B3JA 3WFEH 2X0VA 1AGBA 3IMSA 1N9PA 5DD1L 1VEPA 3MJ7A 1UA6L 1GW0A 3PQYE 1LQBC 5E5RB 2XQYG 2VDLH 1MLBA 2WZ6A 2ZXBA 3BVDB 4C56D 3MJWA 2BP0A 3CX5K 1WE5A 1BZ9B 3WFHB 1XSOA 5HYFA 1E43A 5E6IB 3IK2A 1GS8A 3BSZH 1O0VA 4HC1A 3GXTA 5B4MD 5C08D 3E38A 5IB5A 2Z1KA 1X7SA 2ZQKA 4YO0A 2ZCHH 5F9JB 3EOYG 3RAJL 1HZHL 4JRYA 2WINA 1V10A 3QXAA 3KPRA 1CVSC 3O3EB 4LOUD 1A2YB 4JG1H 5C0ND 5I76B 2P42B 5KS9E 1N5AB 4M43L 5CN2A 3DTXA 2DBJA 2EC9T 3PNRB 4IOSA 4LLVB 3BIAX 2OL3H 4GQ9L 2A9NL 3C09C 3L3KA 1ICTA 2NYYC 4JFOB 1J88A 2ZUTA 2I9TA 2DICA 4EKJA 1BBDH 2GJ6D 2WD0A 2WJ5A 2W9LA 3ZZ1A 2CAKA 1SUHA 3AU0A 3OC5A 4HJSA 2NY2D 4L8BA 4N0UE 3VXME 4ANXA 1HVXA 3REWA 1FFPB 1XBDA 3QEUA 2WIIB 4ZOEA 4QIRA 2AEPH 1HHKB 1NPNA 4PRIB 3UTPD 4GMTL 5DD5L 1NGWA 4J4PA 4UB0H 5AZUA 4AV5A 2P47B 1SBSH 2MCPH 4FCHA 3PDOA 4N6QA 3AG2B 3QR0A 4DO6A 3IJ9A 3FUJA 4EXPX 1BF5A 1MCHA 1TYEB 1UM5H 3L13A 4J4PC 1NICA 3OV6A 1IGJB 3DVIA 3V5KB 2CDFA 1LD9B 1XAKA 2AABH 5DDHA 1XT5A 3KYOB 1KTBA 2ZX7A 3NJLA 3L5WB 4RAUA 3P3SA 3V10A 3FCTB 3W0WD 4PW4A 2V5YA 4KKZA 3KPOB 3GXIA 3ABGA 2ZT9C 2F8OA 3D0LB 4OFDA 2XRAH 3DIFA 3OB0K 4RMSA 3PV6A 1HHGA 1ZLUK 3X1BA 2M8XA 1ZLSH 4CUCA 1B88A 1KTLA 1OM9A 3AQXA 1HH6A 5DSCB 3GDBA 4TQPA 1TQUA 1D2OA 3TJEH 4GO9A 3SGJA 3Q0HA 1J5OL 2JXMA 2J8UB 4M43H 2EZ0D 2ZYRA 3QJOA 1DEEB 3V4VA 4MZIA 1AG0A 3QFDA 2XSKA 2H1LM 4P06A 3A24A 4Q6KA 4Z7VF 3T0WA 3VFTB 2A9NH 3MRHB 1JXDA 2NY0B 3GI8H 3PL6D 1ZV2A 1R1CA 2Z35A 1BBDL 2EH8H 2D4FA 2WXGA 3MJ9H 4WWNA 4L3EE 2E56A 1YPZA 2XN2A 2ICWJ 2Q8BH 3U9WA 3MRKA 1QLEH 3OKDB 1PX8A 3D3VD 2ATKB 4N0FB 5B7MA 2P8LB 2O5YH 4E9YA 4C54A 2DI8A 1M4KA 5B3JF 1AAJA 3BH9A 2OCFD 1J9RA 4OM1L 4BGLA 4TUKL 5D1ZB 4WEUD 4KMTH 2FGWL 5AW0B 3STBA 1XEUA 4BFIA 2WWKO 2EYRA 3HC4H 4GBXB 4Y19E 5CLXA 2KQNA 3CE1A 4OSUH 3HN5A 4R0LB 4WTWA 2Z0UA 4JRXA 1A65A 4QYAA 4JRYE 5EN2B 5TE4L 3CJJA 1UCBH 4R3SB 3VI3B 3WGVB 4AH2B 5DS1A 2C9SA 4AEFA 5I24A 4MJ4A 1TDQA 3NDZE 5JHDD 2BVEA 4KNSA 4WI0B 4OV5A 1MAJA 4AYSA 4GW5A 4OV5B 4HFUH 5ALBH 5H2BA 4A37A 1V7ML 2ED8A 1UD6A 5TQ0L 1D5ZB 3BMVA 4U6VL 5DCCA 2EDJA 3DPDA 4TL4A 2XG4B 1O6TA 4R4BA 2J4WH 5DD6B 2NW3A 4HKXA 2X2YA 4OT1L 4YO0B 4L3CA 4LNRB 4AEIL 5HYJD 2F7PA 3C5ZA 4JHUA 1NAKL 3QI9B 5ACMA 3UPCA 3O2DH 5FPIA 1FVCA 5E6RB 2EH8L 5C3LD 3WNOA 4P5MA 1R3KA 1LP9A 3MXVH 4WEEA 2HRHA 4NNYB 3JWNH 4H26B 4IBQA 3TBWB 2ORBL 3EYUL 1L0PA 2K6ZA 1U42A 2OSWA 1FC1A 3R7QA 1USQA 5FKPA 3S37L 3MTXA 1IC7L 4Y4FD 2WQXA 3RQ3A 1M05A 1UWXK 3TA3C 2QKIC 3GC3A 5E51A 2VQUA 3MLZL 3IPBA 1S7XA 3ECBA 3VNZA 2X41A 4Z7WF 5IUCA 1YEKL 1IARB 2R29A 3GRWH 5FCUL 2W5PA 4F7EA 5JIQA 3ASNB 1XSKA 3DO7A 3FFDA 2B1OA 1ETB1 2VISB 4YHKH 4JDZB 4WK0B 3V9EA 1FRGH 4L8CA 2X09A 4UQDA 4DAGH 3ZSSA 4H1LH 2WWNA 1GZHA 3C2AH 1SDYA 3LS5H 1U2CA 5HBBA 3D33A 1QZNA 5C1MB 5I1CH 1PYWA 2LOEA 2ZCLL 5C0EA 1MG2C 4DZBA 3CH1A 1UWYA 2OXGA 1OSYA 2HRLA 4RESB 3WFEL 1OSEA 3BUIA 2H6PB 3KE0A 3APDA 4XOBA 1D5RA 2AP2A 1OGTB 2JXMB 4IQHA 4N0YL 2WLLA 5IWLC 3SBQA 3MRNA 3VWJC 1YEGL 5GGQL 3IXAB 1QFPA 3B9EA 1A4JB 2WM0A 4P4KC 4PWKA 3ZL2A 1A8ZA 3VQ1C 4RWYL 1MLCB 5D4JA 1SF5A 2GSIA 4ZUUA 2HWZH 3UACA 5D71H 4IDJH 1BFTA 1CG9A 3S37H 4AM0A 2E9WA 2H6UA 3T0VA 2E75C 2XNAB 3U46A 5E8PA 5T3ZL 2VC2H 4ATWA 2GJZB 4X9IA 5DJ2A 5JDSA 1MCWM 4O58H 5EN3A 5C0JA 3DPBB 3LCYA 2XG5B 3HG0A 3HG4A 4J7RA 3K4DA 3C6LB 4ZTEA 4XNYH 4GW1B 3UTSB 1TETH 4ETQB 3O81A 2XIIA 1MH5A 4L3ED 2DBLL 2X1PA 2WY3B 3CTTA 4JAMB 5E1AA 1MDAA 4GXVL 2O72A 4HVBA 2Y7NA 3P02A 5J1SC 4L8CB 1PY4A 1QG3A 3T0EE 4F20A 1UB6B 4LPWA 3ZPDA 4JFPA 3H85A 4M6NL 1DUZA 2E7LC 3PAYA 4P5SA 4H88H 4KZ0A 1YEJL 1J0ZA 1LP9E 1JL8A 4HWUA 3P77B 1VZHA 2X4NA 4RGMB 4Y19D 2CKBB 3Q5TA 3P77A 3Q44A 1YN7B 5D1ZC 4RVBA 2P5WB 4HKXB 2WZPA 1F00I 1WITA 1ED3A 1UXLA 2JI1A 5I1HH 1ZK9A 4P4RB 4UQ9A 2HTLC 3PABA 5IHZA 2GCYA 2V3DA 5JOPD 1HHHA 1TLKA 4JR9H 1XHHA 3G6DL 3HFML 3QXUA 4B96A 5CGMA 4AGQA 4AQAA 1YEEL 5AUMB 4ZW7A 3U1QA 4M5TA 3QZOA 4XH2B 4NQEA 4ZYKB 3L8QA 4F2FA 4PFEA 4Z0BH 3MYZA 3W9EA 3CQFA 3CQQA 3T1WA 1XR9B 4Z9KB 3H55A 1VACB 1VAHA 5IHLB 1S7TB 4M4RB 3SDXF 4PG2A 5HYSG 4FXKA 4W9LC 7PCYA 2JKIS 1IC1A 1KV3A 3Q2CA 2FVNA 1XGQA 2HPTA 3ECBB 2XXFA 4GS7B 1SMAA 2G2NA 3I9PA 1RIHH 4QHUA 1UJ3A 4LLDA 4JPIB 1WS8A 1XGTB 1SFHA 3EYSL 4UAOC 3T0ED 4UANA 1DQIA 5KJRL 1U8KA 4ZDHB 1G7QA 1RUQH 3PPEA 4U1MA 1MHHA 4Z7UE 1J5CA 2YJLA 3FCSB 2PP7A 5JNYA 3QUZD 4F5CA 2E0PA 5GS2D 1JPGB 3O3DA 4NZUL 4U0RB 4H88L 2DQJL 3IDGA 2DYPD 2FGWH 3MLTB 3FHQA 3WS6C 3JTBA 5F3BB 1E4XL 1OCZB 1BFOB 2O61B 1Q94B 4BHUA 4ENEC 1EZVY 4V33A 3BO8A 4BZ2H 1YG9A 5F0JB 3Q1SL 4JJOA 2C9QA 1ZE3C 3RLSA 4FXGB 4KV5F 2O6EA 1OGTA 3EYVA 3V8CA 2APWA 4Y5VB 4FG0A 4U4BA 3P4MA 4QHNB 1WA0X 4Y4KC 1AS7A 2DAVA 3AY4C 2YD0A 4W6WB 3P54A 3W0WE 3S5ZA 1YEDB 3M1BA 1UB5A 4BJLA 4BUGA 4P5TB 2YO3A 4NAMA 4HCGA 5BZDA 4UNUA 1MQ8A 5I1GL 2GITA 5AKVA 1UJ3C 1FFOB 1H5BA 3F6JA 4XBMA 4PV9A 1JCKA 1NCBL 4OJCA 3O2DL 3VXRA 1EJ6A 3BD3A 1KIQA 1BVNT 2DLTA 4EMZA 4XGZB 4MD4B 5B38A 2EIZA 3T0AA 4MZRA 4OGXH 3MNZA 3KLKA 3SQOL 5HGBA 3O0LA 4GB9A 3FW6A 3QC5X 4HHGA 4IRSA 4NUQA 4WUKL 4K2UH 5BZZA 2B59A 3MV7D 4X6CA 4AKPA 4RDQF 4WSJA 2DLEA 4Y4HC 3WO4C 4EZJA 5IB1B 2OMWB 1AI1L 1T7VA 2HH0H 4K3HA 2RA1A 4PI0A 4PRAB 5CEZE 3BH4A 3FYEB 2GAZB 3H9HA 4CMMA 5ENWB 2LLNA 3RUGB 3SD2A 1E4XH 5DD0H 2Q10A 3NCCB 3RKDC 3CFDA 4L8SC