4GEOA

P38a map kinase def-pocket penta mutant (m194a, l195a, h228a, i229a, y258a)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
326
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIAANWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDAADQLKLILRLVGTPGAELLKKISSESARNAIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title P38a MAP kinase DEF-pocket penta mutant (M194A, L195A, H228A, I229A, Y258A)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 326
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4geoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4geoA01
1E1XA 4F4PA 1Y6AA 2R3IA 5AV2A 4FSNA 4HOKA 3JXWA 3MJ2A 3KF4A 4FTTA 2YM4A 5M57A 4WBOA 4AG8A 2NRYA 4DFZE 4MK0A 3ZXTA 5HBHA 1DAYA 2PZIA 3O71A 4RMZA 4ZS0A 4PPCA 2HZIA 5J95A 4FTMA 1JKLA 4HNFA 1OKYA 4EQMA 5C01A 3MTFA 1PY5A 3CXWA 4BKJA 3TM0A 1JKKA 2RG6A 2XRWA 3W18A 2QU6A 1L3RE 3FMLA 4RJ4A 2IVSA 3P23A 4WG3A 4ZTHA 4GT5A 5HE2A 4APCA 4F7JA 3EN9A 3UO4A 4A9RA 3W2RA 3FMDA 2A2AA 4FT3A 2R0UA 4QPMA 4X6RA 3VBYA 1FVTA 4IWOA 5M53A 4CKIA 2RFNA 3CPBA 3TG1A 5LVOA 2XNNA 2RIOA 4G3CA 2VN9A 4KKEA 1R0EA 3C4XA 2R3MA 5DRBA 5AV3A 3SW7A 2XM9A 4FVRA 2XNOA 4V0GA 4JBQA 1EH4A 3UVRA 4IZ7A 5IQFA 3U4WA 4E4MA 3DXQA 4G6OA 4E5AX 3W8QA 1JAMA 4H3BA 4C3PA 4O0XA 3UMXA 1O6YA 1OKVA 3CIKA 2OZAB 4D4VA 2PZ5A 3DZQA 4PTGA 3ZC5A 4RVLA 1B38A 5M51A 1P4OA 2J0MB 4D1ZA 3EJ1A 3IW5A 4G2FA 1GZKA 2VTHA 4HGTA 2VWIA 1R0PA 4JJRA 4NIFA 5AIRA 1W82A 4IVCA 5AUUA 5HZNA 4CG9A 3BE2A 1LPUA 2HIWA 3PXFA 3A4PA 4FIEA 3G0FA 4ZSAA 4ZY6A 3FMNA 2XBAA 4QTCA 3FI4A 3QQGA 1T45A 5F9EA 5HCYA 3G51A 4G3EA 2YM6A 3ZC6A 3BLHA 3BLQA 3UQCA 3BPRA 4I23A 1PXIA 4YHFA 3MVHA 2HXQA 5AX9A 4E4NA 3LJ1A 3QZHA 3VUTA 4V05A 1LUFA 4YZBA 2QHMA 3OBJA 3V5LA 2YJSA 4IX6A 2C6OA 4D4SA 5HX8A 3F2NA 1UNGA 5C4KA 5FXSA 3P4KA 4EOIA 4LUDA 2V55A 4X3FB 2W1CA 3RK7A 3MY5A 3RAWA 3TNPC 5CZIA 1PYXA 2YCFA 1H26A 4BB4A 4FTIA 3G0EA 3QKLA 3MFTA 3Q3BA 2WQEA 4FK3A 3QXOA 4P5ZA 4MBIA 3OCBA 3I6WA 2RL5A 4FTNA 5AA8A 2JDRA 5IMXA 5ACKA 3K54A 4DFLA 2YERA 5GJDA 4UWYA 4HGEA 3BYVA 2OGVA 3GXLA 4RA5A 4TYIA 4GKIA 4B6LA 2X6EA 4WG4A 4XRLA 3VS3A 3W2SA 2Q0NA 3OS3A 4KBCA 5EHLA 1NVRA 5TR6A 1OECA 2GNIA 2VD5A 4X2GA 3O23A 3VUGA 3O0GA 5L2TA 4UMRA 3LVPA 4YP8A 1IA9A 3OVVA 3CEKA 3PXQA 3UE4A 4MD9E 3L9LA 5F4NA 4ZJIA 4IAIA 4G3FA 3EYHA 3RHXA 4B8LA 4RIOA 5AAEA 4E7WA 4NCTC 1G8SA 4W8EA 5CNOA 3PP0A 1KE5A 4D2PA 5JFSA 3DY7A 1ND4A 4YZ9A 5BNJA 2HK5A 4K6ZA 5H2UA 1Y8YA 2Y0AA 3A7JA 3VQUA 4RWLA 4ANMA 4DGNA 2PHKA 2E9VA 2NRUA 3EQIA 4QNAA 2OXDA 5FTQA 4NFMA 4RZWA 3RCJA 1H07A 3FZPA 5GNKA 2X8EA 3HGKA 3QUEA 2XP2A 3I6UA 2XUUA 4MWHA 4PDOA 3I79A 3MFUA 3PUPA 4RC3A 3A7IA 3VRYA 4AA4A 1K9AA 4C59A 4CXAA 4CYJA 3EWHA 2XA4A 4F0GA 3A7HA 1GIJA 2WNTA 3QTXA 5HIBA 4ALWA 1OBGA 1U59A 2XIRA 3BQRA 1QMZA 2XS0A 3W10A 4O7SA 4J96A 2P0CA 3IECA 4B7TA 1PXLA 4FSRA 5EQEA 1QPCA 2QU5A 1P5EA 1WAKA 1NA7A 2GDOA 3DLZA 3FDNA 4FKOA 5CT0A 3GFEA 4D55A 1NW1A 2B9JA 3F3VA 4IXPA 1GNGA 3QLFA 1M2QA 3EN7A 2C0TA 4Y85A 4DTKA 4M69A 2ITUA 4H39A 1ERKA 4AW1A 2OJJA 3EIDA 5I4NA 3ALNA 4X2NA 2RG5A 5AR8A 4ITIA 2QOIA 4QQJA 2WMQA 4MXAA 4GFOA 3HA6A 2ITPA 3LCSA 1I09A 5CVFA 4WD5A 3KXGA 4DLJA 2R3NA 3O17A 4R5YA 1KE7A 3UMWA 3OWJA 3R01A 4CFVA 5GIOE 2JIIA 3HP5A 4IM2A 3I5NA 2JDTA 4XUFA 4MVFA 4YUQA 2WMBA 5AUVA 5L8LA 5D11A 5IISA 4S33A 3PVWA 3LM0A 3QQHA 5HBEA 3D2KA 2GQSA 3D9VA 2OH4A 4KS8A 1M2PA 5AV4A 2UW0A 4EHGA 3DAEA 3MBLA 3PIZA 4AGUA 3DGKA 4HPTE 4U0IA 1M7QA 4Z55A 2CSNA 3ROCA 3DKFA 4W4WA 4J98A 3GU6A 1RQQA 4YJPA 5LARA 4YO6A 4U3ZA 4USEA 3R1QA 2WGJA 4IE9A 2UZBA 1XH4A 3NIEA 4OLIA 5L8JA 4CLIA 1OL2A 2QKWB 3UBDA 4KAOA 1YXXA 1OL6A 5IH5A 5CENA 3KXHA 2OF4A 3KULA 2B54A 3RPRA 4YGAA 4MBJA 4JRNA 1WBOA 3O8UA 3WE4A 4YTCA 4LRJA 1ZZLA 2HW7A 4L46A 1ZYDA 3WIGA 5CAOA 3Q96A 3A62A 5CAQA 3ZH8A 4QTBA 4CV9A 5HO7A 2JDOA 1UNHA 3CY3A 2OICA 5CU2A 5J9YA 3D5XA 2EXCX 1LR4A 1IASA 1A06A 2ITNA 2ZV2A 3KXMA 3GUBA 3P5KA 4IAAA 4IAYA 3L9PA 1MQBA 4A4OA 4YO4A 4U8ZA 4E1ZA 2JIUA 2R5TA 3QGWA 4XCUA 3O8PA 2W1GA 3R30A 2OK1A 4M84A 5DOSA 2W7XA 3BYOA 3OFMA 4H1JA 2VTSA 4KKHA 4L53A 4TPTA 5CAVA 4ASEA 4J52A 3VS5A 5F95A 1TQIA 4EBWA 3PY1A 4JDKA 4I5PA 4F1TA 4YJTA 2PPQA 4OTHA 4GFGA 4ASDA 4HZRA 3R8ZA 4LV8A 4RIWB 3F3TA 2XK3A 5E9EA 4S34A 3OD6X 3THBA 4D1XA 3DBQA 2GMXA 3FYKX 5CASA 1GY3A 4C61A 2WHBA 4OBPA 4AGWA 2B55A 3C5UA 3LXLA 4RIXB 3QTIA 5DH3A 4ENXA 3UO6A 2R3QA 4BYIA 3AC1A 3BQCA 5E1EA 4YC3A 1IAJA 5DMZA 4X0MA 2HY0A 4BC6A 1FVRA 3R22A 1YDSE 4FNZA 4HVSA 1H0WA 2W0JA 3C4FA 3HV3A 3DV3A 4JAJA 2PUNA 3PE2A 3FAAA 4O81A 1QCFA 4EH2A 4GK2A 4MXYA 1W0XC 2ONLC 3FQSA 3W1FA 4YSJA 4FSYA 3G5DA 4MNEB 3HKOA 2X4FA 3PFQA 5DN3A 3CQWA 5HOAA 5AR4A 5ACBC 3KVXA 4RGJA 2UV2A 3PPJA 3E8DA 3ODYX 4F0FA 2XJ0A 5BVFA 3EN4A 2R2PA 3PP1A 1Q8YA 4QMYA 4AZSA 4ASXA 5DHJA 3FE3A 3LMGA 4BF2A 1Z57A 1XH9A 5EYKA 1Y57A 4ITHA 2CNUA 2O8YA 3P79A 3QLGA 2ITZA 4B99A 5EKNA 1BI7A 2GTMA 4DN5A 4PNIA 4XJ0A 2J50A 4DBNA 3DXNA 1RW8A 3R73A 4K11A 3GCQA 4JQEA 4X6QC 1Q3DA 1IAHA 3AQVA 4HYUA 4D2VA 4F1OA 3F5GA 3GCVA 1CSNA 1U54A 1WVYA 4F9WA 3O8TA 3MV5A 1Q5KA 4QQCA 4UWBA 1H0VA 4YBKA 1SMHA 1Y8GA 4C4FA 3ACKA 4OR5A 3OXZA 5KMIA 3RAHA 4XH6A 4NH1A 3EN5A 4FV5A 2BHEA 3F9NA 5C8MA 1XHAA 2C3LA 3RBWA 3D83A 3UC3A 2VNWA 4DH5A 4ACHA 5HI2A 4O0UA 1Q24A 4AW2A 4QTAA 4BTKA 1CM8A 5IA2A 4FOCA 4NW5A 5FM2A 4DGGA 4YC8A 4M3QA 4C57A 3UGCA 3V51A 3GC9A 4QO9A 4S30A 4XP3A 4DFBA 3PZEA 3SKCA 4FR4A 4C02A 2C5VA 4B9DA 2GHMA 2YCQA 4CZTA 5JQ8A 4BDFA 3SW4A 3O51A 4DGMA 4TL0A 4FEUA 4CD0A 5FM3A 1H1SA 5DYJA 4FT5A 1XJDA 4O91A 3ZSHA 2GQGA 2YJRA 3HMMA 4PNKA 2ITQA 4PL5A 3SV0A 2CCHA 2PZPA 1XO2B 3R7OA 4A9YA 2RFEA 4AZTA 5H3QA 2QURA 2OW3A 4IWQA 1OMWA 3VJNA 4MX9A 3QU0A 3H9FA 4U43A 5HE1A 4B4LA 5J9ZA 3NR9A 4QP8A 5JFXA 1TQMA 3V6RA 3PRIA 3N51A 4HGSA 3IOKA 4GFMA 3DT1A 4BCKA 4C3RA 3ORPA 5A46A 3EQDA 4AACA 4CT1A 3RPVA 5EDRA 5E8UA 4BDDA 2KTYA 3HYHA 2VTRA 5HLPA 1VZOA 2PMOX 4NM0A 3VS4A 4ANSA 1YWRA 4FICA 3VULA 3GNIB 4O1OA 4ZJVA 4AN2A 3D5UA 2J2IB 4GG5A 2Y7JA 2ETRA 2QI8A 4O38A 4WKQA 4C37A 1V0BA 4KUJA 4OW8A 3Q9YA 2IVTA 4JOAA 2H34A 2J90A 1V0PA 3RM7A 4LOQA 2JKOA 2XZSA 2VWYA 2B9FA 3LFNA 3BV2A 3BU5A 4O2PA 5KUPA 3W33A 3VNTA 3CQEA 2ZV9A 5ANOA 4QYYA 1P14A 4A06A 4IH8A 1WBVA 4ANQA 3V3VA 4FEVA 2YLEA 3COIA 3RJCA 1LEZA 3R9HA 1R1WA 2J0KA 1HCLA 4PF4A 1OPLA 4ZP5A 2AC5A 3NW5A 3NYOA 3FWQA 3OZ6A 3PVGA 5C27A 2X81A 3ZZEA 3D7TB 2AYPA 3I4BA 3R71A 4F6SA 2JFMA 2PMIA 3IONA 3QQLA 2GCDA 3G9LX 5FP6A 4IC8A 3KEXA 5JZNA 4FA2A 4BI2A 4AOIA 3TNWA 2QO9A 3NX8A 3G90X 4LRMA 4PRJA 4X21A 5LOHA 2OLCA 2CN5A 2JD5A 3GOKA 1IR3A 4NZWB 2YCRA 4TYEA 5E91A 2PE2A 2FSMX 4IB1A 2EB2A 2UZNA 5TO8A 3RMFA 5L3AA 4FG9A 3R9NA 2OH0E 1VJYA 4AX8A 2R3PA 4YJVA 2G1TA 4FL3A 4FZ7A 2OJIA 4GJ3A 5E7RA 4ZSJA 5IQBA 3IGGA 2PUUA 3NUYA 4R3PA 5KMMA 1ZRZA 2GSFA 5HU9A 3C4ZA 3IGOA 5EOBA 4LGHA 4EHEA 4QOXA 2UW8A 2WB8A 4PMSA 5DNRA 5B2LA 4WNMA 4G34A 4LUEA 5DPVA 4O7ZA 4R7BA 4EL9A 3ZOSA 3OT3A 4RG0A 5KO1A 3AT4A 3NVMB 4K1BA 1XH8A 5HU3A 1Q3WA 1PW2A 1FQ1B 3R1NA 5LMKA 5D12A 5JSMA 3DS6A 4UX9A 2BPMA 2WPAA 4XLIA 3OG7A 2CKQA 3I60A 2PUPA 3D5WA 3DK3A 5DG5A 4EK8A 1PKDA 3UZTA 3P7CA 5C4LA 4I5CA 2E2BA 4I6BA 2G9XA 5IMEA 3DZOA 3D0EA 4EOJA 3I81A 3NNXA 3TV7A 2QG5A 2BILB 2Y4IC 3PY0A 3MN3A 4UMTA 5FQDC 4DG2E 4U80A 2CGWA 1IA8A 4FZDB 3UOJA 2JBOA 4YMJA 4FKUA 5K0KA 3QCXA 4FT0A 4LL5A 3U87A 2GNFA 2I0YA 3HUBA 4GYGA 4UV0A 4WNOA 4WIHA 3SA0A 4UYAA 1SZMA 4UZHA 4FSUA 2YM7A 4MF0A 3NUNA 4CTCA 4BR3A 1OPJA 5LVLA 4MNEA 4ITJA 4PMTA 5HEZA 4DLIA 1B39A 5DIAA 2XBJA 1KE9A 3F2AA 4JNWA 3UIUA 4XOYA 1M14A 3FMJA 1CTPE 4RX9A 4LRKA 4UB7A 4BY9E 3QXPA 3UC4A 1ZARA 3VQHA 5EI6A 4DG3E 3R04A 4U3YA 1Y91A 2RGPA 3M42A 2VWBA 4MNFA 3MGYA 4RIYB 3RK5A 3NWWA 4O21A 3DU8A 3I0QA 3KN6A 3R7GA 4GVAA 4B8MA 2PVMA 3UQFA 5L6PA 2XIKA 2IZRA 5FEQA 3FJQE 4XLVA 3UG1A 2CLQA 3BYMA 1RE8A 4DTAA 2AUHA 2H6DA 5FDPA 4C33A 3IOPA 3QCQA 5HICA 2GU8A 3FMEA 3DBFA 2LAVA 2PK9A 2XRUA 4O7NA 4ACMA 4O0WA 3OC1A 4QP2A 4LG4A 3PPZA 2YABA 4P7EA 2XNEA 3VBXA 1JKTA 1OIYA 5TF9A 5IQGA 4C62A 3HRBA 3AD6A 2GS2A 1H8FA 2IVVA 4IVBA 4HVDA 3BWFA 3G6GA 4S2ZA 4FZ6A 1ATPE 4AZFA 4ZY4A 1A9UA 4KIPA 4D9UA 5HG8A 3R9OA 3HV4A 4ZXTA 5EW8A 4DGOA 4DEHA 5CEMA 3QTRA 3VBTA 3ZEWA 4XV2A 4ZJJA 5CALA 2UZEA 3GT8A 4FIGA 4F6WA 4M7IA 4RA4A 2ERZE 4P4CA 2W4KA 3L8XA 4GVJA 4R3RA 3SRVB 4OAVB 3AD4A 2J5EA 3CKXA 4XG7A 3ZLSA 5AADA 2XIXA 3TNQB 1WVWA 4EORA 4H05A 2ZM3A 3MFSA 3QKKA 1OL5A 3O7LB 2EVAA 2X7FA 4AZWA 4DEBA 5AX3A 1MRUA 5BYLA 4FTUA 4AT3A 3HAMA 2X7OA 5L8KA 2YIXA 2J0JA 3QL8A 4FSZA 3DBCA 1G8AA 4TW9A 2LGCA 2ZV7A 2W1ZA 4BWXA 3VUDA 4EYJA 3Q9WA 2WTIA 4C38A 4QP7A 3LHJA 5IH4A 4UXLA 1Q61A 3DKGA 3NYVA 4EUUA 3T8OA 3OTVA 3UQGA 3GU7A 2X4ZA 3DAKA 3JYAA 4ZZOA 4EH4A 3AC8A 2XB7A 1DS5A 1S9JA 2YM8A 5B7VA 5CSHA 3VUHA 1UWJA 2QQ7A 1OL7A 3FKLA 1F0QA 2BZKB 3D4QA 3PG1A 2J51A 5CAUA 4C3FA 4XG6A 1SVGA 2QKRA 4OTDA 3ANRA 4O7RA 5HO8A 3UVQA 2JC6A 1Z9XA 4EKKA 5ETCA 2XK4A 3QC9A 5CQWA 3KRJA 4PPAA 1PRYA 3MESA 3QUDA 4FEWA 3WOWA 3GU4A 4Y73A 5AP1A 3RPSA 4UY9A 1L8TA 4HVHA 3WARA 4PMMA 3FV8A 3F5PA 4JG7A 5AUWA 3TJDA 2HWOA 4LOOA 4NJDA 4QMZA 2ZMCA 4BCPA 4O0SA 5JKGA 5J79A 3D5VA 1GOLA 3FC1X 3ZO2A 2ZB0A 4U5JA 4R6VA 1WBPA 4CRSA 3TUCA 4OBOA 4I4EA 4FK6A 4A9TA 3KKVA 2JITA 3NGAA 4QMVA 1JVPP 4YSMA 1CKJA 1RJBA 2R64A 2ESMA 2ZAZA 3QRJA 4MBLA 4HCVA 3ZM4A 3LLTA 3ORKA 2ETMA 5DT4A 3ZLXA 1KV2A 4CFXA 4KIQA 3V5QA 5C9CA 3SDJA 3KU2A 4DYMA 4QQ5A 2VTJA 4UMUA 4YURA 5L4QA 4DF3A 3F7WA 3FXWA 3DNDA 2J7TA 2P33A 5D1JA 2RKUA 3IW8A 1PXPA 4IDTA 1ZMVA 3NUXA 2G2HA 3Q04A 2C68A 5IEXA 1Z5MA 2FO0A 4IB3A 2WIPA 4CFNA 2B0QA 3G6HA 3Q4CA 5HGIA 3COKA 1W83A 3BCEA 3TACA 3WZDA 1YI3A 4FL2A 3UIBA 1SM2A 5EDQA 5DR2A 3KK9A 4YLKA 2VX1A 4H3QA 1MP8A 4K18A 5K3YA 5EDPA 4AS0A 2UZLA 4RWKA 2C5XA 3FL4A 4CKRA 5JGAA 3QTQA 5HLNA 3RM6A 4UBAA 3W2QA 1YWVA 3RTPA 1ZWSA 2GNHA 2QOKA 4MKCA 4ZTSA 3E93A 5CVGA 3U9CA 2FH9A 4ZZNA 5HVYA 3VWAA 2UZUE 3DAJA 5CWZA 5A54A 2BRGA 2PU8A 4IM3A 1M2RA 3BYUA 4YU2A 2J0IA 2XEZA 2FSLX 3DQWA 3OY3A 3N9XA 3Q5IA 3OCSA 3QF9A 4I41A 3UO5A 4MF1A 5FLFA 4C0TA 3OXTA 3PA5A 1KOAA 1E1VA 3LFCA 4O1PA 3NEWA 4C4HA 3JY0A 1APME 4AGCA 4M12A 2HENA 3ZFMA 4ONAA 3OOGA 4LI5A 1REJA 4Z7HA 1Q8UA 2VWVA 5DBXA 2FB8A 4QYHA 4N0SA 3RNIA 3R21A 4CFUA 4D28A 5HIEA 4FUYA 5ANJA 1QL6A 4C8BA 1YOLA 4QPAA 1ZLTA 2WTDA 4FSQA 4NFNA 3ZMMA 3NDMA 4BWPA 4AF3A 3L9MA 4TN6A 3QA8A 4AU8A 4FX3A 4DT9A 3KCFA 2R3KA 5AR3A 3PTGA 4YZMA 2NO3A 5KMLA 4G6LA 4PPBA 3R6XA 2FSTX 2JDSA 3QALE 4XMOA 2C47A 1OIQA 4ZTLA 5BMSA 2W1HA 4MQ2A 5E4HA 3MW1A 4LQMA 4O22A 2IPXA 4Y5QA 2OU7A 2UVXA 4DCAA 2QOBA 4DA5A 2XKFA 4MXOA 4W9WA 5LVMA 5DFPA 3KRWA 2GNLA 2Z2WA 5BVEA 5BQ0A 4I93A 3MH3A 4J95A 5AP0A 4UWCA 3DPKA 5DT0A 3PZHA 4FUXA 5G6VA 3BU3A 4BI1A 2FUMA 4AFJA 4L52A 3EQPA 3QWJA 2B4SB 4NJ3A 4RLLA 3R8VA 3PVBA 3VS0A 4AP7A 3POOA 4CEGA 3ZUUA 3SOCA 3VJOA 3NS9A 4BIDA 3GVUA 3DFCB 1S9IA 4K8AA 5C8NA 3PVUA 4JIAA 1QPDA 3KK8A 2HZ4A 4UXQA 3ZU7A 5BUEA 3AGLA 3I1AA 4LGGA 2HXLA 2DQ7X 5D7AA 4EK4A 2O5KA 2YAKA 3H4JA 3I5ZA 3QHWA 4M15A 5FTOA 3OY1A 5HVJA 4DC2A 3WF7A 1W7HA 3EFWA 3S0OA 2BIKB 4IAZA 5EM7A 5KBQA 5I3OA 5TT7A 4CZUA 3R2BA 2PVJA 1J91A 4QD6A 4QP1A 4FV3A 2WQOA 4J8MA 4ZTMA 3KRRA 4XHKB 1JKSA 3TIZA 5E8WA 4AW0A 5LCJA 2PZYA 2OIQA 2W1FA 4I94A 4ZTNA 1H1RA 2W06A 4FYOA 3DKOA 3COHA 5AMNA 4CNHA 2GNGA 3AC4A 4BI0A 1H1WA 4E6QA 4W4YA 5KX8A 2X0GA 4IZ5A 1OIUA 4PDPA 5J8IA 4PDYA 3PJ2A 4E4XA 3R8PA 2C6EA 1ZYCA 2ZV8A 3TXOA 3ORIA 5AJQA 3FXZA 4HYSA 4QP6A 5A9UA 5CZHA 4QYFA 5IQCA 3CTHA 4I24A 5EK7A 2WMUA 5KZ0A 2HCKA 5LMAA 4XG2A 3NIZA 3FEGA 3IKAA 4BCJA 2VWUA 4F09A 3CCNA 4MWIA 1PYEA 4OTGA 4F9CA 3IW4A 1UU7A 4YBJA 4IBMA 4PWNA 3LZBA 2G2IA 4AZEA 1OVEA 2Z7RA 3F5XA 4WSYA 2QR7A 2JFLA 3QTWA 1KE6A 4H36A 4YJSA 2JBPA 5JK3A 4M0YA 2W1EA 4IWPA 4I3ZA 2WKMA 1UKIA 3L8PA 5FGKA 4O6EA 4TWOA 4AN3A 4RQKA 3OMVA 3VW8A 3DK6A 1FPUA 2QOLA 3UODA 3FLSA 4FEQA 5AR5A 4F7NA 4PX6A 5IQDA 4Q5EA 4QP4A 1DI9A 2VTLA 3R7YA 1YKRA 3C0HA 2VWZA 2WMTA 1XQZA 3M1SA 3CJFA 1OBDA 3IK3A 4L42A 4HGLA 3IO7A 2C5OA 5M4FA 2R3FA 3OW3A 3EQGA 4TNDA 3NNUA 5DVRA 4BHZA 4TWPA 2V5QA 2Y6OA 2OO8X 2XCHA 4OTQA 4XRJA 5BVNA 4JBOA 5HIDA 4EJNA 4JDHA 2EXMA 4JI9A 4FV0A 2IW9A 4XG4A 4E3CA 4DG0E 3GCUA 3Q4TA 4BTJA 3OWLA 2E9PA 5FEEA 4ANOA 4DEIA 4ZS4A 4MAOA 3ZO1A 2BKKA 4QP3A 4YJQA 3AGMA 3DJ7A 4AN9A 3DK7A 3UP2A 3ZO3A 3ET7A 4UMPA 3UJGA 4CGAA 1Y6BA 3ANQA 5F1ZA 5CU4A 2IZTA 4AT5A 3UPZA 2GNJA 1YI6A 3FI2A 5LVPA 4U81A 3FPMA 4J1RA 4PUZA 5IA0A 3W55A 4C34A 3EFLA 1PXJA 1R78A 4ZLOA 1URCA 3A2CA 1BLXA 4FKRA 4KIKB 4A4LA 4XV1A 3PJ3A 3BGZA 3U54A 3BHUA 4ZMEA 1PF8A 1CKPA 3NW7A 3WF5A 2WMVA 2C1AA 2BFXA 3QGYA 4ZTRA 2PZRA 4XX9A 3FI8A 5I9ZA 5IA4A 5DGZA 1ZXEA 2PVKA 5TE0A 1UKHA 2FVDA 2OIBA 2P2IA 4UZDA 3R8LA 2VUWA 5C03A 2O64A 3EQFA 4M68A 2XM8A 2OXYA 2XNPA 3RCDA 4L3JA 4OTPA 4YJRA 5DLSA 2C6KA 2ZB1A 4H3PA 5EYDA 3LFAA 3OT8A 3W8LA 1Q8ZA 3TKIA 4G6NA 2BHHA 3HZTA 4FTOA 5EFQA 4BZNA 5ICPA 2PE0A 1J1CA 2IWIA 4A07A 3LLAA 3EN6A 4O2ZA 4O6LA 2ITWA 2QC6A 3RZBA 4D4YA 3AMAA 4MXZA 3CLYA 3FZTA 4AE6A 4YR8A 1KUTA 2RF9A 2OZAA 4QMXA 2GTNA 4EJ7A 3WZEA 4DCEA 1J7LA 1GZOA 4YHTA 3E64A 2VTTA 3FYJX 4BN1A 2W1IA 5TKDA 4RX5A 2XNBA 2BAKA 3BI6A 2OF2A 4R8QA 4EH6A 4GYIA 5J5TA 3DBEA 4EC9A 4CCUA 5FBNC 2FYSA 3Q32A 3Q6WA 4O27B 5KBRA 3PJCA 3SHEA 4BDKA 3QWKA 3UDBA 2XCKA 4EYMA 4O7TA 4HYHA 3TN8A 5IEVA 1ZMUA 5K4JA 3CPCA 3LFEA 4P5QA 4FKWA 4HCTA 4UN0C 5J1VA 5DI1A 1JBPE 4BGHA 1W98A 2BFYA 3NCZA 5F94A 3LFFA 4FTKA 4AT4A 2BRHA 3QD2B 3H3CA 3DNEA 4IAFA 2PMLX 2Y4IB 4X3JA 1X8BA 4X3FA 5CTPA 1TQPA 3CQUA 3P78A 3PWYA 2XEYA 2NNWB 4RJ3A 2BAJA 4A9SA 3GC7A 1SNUA 4ZEGA 3CTQA 2PVHA 5HD4A 5LCKA 5CSVA 2BZHB 5DEWA 3WF8A 1URWA 2IZSA 1XWSA 4OTWA 3NAYA 4FNWA 2YIYA 3S4QA 4DEGA 3GENA 2ERKA 5LQFA 4FTQA 3VC4A 1I44A 1B6CB 3TV6A 2C6DA 2Y8OA 4RVKA 3S2PA 4CMUA 3R8UA 3ENHA 4KBKA 5IDNA 2WTKC 4OTIA 4KKGA 2YWVA 5AP7A 3NUUA 5TOZA 4F6UA 4GL9A 3AMBA 4NTSA 3JR1A 1NVQA 3NNWA 3OP5A 4TT7A 5HTIA 3CKWA 2YFXA 4GSBA 4UALA 3VVHA 2BVAA 4I6FA 5IA3A 2YISA 3NYNA 1FMKA 5KCVA 3C4EA 3MIYA 4F65A 5A4QA 2W5HA 3ATSA 2QOFA 4FV6A 3U6JA 1PMNA 2BMCA 3KXNA 2PVLA 4WA9A 2RSVA 2PY3A 3AC2A 4BCNA 5M4UA 4YTHA 4K77A 5CEQA 4JR7A 2XIYA 4AOJA 4C36A 4R7HA 5DR6A 2CKOA 2VX3A 3DDQA 3KL8A 3FLYA 4EI4A 1BL7A 4TWCA 3QQFA 1U5RA 2B1PA 4EOOA 1SVEA 3BEGA 3MFRA 3P9JA 3S95A 3DJ6A 5AR7A 3RPYA 4ID7A 1GJOA 4IB5A 3V5TA 1K3AA 4BDJA 3HV7A 3ATTA 4O7LA 4EOLA 2OFUA 2UZDA 2VU3A 5LVNA 3NVKI 2VNYA 5AM7A 3CE3A 4YNEA 3ZDIA 4F9AA 4O0RA 5HO6A 3HDNA 3P86A 3BX5A 5GJFA 4XP2A 4D0XA 4Y8DA 4FOBA 3VHEA 4TKSA 4D9TA 4G3DA 4KBAA 5J7HA 4FSWA 2REIA 3GC0A 3QYZA 5BYZA 2W9ZB 5D9HA 5CF4A 3NUAA 3HEGA 3DCVA 2OFVA 1V0OA 5EYMA 3MI9A 5HHWA 1WMKA 3QFVA 3ULIA 5AFVA 5CANA 5IU2A 5KKRC 2W96B 2R4BA 3BKBA 4ZY5A 1XH7A 1M17A 2QD9A 4IEBA 4MQ1A 2R3RA 4GIHA 4R5SA 5LXMA 4L44A 1YXSA 1FBNA 5EQPA 5F20A 4IFGA 4WUAA 1F3MC 2XKCA 1YQJA 4ZK5A 1W84A 3JPVA 4BIEA 3D14A 3N4VA 3QAME 4EH7A 5CEIA 2ETKA 4KSQA 3UG2A 3A4OX 2C6TA 4F9YA 4FKPA 5AUTA 2C0IA 4QMWA 4QT1A 4R7IA 1OKZA 3A8WA 3Q4UA 3FL5A 2HYYA 4Z9LA 2CN8A 3EHAA 4JVGA 4Y46A 5CI6A 3UYTA 3VHKA 5EH0A 5A14A 2C3KA 2Z8CA 5ETIA 5GIPE 3PY3A 4RC4A 3WF9A 3P7AA 1U5QA 3DA6A 4TWNA 5CEPA 4U79A 3SAYA 4YPDA 4EH5A 1MRVA 4EOQA 4NYEA 5AP2A 1ZOEA 3ZO4A 3PSCA 5HESA 4JBPA 5LMBA 1PHKA 3EL7A 3PSDA 3WZUA 1AGWA 1CMKE 3PIXA 3ORNA 4D5KA 2CHLA 3A60A 2R7IA 4EK6A 2HY81 4KIOA 1ZOGA 3ZRLA 5D7VA 4BCHA 2CDZA 3CJGA 4IADA 4W4XA 1UWHA 3FMHA 1WBNA 4FV2A 5E8SA 1ZYSA 3CGFA 2CGVA 3P08A 3MS9A 3RK9A 3TUBA 4I1ZA 3FQHA 4MTAA 4R3CA 3FQEA 5E92A 3ZFYA 4C2VA 3FZOA 3RI1A 4U97A 4RBLA 1UVRA 2PL0A 2W05A 2BALA 3AXWA 2XK8A 2HOGA 4IB0A 3SOAA 2UW9A 3QD0A 4YTIA 4HVGA 3S1HA 4DINA 4F63A 2PVYA 4XS2A 3UYSA 1K2PA 3E8EA 2X9EA 3A8XA 3HUCA 3BE9A 4W9XA 4XYFA 3WIKA 2Y6MA 3UIXA 4YZNA 1WBSA 4JL9A 4YPSA 5A4TA 3CC6A 1UU9A 3ETAA 4KRCA 3BRBA 4FG7A 4APPA 2GQRA 1TKIA 1IRKA 3E7OA 3EQHA 3P1AA 2QR8A 3HMPA 4QYEA 4UEUA 3RALA 3RZFA 4ACGA 4LM5A 3V8WA 4CFFA 3ROYA 3GQIA 1OPKA 1H24A 1H4LA 1O6LA 2OIDA 2BZJA 4RIWA 1YVJA 4G31A 4LMNA 5CF8A 4EOMA 1JPAA 4BFMA 4ZSEA 4CMTA 5I5ZA 3MY1A 4K0YA 4QMTA 2R3LA 2DUVA 4DEAA 5LMKC 2V22A 1DM2A 2CMWA 4MXCA 4Q9ZA 5HVKA 2ZMDA 4FV7A 2XNMA 2GFCA 3CY2A 3MJ1A 4RIXA 2P3GX 5HE0A 2BDWA 5T6KA 4A7CA 4HYIA 4ALVA 2PUIA 3CBLA 1OI9A 2CPKE 3VS7A 3QKMA 4DAWA 4GEOA 5AV1A 4JBVA 4EZ5A 1Q41A 3FSKA 3H30A 4RJ8A 3TCPA 3NZ0A 4BDBA 2XMYA 3GBZA 4CZYB 2OBJA 3QHRA 4XG8A 5EI8A 4ZSLA 5JRQA 5EKOA 5FUTA 5E1SA 5A4LA 4HZSA 4BCQA 4FT9A 3DLSA 4TNBA 4XG3A 3QRKA 5EM5A 2I7QA 3NYXA 4NEUA 2VZ6A 3C0GA 5JMSA 4IX5A 5B2MA 3VF8A 5A4EA 3LJ0A 2QCSA 4E20A 4IVDA 4ZAUA 3O2MA 4KB8A 4JS8A 4FV4A 2QOQA 1BMKA 3UNZA 4ALUA 3ODZX 4ASZA 4DH3A 5CU6A 4WUNA 2XH5A 1H00A 4TTHB 2X2KA 5D10A 1PJKA 4FZFB 4OUCA 4ARKA 3WZKA 3C5IA 3F2RA 2QODA 3UZRA 4CVAA 4P2KA 5KMJA 5FEDA 3KGAA 4QMUA 4V0GB 4IM0A 3C4WA 4D0WA 4EWHA 3A99A 1WCCA 2UZOA 3BYSA 1PMEA 3IW7A 3HECA 1M7NA 3PRFA 3PXKA 4KS7A 4E6AA 3TT0A 5BMMA 4KD1A 4HVIA 5CLPA 4DFUA 1YXUA 5I9YA 3QA0A 2WOTA 5JEBA 2WMSA 4QMSA 4YZDA 3CSVA 2A1AB 4KRDA 4C4JA 2B53A 4NIFB 4X2KA 3UTOA 2W4OA 5H9BA 5BPYA 1O9UA 2W9FB 3QRTA 3HV6A 4TYHB 3VUKA 4BDGA 3BHVA 3MDYA 2DYLA 4FTAA 5KHXA 3JUHA 3E8NA 4PTEA 2YIWA 2YITA 4RFMA 2NP8A 2YN8A 1YXTA 3BGQA 4C4IA 3PJ8A 4YHJA 1OL1A 3R8MA 1WBWA 4HNIA 3Q52A 1KWPA 3LQ5A 2J4ZA 3F66A 5AUXA 4BIBA 5IQEA 3EKNA 4NUSA 3WYYA 3R2YA 3OCGA 1YXVA 3KREA 2ZDTA 4FSTA 4K33A 2BKZA 3SQQA 5HCXA 3MA6A 4J7BA 3ZRKA 3F5UA 3ZBXA 1PXNA 2YA9A 1JLUE 4FKSA 3KQ7A 2I0EA 2XK6A 3OXIA 3UNKA 4I5MA 2WTWA 3SXFA 1Q99A 1P4FA 2F7EE 5CI7A 4EOPA 3Q9XA 4EHVA 4FV1A 3QTSA 3TWJA 3GEQA 4NM7A 4FEXA 3KA0A 2C6LA 5DA3A 3HNGA 3MSSA 4WHZA 5BVKA 4ANBA 4L7SA 2Z7SA 5DR9A 3ZLWA 2VTMA 2I0VA 4DITA 3AD5A 4NT4A 4E5WA 3EKKA 2Q0BA 5HORA 2BAQA 3BWJA 4QMMA 4FNXA 5CS6A 5HTCA 3H9RA 4E4LA 4NKSA 4G5JA 4II5A 3EL8A 5IA5A 4CFMA 1WBTA 4RVTA 4FV8A 4O7YA 2BR1A 2UZVA 2QOHA 3VUMA 2J5FA 2V62A 2XIZA 3A61A 5AR2A 4C4EA 1REKA 1MUOA 1YRPA 4I0SA 4U40A 4AWIA 5CF5A 3CTJA 2UUEA 4IWDA 4AAAA 3L1SA 4CCBA 5CU0A 3ERKA 5ANGA 4OTRA 2WEIA 3IS5A 4CQEA 1ZYLA 3E88A 3PA3A 5ETFA 5HNGA 4O0YA 5IEYA 2OJGA 4BKYA 4C2WA 3SXRA 2PMNX 4RZVA 3N4UA 3FPQA 3K5UA 1DI8A 3D7TA 4IX3A 1W8CA 3O7LD 1OIRA 4JG8A 3MB6A 4EQUA 2O3PA 2YWPA 3RP9A 4JX3A 4ZLZA 3QQUA 5HCZA 3LMHA 3HV5A 3PIYA 3B8RA 2P4IA 4ANLA 1NXKA 2JKMA 5KMKA 3KXXA 1JWHA 3ID6C 4FTLA 5HNIX 3QRUA 3LE6A 5K5NA 2WTVA 2X1NA 4AQCA 1H08A 2EXEA 4ZZMA 5AP3A 4GIIA 4FL1A 4M69B 1ZZ2A 4MYGA 3TZMA 4TRLA 4EZ3A 4IC7A 4FVQA 4XBUA 5IUIA 5DT3A 3ZBFA 3HAVA 3CGOA 5IH6A 2IN6A 2C1BA 4EWQA 4QTEA 3W2CA 4RX8A 4BDHA 1ZOHA 2C69A 2ITOA 3BIZA 3DTCA 4K2RA 4NU1A 3UOHA 3WILA 4EK5A 2XJ1A 4CTBA 5CYIA 3MH1A 2Y4PA 5HG7A 2JEDA 2P55A 3II5A 3KVWA 3TI1A 3F3UA 5IZFA 1VYZA 3FZRA 4AGDA 1PMUA 1T46A 2C5NA 3FUPA 2XKEA 2CCIA 4EH3A 2UW5A 2CNVA 1ZAOA 3U55A 4FYNA 1YOJA 5AUZA 2UW7A 4L01A 3BHTA 3OUNB 4XP0A 1WVXA 4YJUA 3U4UA 1H25A 5E8YA 2JKQA 3QD3A 4AE9A 3LIJA 5EW9A 3R7UA 2GHGA 2WFYA 3LXPA 3H10A 4KNBA 3HLLA 3GP0A 5J9LA 4E5BA 3C0IA 4FF8A 3RGFA 4DH1A 3KULB 4R78A 3OWPA 2F57A 2GHLA 2R3GA 3GB2A 3HRFA 3V8SA 3SG9A 3Q60A 2AC3A 2OJ9A 2VWXA 3LFSA 5LWNA 2XYNA 2Q83A 4Y5HA 3PJ1A 4IVAA 1BI8A 4GJ2A 1JNKA 2WU7A 3DBDA 4PTCA 5L6WL 4XV9A 4I0RA 2UZTA 3QCSA 1VEBA 2HELA 1LP4A 3D15A 4EUTA 3H0ZA 4MD7E 1HOWA 2F9GA 2A4LA 4EBVA 3MY0A 2YEXA 4RIYA 3ZXZA 4TZRA 2WTJA 5I9UA 4O0VA 4XNEA 5M06A 2CKEA 2CGUA 5CX9A 4EOSA 1PKGA 3OW4A 3FSFA 5IA1A 5HKMA 2WAJA 3L9NA 5IKWA 4O96A 1NY3A 5GHVA 2O65A 1OB3A 3S3IA 3POZA 4H1MA 4D1SA 5CEOA 2HZ0A 2C0OA 4FKVA 5AP4A 3LKMA 3EQCA 3ORXA 2PVRA 3AC5A 3KY2A 4PDSA 4QTDA 3Q6UA 1SNXA 4PL3A 4AFEA 4DH8A 3F7ZA 1FGIA 3C4CA 2FSOX 4BDEA 2X2MA 2ZOQA 5G1XA 4CLJA 5BX0A 5KNJA 3P7BA 4OT6A 4TYHA 4G3GA 4BHNA 4E8AA 2VGPA 3RAIA 4DH7A 1YHWA 4HCUA 5FRIA 4O84A 4BKZA 2P2HA 1XKKA 3LFDA 3OEZA 3FHIA 5I9XA 2V7OA 2GFSA 3ZSGA 4U42A 3AT3A 2IZUA 4BICA 5E90A 3RPOA 1UNLA 3P0MA 3Q9ZA 5AP5A 2F2CB 2UVYA 3TUDA 5M07A 5KMOA 4EOKA 3ZYAA 3R0TA 2HW6A 3T9IA 5L2QA 5HBJA 5IF1A 2WMWA 2C6MA 4FODA 2YCSA 3LQ8A 1MRYA 5A6NA 3ZUVA 2XK7A 3SRVA 3VRZA 3QZIA 5M08A 4RJ6A 3G9NA 5GJGA 5BUJA 4RLKA 4FV9A 2BRNA 4F0IA 2BDFA 3MVMA 3LXNA 4JAIA 4OAUC 3FBVA 3PLAE 2JAMA 3OHTA 1RDQE 4PL4A 4RC2A 3EB0A 3PA4A 4BDAA 5HNBA 3DDPA 3TZ9A 4BDCA 3D2IA 4FBXA 3PXRA 4FKTA 2BDJA 3UPXA 4EKLA 2VTAA 3WYXA 2E9NA 4RFYA 1YDTE 2WTKB 4USDA 4BVUA 4EONA 1LEWA 3K3JA 4LOPA 2EUFB 3V8TA 5L2SA 5M44A 4AUAA 1GZNA 5E8XA 3A7FA 3NPCA 3AC3A 3OROA 3ZCLA 3R63A 4G16A 3UP7A 3G15A 3LAUA 2BROA 2WIHA 4UMQA 3SX9A 2G01A 3MPMA 1R39A 5M4IA 3TDWA 4J71A 3MA3A 5M4CA 4NCTA 1U54B 4G5PA 2X7GA 1XH5A 5C1QB 1BYGA 3K5VA 1Q8WA 4AA0A 5L2WA 1P2AA 4DEDA 5JH6A 5JGBA 3KB7A 2W4JA 3I0OA 4L00A 4IANA 4BGGA 4V04A 3ZTXA 3NUSA 2X8IA 3BGPA 4JRVA 3M11A 4RWJA 4KWPA 3R9RA 5ANKA 2I40A 5CEKA 4U9AA 3MVJA 4HW7A 1G5SA 1KSWA 3LM5A 3ITZA 3Q53A 3REPA 4BZOA 1DAWA 2WMRA 3FMKA 5EG3A 3GFWA 3UZPA 2DWBA 3IQ7A 2WXVA 1U4DA 4CQGA 5B2KA 3Q2MA 4LL0A 3EQRA 4XOZA 1AQ1A 1H01A 2ZM1A 4TYGA 4YJNA 2QHNA 4RVMA 2ZYBA 3DKCA 4IFCA 1GZ8A 4WNPA 1KOBA 2G2FA 4H58A 1NVSA 2JLDA 5CAPA 4GG7A 3ULZA 1JOWB 4I22A 4M8TA 4GK4A 4CMOA 4D2WA 4NSTA 1XBBA 2X9FA 2GS7A 5ETAA 3HP2A 3W2PA 4PP9A 4I20A 3TZ7A 5KKRB 3HMIA 4GU9A 4U41A 4BZDA 1UV5A 1PXMA 1J7UA 4MH7A 4IX4A 5AP6A 2B7AA 5HQ0A 4JXFA 3DFAA 3PPKA 3QTZA 5EYCA 3F6XA 5IQIA 2C6IA 2X8DA 4GS6A 5JRSA 3TZ8A 2O2UA 3HA8A 4L9IA 2KULA 2XVDA 4QP9A 4RT7A 2QOOA 4FGBA 4ZOGA 4WBBB 3GOPA 3ORTA 4BL1A 1BX6A 4F1MA 4CFWA 3W32A 3R28A 2ZDUA 3LCOA 3HVCA 2YM5A 1SYKA 5HE3A 5EM6A 3ZRMA 2I6LA 4BCMA 5AAFA 3LFQA 3F82A 4YTFA 4JX7A 4IJPA 3DB6A 1JSUA 2WEVA 4FTJA 2H9VA 3PLSA 2ITTA 3AMYA 3VBWA 4EEVA 1Q4LA 2JKKA 5L6OA 4GK3A 4FGRA 5HTBA 4GT3A 3R7VA 2UW6A 3KMUA 3OEFX 4YNOA 4EH8A 3E8CA 4Y83A 2WMXA 2QO7A 3JY9A 2CNQA 4S32A 1XH6A 3FXXA 3BBWA 3EFJA 3ZUTA 4BBFA 3EYGA 5BYYA 3QBNA 1J7IA 3EQBA 2HZNA 4GUEA 3MH2A 2QNJA 2DS1A 3GC8A 3VIDA 4M66A 4BTFA 2YAAA 5GINE 5E8TA 4GKHA 4LMUA 5CXHA 3RNYA 4CV8A 3E87A 3KN5A 3NAXA 2WO6A 4HPUE 2YLFA 5ANEA 3ZEPA 4Y72A 3FKNA 5I9VA 2PTKA 3ENMA 4IW0A 3E62A 4IACA 3V5WA 3VUIA 1WZYA 4FE2A 4KA3A 4D2RA 4F7SA 4UYNA 2I1MA 3F3WA 2VTPA 4I21A 4ZIMA 5FTGA 3MH0A 5DEYA 2YDKA 3RINA 1XR1A 3CD3A 3V5PA 4Z16A 3E5AA 2VAGA 1AD5A 5HX6A 2I0HA 3I7BA 3HMNA 4O7WA 1WFCA 4OT5A 2C3IB 3A7GA 3BEAA 3R02A 5J5SA 1UA2A 3C13A 3PXZA 4FVPA 4I6QA 3JVSA 3DOGA 3TKHA 3NUPA 4DHFA 2UW4A 1BKXA 3GU8A 4XV3A 3R1YA 3NNVA 4BDIA 4XBRA 4PP7A 4F08A 2WMAA 4OGRA 4AW5A 2X2LA 3KF7A 5B0XA 4G17A 4D4RA 5ITAA 5FDXA 4S31A 5LWMA 4HJOA 4FTRA 5BVDA 3FC2A 4ZLYA 4DT8A 5CSPA 5T3QA 4GUBA 2FA2A 2XYUA 2X39A 4BRXA 2YHVA 3T3VA 4ACCA 2W17A 4R1YA 5I0BA 3IDPA 2B52A 4X3FC 3SGCA 3E3PA 5IPJA 2ONLA 5FWKK 1YHVA 2WELA 3F3ZA 4ERWA 3PDTA 2ITXA 3B2TA 3DQXA 4GU6A 5EW3A 3PXYA 4L7FA 3VF9A 2W5AA 3MYGA 1YW2A 3SLSA 3KXZA 4ENYA 2YDJA 2VO3A 4L43A 4BBMA 2YZAA 2YZLA 3LXKA 3W2OA 4FI1A 5E8ZA 2PWLA 3V5JA 4QMNA 5IUHA 2Z60A 2O0UA 1FINA 2IG7A 2WQMA 3SD0A 3PYYA 2VTNA 2A27A 3EOCA 5D41A 1H28A 4FIFA 4D58A 4ERKA 4E93A 5CF6A 4NWMA 3KC3A 4J53A 4ZTQA 4Z7GA 2EWAA 4C4GA 3OCTA 4G1WA 4NM3A 5HG5A 4NM5A 3HX4A 4BWKA 2WZJA 4CT2A 2C5YA 1STCE 4WNKA 3BBTB 3FKOA 4N6YA 4C35A 2UVZA 1GIHA 5FP5A 3B8QA 3ZDUA 4IDVA 4F64A 4AZVA 3EZRA 3R7IA 4J99A 3VS2A 3BELA 4MEDA 4O82A 3TL8A 3MVLA 4DE4A 5M09A 2W99B 3QX4A 3O50A 2C3JA 1YI4A 1OM1A 2F49A 2VGOA 3FI3A 3D94A 3V01A 5JZJA 2J0LA 1XBCA 5JGDA 2QOCA 4E6DA 4FKGA 1ZY4A 3B2WA 3NSZA 4R77A 3FHRA 2IO6A 3C1XA 4EHZA 4K9YA 4FG8A 3TKUA 3EZVA 3KMWA 3Q5ZA 3QYWA 2F7XE 3CD8A 3ZS5A 4M13A 1BUHA 4FNYA 4I4FA 3L8VA 5HLWA 2ITYA 1YWNA 4W4VA 4C7TA 4DFYA 5BVWA 4Z3VA 5AWMA 4GT4A 4PQNA 2Z7LA 2BZIB 4DFXE 1YOMA 4M67A 4CSVA 3ACJA 4O86A 4I6HA 3LQ3A 3PSBA 3QQJA 2VTQA 2WD1A 4X2JA 2UW3A 5ANDA 3HMOA 4DEEA 1FVVA 4EC8A 4D2TA 5K9IA 4A4XA 2BRMA 4E6CA 4TYJA 2E9UA 4QPSA 2JGZA 4MD8E 3EFKA 3SC1A 3F88A 4IQ6A 3LMIA 4QMOA 2BUJA 3BV3A 5M56A 3U6HA 4ZSGA 2CJMA 4JDIA 3ZZWA 3GQLA 1YDRE 2A19B 4BCGA 4F7LA 1OUYA 5H8BA 2VX0A 2ACXA 3UIMA 4EH9A 4WSQA 2HAKA 3AOXA 2W5BA 5K0XA 3QZGA 5AAGA 4I92A 1ZMWA 2Z7QA 2R0IA 3M2WA 4L3PA 1H1QA 3QX2A 4M0ZA 2IW8A 2PVFA 3D7ZA 1BL6A 2Y9QA 3C51A 3I7CA 5GZ8A 4FIIA 3DXPA 4Q2AA 2YACA 5JQ5A 4FKIA 3H0YA 4GCJA 4L3LA 1XBAA 2ZVAA 1IEPA 1CDKA 1VYWA 2B9HA 4RJ7A 4WG5A 1H1PA 2JAVA 4N6ZA 4FMQA 3COMA 4KIKA 1HCKA 4R1VA 4U7ZA 5FXRA 3LCKA 3MPAA 2WOUA 2CKPA 1OZ1A 2EB3A 5EQYA 5CSXA 3VW6A 1U46A 3CR0A 4OBQA 3ZSIA 4B0GA 3RHKA 3VS1A 3OUKA 3PE1A 4IHPA 4QMPA 1CKIA 3OWKA 2QLQA 3ALOA 3OTUA 4X7QA 5HD7A 5KE0A 3CP9A 4LYNA 4AXAA 1KV1A 1ZY5A 2XF0A 4DFNA 4EK3A 4EZ7A 2CGXA 4WRSA 4E73A 2QONA 2XKDA 5LJJA 3C9WA 1F5QA 5BUIA 1A48A 2PVNA 2OXXA 3QUPA 1FMOE 3VO3A 1O6KA 3VBVA 2R9SA 4IIRA 1GIIA 1M52A 1VR2A 4PV0A 4PY1A 1J3HA 3RVGA 3ORMA 2PSQA 4JR3A 3AT2A 3Q4ZA 3QRIA 4I0TA 3GCPA 4JLCA 4WRGA 2VWWA 4F9BA 5AA9A 3QTUA 3MPTA 4YLJA 4BYJA 4GH2A 2J9MA 3R9DA 3C7QA 4XG9A 3U9NA 4ZMFA 4CRLA 4D2SA 3OF0A 4E26A 5C8KA 4RWIA 3R83A 2A0CX 2GPHA 3PWDA 4KINA 1JQHA 1GAGA 1OKWA 4RSSA 5CY3A 2R3HA 4QYGA 4QMQA 2BIYA 4I5HA 3JVRA 3FLQA 1IG1A 4J97A 1JSTA 3E92A 5EHYA 2QO2A 4DGLC 5IG1A 3E7VA 4L45A 2VTOA 3MTLA 2F4JA 3F61A 2QG7A 4LV5A 2VO6A 3V04A 2RFSA 2RFDA 2G15A 4NKAA 4RX7A 5CT7A 3TV4A 5A3XA 3WE8A 3IDBA 5AUYA 5GZAA 1FGKA 3RWPA 4O83A 4NTTA 5CXZA 3F69A 3TTJA 3GU5A 3HL7A 3KMMA 4GW8A 2EU9A 3QCYA 4RJ5A 5J1WA 2X6DA 3LW0A 4PMPA 4FC0A 3LJ2A 2FGIA 3TEIA 2WQBA 5JFVA 2XJ2A 4BBEA 3UNJA 2PE1A 3OOMA 4P90A 5JFWA 3MIAA 1H27A 3FZ1A 4YJOA 5DRDA 3BU6A 1FOTA 3RAKA 3HDMA 5DWRA 3KCKA 3VS6A 2R7BA 4M14A 4L6QA 2SRCA 3FLWA 2OZOA 3KFAA 3K2LA 4GV1A 1NT2A 3N4TA 4TY1A 3BHHA 1OGUA 2YIRA 4CG8A 3T9TA 3TJCA 2W1DA 5IQHA 5A6OA 3L8SA 4RQVA 5K5XA 2J6MA 4N4SA 3ORLA 4FIJA 3G33A 3O96A 3GGFA 5E8VA 3KRLA 3Q2JA 4U44A 3E63A 4LFIA 5AIKA 3HRCA 1E9HA 5GZ9A 3TDVA 2WU6A 3QZFA 3ORZA 3RKBA 3WF6A 1PMVA 4FT7A 1OUKA 2HWPA 3EH9A 3GCSA 4JIKA 3W16A 3FY0A 3NLBA 3QD4A 1Q62A 5EI2A 2OWBA 5J7BA 1TVOA 2VV9A 4G9RA 2OG8A 3ELJA 4FIHA 4DBXA 2V0DA 3EMGA 5HG9A 3LCTA 4FZAB 5CSWA 3GI3A 2C30A 4JDJA 1YHSA 2BTRA 3IDCA 4N57A 2WQNA 3KRXA 4AOTA 4BGQA 2QLUA 2XK9A 2BCJA 2H8HA 2IW6A 3TTIA 4V01A 4F99A 5KHWA 1MQ4A 3LPBA 4O0TA 3FMMA 4WT6A 5EM8A 2OI4X 2XNGA 3MWUA 5AEPA 4ORKA 3LOKA 1UU8A 3R1SA 4O7VA 3ZM9A 4DTBA 5FBOA 5FG8A 4U45A 1JSVA 1UU3A 4FTCA 5I3RA 3R00A 3LCDA 4YC6A 3UVPA 3AG9A 3ZHPC 5JN2A 4CKJA 4M97A 5EOLA 4A9UA 4OTFA 4X2FA 4JT3A 2YIQA 2VRXA 1PXOA 1QPJA 2OJFE 5AM6A 3ZFXA 3H9OA 3PG3A 4W8DA 4D5HA 2PULA 3NMUF 3R7EA 3WI6A 3LFBA 4USFA 1ZYJA 5BVOA 1QPEA 3WBLA 4FSMA 5FD2A 3U8WA 4JQ8A 2BTSA 3S00A 2R3OA 5CQUA 5H8GA 1G3NA 5J87A 1V1KA 4L68A 3FY2A 3JS2A 3NW6A 4IZAA 3RWQA 2OKRA 5IQAA 3T3UA 3U51A 3VBQA 4GRBA 2WTCA 5CU3A 4BCOA 4FKQA 2VO7A 2ZJWA 4G9CA 3FLNC 2ITVA 4MHAA 4MXXA 3TNIA 5JT2A 5IUGA 1OITA 1PXKA 3IG7A 4MCVA 4JQ7A 2O63A 3U6IA 3NRMA 4BTMA 3TIYA 5CVHA 2F2UA 5IDPA 4IAKA 4NK9A 4NW6A 3K3IA 4Q5HA 2C4GA 4CYIA 4KSPA 4EQCA 3QQKA 4L8MA 4F70A 4WOVA 4RPVA 5T68A 3UOLA 3VN9A 3BHYA 5L2IA 2E9OA 3OBGA 1Q8TA 4ANNA 2PYWA 2BRBA 3BLRA 4KABA 3TNHA 1R3CA 4WO5A 3WZJA 4QRCA 4JG6A 1J1BA 1SVHA 4BCFA 4Y95A 2VTIA 3FZSA 4QQTA 3BZ3A 4IMYA 3IW6A 3VAPA 4NL0A 4XEYA 4TXCA 2QVSE 4N70A 3IPHA 5EHOA 2JDVA 3QC4A 2ZM4A 3UOKA 4BCIA 2V7AA 3G2FA 5M55A 2GS6A 4U6RA 4YLLA 5KMNA 4IZYA 1Q97A 4QMLA 2IJMA 4FKLA 2R3JA 3DTWA 3V6SA 1KE8A 2CLXA 4FKJA 5K4IA 2NPQA 4GMYA 4LGDA 5KZIA 4YZCA 3ZLYA 5A4CA 2JIVA 3SVVA 4QNYA 4C58A 3E3BX 4L67A 5FXQA 2Z02A 4IJ9A 2IVUA 4RRVA 2B9IA 3C50A 3DJ5A 5DE2A 2F7ZE 2H96A 5ANIA 2YM3A 3SXSA 4AA5A 2UZWE 3ZONA 4ACDA 4J8NA 5CNNA 5AV0A 3SG8A 3DB8A 5C26A 3CS9A 4RFZA 5I9WA 2YDIA 3NCGA 4Q9SA 2OSCA 5H8EA 3FLZA 3MB7A 2VO0A
chains in the Genus database with same CATH superfamily
1E1XA 4F4PA 1Y6AA 2R3IA 5AV2A 4FSNA 4HOKA 3JXWA 3MJ2A 3KF4A 4FTTA 2YM4A 5M57A 4WBOA 4AG8A 2NRYA 4DFZE 4MK0A 3ZXTA 5HBHA 1DAYA 2PZIA 3O71A 4RMZA 4ZS0A 4PPCA 2HZIA 5J95A 4FTMA 1JKLA 4HNFA 1OKYA 4EQMA 5C01A 3MTFA 1PY5A 3CXWA 4BKJA 3TM0A 1JKKA 2RG6A 2XRWA 3W18A 2QU6A 1L3RE 3FMLA 4RJ4A 2IVSA 3P23A 4WG3A 4ZTHA 4GT5A 5HE2A 4APCA 4F7JA 3EN9A 3UO4A 4A9RA 3W2RA 3FMDA 2A2AA 4FT3A 2R0UA 4QPMA 4X6RA 3VBYA 1FVTA 4IWOA 5M53A 4CKIA 2RFNA 3CPBA 3TG1A 5LVOA 2XNNA 2RIOA 4G3CA 2VN9A 4KKEA 1R0EA 3C4XA 2R3MA 5DRBA 5AV3A 3SW7A 2XM9A 4FVRA 2XNOA 4V0GA 4JBQA 1EH4A 3UVRA 4IZ7A 5IQFA 3U4WA 4E4MA 3DXQA 4G6OA 4E5AX 3W8QA 1JAMA 4H3BA 4C3PA 4O0XA 3UMXA 1O6YA 1OKVA 3CIKA 2OZAB 4D4VA 2PZ5A 3DZQA 4PTGA 3ZC5A 4RVLA 1B38A 5M51A 1P4OA 2J0MB 4D1ZA 3EJ1A 3IW5A 4G2FA 1GZKA 2VTHA 4HGTA 2VWIA 1R0PA 4JJRA 4NIFA 5AIRA 1W82A 4IVCA 5AUUA 5HZNA 4CG9A 3BE2A 1LPUA 2HIWA 3PXFA 3A4PA 4FIEA 3G0FA 4ZSAA 4ZY6A 3FMNA 2XBAA 4QTCA 3FI4A 3QQGA 1T45A 5F9EA 5HCYA 1G8KA 3G51A 4G3EA 2YM6A 3ZC6A 3BLHA 3BLQA 3UQCA 3BPRA 4I23A 1PXIA 4YHFA 3MVHA 2HXQA 5AX9A 4E4NA 3LJ1A 3QZHA 3VUTA 4V05A 1LUFA 4YZBA 2QHMA 3OBJA 3V5LA 2YJSA 4IX6A 2C6OA 4D4SA 5HX8A 3F2NA 1UNGA 5C4KA 5FXSA 3P4KA 4EOIA 4LUDA 2V55A 4X3FB 2W1CA 3RK7A 3MY5A 3RAWA 3TNPC 5CZIA 1PYXA 2YCFA 1H26A 4BB4A 4FTIA 3G0EA 3QKLA 3MFTA 3Q3BA 2WQEA 4FK3A 3QXOA 4P5ZA 4MBIA 3OCBA 3I6WA 2RL5A 4FTNA 5AA8A 2JDRA 5IMXA 5ACKA 3K54A 4DFLA 4QDVA 2YERA 5GJDA 4UWYA 4HGEA 3BYVA 2OGVA 3GXLA 4RA5A 4TYIA 4GKIA 4B6LA 2X6EA 4WG4A 4XRLA 3VS3A 3W2SA 4O4DA 2Q0NA 3OS3A 4KBCA 5EHLA 1NVRA 5TR6A 1OECA 2GNIA 2VD5A 4X2GA 3O23A 3VUGA 3O0GA 5L2TA 4UMRA 3LVPA 4YP8A 1IA9A 3OVVA 3CEKA 3PXQA 3UE4A 4MD9E 3L9LA 5F4NA 4ZJIA 4IAIA 4G3FA 3EYHA 3RHXA 4B8LA 4RIOA 5AAEA 4E7WA 4NCTC 1G8SA 4W8EA 5CNOA 3PP0A 1KE5A 4D2PA 5JFSA 3DY7A 1ND4A 4YZ9A 5BNJA 2HK5A 4K6ZA 5H2UA 1Y8YA 2Y0AA 3A7JA 3VQUA 4RWLA 4ANMA 4DGNA 2PHKA 2E9VA 2NRUA 3EQIA 4QNAA 2OXDA 5FTQA 4NFMA 4RZWA 3RCJA 1H07A 3FZPA 5GNKA 2X8EA 3HGKA 3QUEA 2XP2A 3I6UA 2XUUA 4MWHA 4PDOA 3I79A 3MFUA 3PUPA 4RC3A 3A7IA 3VRYA 4AA4A 1K9AA 4C59A 4CXAA 4CYJA 3EWHA 2XA4A 4F0GA 3A7HA 1GIJA 2WNTA 3QTXA 5HIBA 4ALWA 1OBGA 1U59A 2XIRA 3BQRA 1QMZA 2XS0A 3W10A 4O7SA 4J96A 2P0CA 3IECA 4B7TA 1PXLA 4FSRA 5EQEA 1QPCA 2QU5A 1P5EA 1WAKA 1NA7A 2GDOA 3DLZA 3FDNA 4FKOA 5CT0A 3GFEA 4D55A 1NW1A 2B9JA 3F3VA 4IXPA 1GNGA 3QLFA 1M2QA 3EN7A 2C0TA 4Y85A 4DTKA 4M69A 2ITUA 4H39A 1ERKA 4AW1A 2OJJA 3EIDA 5I4NA 3ALNA 4X2NA 2RG5A 5AR8A 4ITIA 2IF8A 2QOIA 2WMQA 4QQJA 3BL7A 3NFGB 4MXAA 4GFOA 3HA6A 2ITPA 3LCSA 1I09A 5CVFA 4WD5A 3KXGA 4DLJA 2R3NA 3O17A 4R5YA 1KE7A 3UMWA 3OWJA 3R01A 4CFVA 5GIOE 2JIIA 3HP5A 4IM2A 3I5NA 2JDTA 4XUFA 4MVFA 4YUQA 2WMBA 5AUVA 5L8LA 5D11A 5IISA 4S33A 3PVWA 3LM0A 3QQHA 5HBEA 3D2KA 2GQSA 3D9VA 2OH4A 4KS8A 1M2PA 5AV4A 2UW0A 4EHGA 3DAEA 3MBLA 3PIZA 4AGUA 3DGKA 4HPTE 4U0IA 1M7QA 4Z55A 2CSNA 3ROCA 3DKFA 4W4WA 4J98A 3GU6A 1RQQA 2XALA 4YJPA 5LARA 4YO6A 4U3ZA 4USEA 3R1QA 2WGJA 4IE9A 2UZBA 1XH4A 3NIEA 4OLIA 5L8JA 4CLIA 1OL2A 5BV3A 2QKWB 3UBDA 4KAOA 1YXXA 1OL6A 5IH5A 5CENA 3KXHA 2OF4A 3KULA 2B54A 3RPRA 4YGAA 4MBJA 4JRNA 1WBOA 3O8UA 3WE4A 4YTCA 4LRJA 1ZZLA 2HW7A 4L46A 1ZYDA 3WIGA 5CAOA 3Q96A 3A62A 5CAQA 3ZH8A 4QTBA 4CV9A 5HO7A 2JDOA 1UNHA 3CY3A 2OICA 5CU2A 5J9YA 3D5XA 2EXCX 1LR4A 1IASA 1A06A 2ITNA 2ZV2A 3KXMA 3GUBA 3P5KA 4IAAA 4IAYA 3L9PA 1MQBA 4A4OA 4YO4A 4U8ZA 4E1ZA 2JIUA 2R5TA 3QGWA 4XCUA 3O8PA 2W1GA 3R30A 2OK1A 4M84A 5DOSA 2W7XA 3BYOA 3OFMA 4H1JA 2VTSA 4KKHA 4L53A 4TPTA 5CAVA 4ASEA 4J52A 3VS5A 5F95A 1TQIA 4EBWA 3PY1A 4JDKA 4I5PA 4F1TA 4YJTA 2PPQA 4OTHA 4GFGA 4ASDA 4HZRA 3R8ZA 4LV8A 4RIWB 3F3TA 2XK3A 5E9EA 4S34A 3OD6X 3THBA 4D1XA 3DBQA 2GMXA 3FYKX 5CASA 1GY3A 4C61A 2WHBA 4OBPA 4AGWA 2B55A 3C5UA 3LXLA 4RIXB 3QTIA 5DH3A 4ENXA 3UO6A 2R3QA 4BYIA 3AC1A 3BQCA 5E1EA 4YC3A 1IAJA 5DMZA 4X0MA 2HY0A 2IEWA 4BC6A 1FVRA 3R22A 1YDSE 4FNZA 4HVSA 1H0WA 2W0JA 3C4FA 3HV3A 3DV3A 4JAJA 2PUNA 3PE2A 3FAAA 4O81A 1QCFA 4EH2A 4GK2A 4MXYA 1W0XC 2ONLC 3FQSA 3W1FA 4YSJA 4FSYA 3G5DA 4MNEB 4I6LA 3HKOA 2X4FA 3PFQA 5DN3A 3CQWA 5HOAA 5AR4A 5ACBC 3KVXA 4RGJA 2UV2A 3PPJA 3E8DA 3ODYX 4F0FA 2XJ0A 5BVFA 3EN4A 2R2PA 3PP1A 1Q8YA 4QMYA 4AZSA 4ASXA 5DHJA 3FE3A 3LMGA 4BF2A 1Z57A 1XH9A 5EYKA 1Y57A 4ITHA 2CNUA 2O8YA 3P79A 3QLGA 2ITZA 4B99A 5EKNA 1BI7A 2GTMA 4DN5A 4PNIA 4XJ0A 2J50A 4DBNA 3DXNA 4DHJA 1RW8A 3R73A 4K11A 3GCQA 4JQEA 4X6QC 1Q3DA 1IAHA 3AQVA 4HYUA 4D2VA 4F1OA 1OGYA 3F5GA 3GCVA 1CSNA 1U54A 1WVYA 4F9WA 3O8TA 3MV5A 1Q5KA 4QQCA 4UWBA 1H0VA 4YBKA 1SMHA 1Y8GA 4C4FA 3ACKA 4OR5A 3OXZA 5KMIA 3RAHA 4XH6A 4NH1A 3EN5A 4FV5A 2BHEA 3F9NA 5C8MA 1XHAA 2C3LA 3RBWA 3D83A 3UC3A 2VNWA 1XMMA 4DH5A 4ACHA 5HI2A 4O0UA 1Q24A 4AW2A 4QTAA 4BTKA 1CM8A 5IA2A 4FOCA 4NW5A 5FM2A 4DGGA 4YC8A 4M3QA 4C57A 3UGCA 3V51A 3GC9A 4QO9A 4S30A 4XP3A 4DFBA 3PZEA 3SKCA 4FR4A 4C02A 2C5VA 4B9DA 2GHMA 2YCQA 4CZTA 5JQ8A 4BDFA 3SW4A 3O51A 4DGMA 4TL0A 4FEUA 4CD0A 5FM3A 1H1SA 5DYJA 4FT5A 1XJDA 4O91A 3ZSHA 2GQGA 2YJRA 3HMMA 4PNKA 2ITQA 4PL5A 3SV0A 2CCHA 2PZPA 1XO2B 3R7OA 4A9YA 2RFEA 4AZTA 5H3QA 2QURA 2OW3A 4IWQA 1OMWA 3VJNA 4MX9A 3QU0A 3H9FA 4U43A 5HE1A 4B4LA 5J9ZA 3NR9A 4QP8A 5JFXA 1TQMA 3V6RA 3PRIA 3N51A 4HGSA 3IOKA 4GFMA 3DT1A 4BCKA 3PFYA 4C3RA 3ORPA 5A46A 3EQDA 4AACA 4CT1A 3RPVA 5EDRA 5E8UA 4BDDA 2KTYA 3HYHA 2VTRA 5HLPA 1VZOA 2PMOX 4NM0A 3VS4A 4ANSA 4LV7A 1YWRA 4FICA 3VULA 3GNIB 4O1OA 4ZJVA 4AN2A 3D5UA 4FJVA 2J2IB 4GG5A 2Y7JA 2ETRA 2QI8A 4O38A 4WKQA 4C37A 1V0BA 4KUJA 4OW8A 3Q9YA 2IVTA 4JOAA 2H34A 2J90A 1V0PA 3RM7A 4LOQA 2JKOA 2VWYA 2XZSA 2B9FA 3LFNA 3BV2A 3BU5A 4O2PA 5KUPA 3W33A 3VNTA 3CQEA 2ZV9A 5ANOA 4QYYA 1P14A 4A06A 4IH8A 1WBVA 4ANQA 3V3VA 4FEVA 2YLEA 3COIA 3RJCA 1LEZA 3R9HA 1R1WA 2J0KA 1HCLA 4PF4A 3KIOC 1OPLA 4ZP5A 2AC5A 3NW5A 3NYOA 3FWQA 3OZ6A 3PVGA 5C27A 2X81A 3ZZEA 3D7TB 2AYPA 3I4BA 3R71A 4F6SA 2JFMA 2PMIA 3IONA 3QQLA 2GCDA 3G9LX 5FP6A 4IC8A 3W0NA 3KEXA 5JZNA 4FA2A 4BI2A 4AOIA 3TNWA 2QO9A 3NX8A 3G90X 4LRMA 4PRJA 4X21A 5LOHA 2OLCA 2CN5A 2JD5A 3GOKA 1IR3A 4NZWB 2YCRA 4TYEA 5E91A 2PE2A 2FSMX 4IB1A 2EB2A 2UZNA 5TO8A 3RMFA 5L3AA 4FG9A 3R9NA 2OH0E 1VJYA 4AX8A 2R3PA 4YJVA 2G1TA 4FL3A 4FZ7A 2OJIA 4GJ3A 5E7RA 4ZSJA 5IQBA 3IGGA 2PUUA 3NUYA 4R3PA 5KMMA 1ZRZA 3W0PA 2GSFA 5HU9A 3C4ZA 3IGOA 5EOBA 4LGHA 4EHEA 4QOXA 2UW8A 2WB8A 4PMSA 5DNRA 5B2LA 4WNMA 4G34A 4LUEA 5DPVA 4O7ZA 4R7BA 4EL9A 3ZOSA 3OT3A 4RG0A 5KO1A 3AT4A 3NVMB 4K1BA 1XH8A 5HU3A 1Q3WA 1PW2A 1FQ1B 3R1NA 5LMKA 5D12A 5JSMA 3DS6A 4UX9A 2BPMA 2WPAA 4XLIA 3OG7A 2CKQA 3I60A 4MUQA 2PUPA 3D5WA 3DK3A 5DG5A 4EK8A 1PKDA 3UZTA 3P7CA 5C4LA 4I5CA 2E2BA 4I6BA 2G9XA 5IMEA 3DZOA 3D0EA 4EOJA 3I81A 3NNXA 3TV7A 2QG5A 2BILB 2Y4IC 3PY0A 3MN3A 4UMTA 5FQDC 4DG2E 4U80A 2CGWA 1IA8A 4FZDB 3UOJA 2JBOA 4YMJA 4AAYA 4FKUA 5K0KA 2XANA 3QCXA 4FT0A 4LL5A 3U87A 2GNFA 2I0YA 3HUBA 4GYGA 4UV0A 4WNOA 4WIHA 3SA0A 4UYAA 1SZMA 4UZHA 4FSUA 2YM7A 4MF0A 3NUNA 4CTCA 4BR3A 1OPJA 5LVLA 4MNEA 4ITJA 4PMTA 5HEZA 4DLIA 1B39A 5DIAA 2XBJA 1KE9A 3F2AA 4JNWA 3UIUA 4XOYA 1M14A 3FMJA 1CTPE 4RX9A 4LRKA 4UB7A 4BY9E 3QXPA 3UC4A 1ZARA 3VQHA 5EI6A 4DG3E 3R04A 4U3YA 1Y91A 2RGPA 3M42A 2VWBA 4MNFA 3MGYA 4RIYB 3RK5A 3NWWA 4O21A 3DU8A 3I0QA 3KN6A 3R7GA 4GVAA 4B8MA 2PVMA 3UQFA 5L6PA 2XARA 2XIKA 2IZRA 5FEQA 3FJQE 4XLVA 3UG1A 2CLQA 3BYMA 1RE8A 4DTAA 2AUHA 2H6DA 5FDPA 4C33A 3IOPA 3QCQA 5HICA 2GU8A 3FMEA 3DBFA 2LAVA 2PK9A 2XRUA 4O7NA 4ACMA 4O0WA 3OC1A 4QP2A 4LG4A 3PPZA 2YABA 4P7EA 2XNEA 3VBXA 1JKTA 1OIYA 5TF9A 5IQGA 4C62A 3HRBA 3AD6A 2GS2A 1H8FA 2IVVA 4IVBA 4HVDA 3BWFA 3G6GA 4S2ZA 4FZ6A 1ATPE 4AZFA 4ZY4A 1A9UA 4KIPA 4D9UA 5HG8A 3R9OA 3HV4A 4ZXTA 5EW8A 4DGOA 4DEHA 5CEMA 3QTRA 3VBTA 3ZEWA 4XV2A 4ZJJA 5CALA 2UZEA 3GT8A 4FIGA 4F6WA 4M7IA 4RA4A 2ERZE 4P4CA 2W4KA 3L8XA 4GVJA 4R3RA 3SRVB 4OAVB 3AD4A 2J5EA 3CKXA 4XG7A 3ZLSA 5AADA 2XIXA 3TNQB 1WVWA 4EORA 4H05A 2ZM3A 3MFSA 3QKKA 1OL5A 3O7LB 2EVAA 2X7FA 4AZWA 4DEBA 5AX3A 1MRUA 5BYLA 4FTUA 4AT3A 3HAMA 2X7OA 5L8KA 2XAMA 2YIXA 2J0JA 3QL8A 4FSZA 3DBCA 1G8AA 4TW9A 2LGCA 2ZV7A 2W1ZA 4BWXA 3VUDA 4EYJA 3W0RA 3Q9WA 2WTIA 4C38A 4QP7A 3LHJA 5IH4A 4UXLA 1Q61A 3DKGA 3NYVA 4EUUA 3T8OA 3OTVA 3UQGA 3GU7A 2X4ZA 3DAKA 3JYAA 4ZZOA 4O4CA 4EH4A 3AC8A 2XB7A 1DS5A 1S9JA 2YM8A 5B7VA 4F78A 5CSHA 3VUHA 1UWJA 2QQ7A 1OL7A 3FKLA 1F0QA 2BZKB 3D4QA 3AKKA 3PG1A 2J51A 5CAUA 4C3FA 4XG6A 1SVGA 2QKRA 4OTDA 3ANRA 4O7RA 5HO8A 3UVQA 2JC6A 1Z9XA 4EKKA 5ETCA 2XK4A 3QC9A 5CQWA 3KRJA 4PPAA 1PRYA 3MESA 3QUDA 4FEWA 3WOWA 3GU4A 4Y73A 5AP1A 3RPSA 4UY9A 1L8TA 4HVHA 3WARA 4PMMA 3FV8A 3F5PA 4JG7A 5AUWA 3TJDA 2HWOA 4LOOA 4NJDA 4QMZA 2ZMCA 4BCPA 4O0SA 5JKGA 5J79A 3D5VA 1GOLA 3FC1X 3ZO2A 2ZB0A 4U5JA 4R6VA 1WBPA 4CRSA 3TUCA 4OBOA 4I4EA 4FK6A 4A9TA 3KKVA 2JITA 3NGAA 4QMVA 1JVPP 4YSMA 1CKJA 1RJBA 2R64A 2ESMA 2XAOA 2ZAZA 3QRJA 4MBLA 4HCVA 3ZM4A 3LLTA 3ORKA 2ETMA 5DT4A 3ZLXA 1KV2A 4CFXA 4KIQA 3V5QA 5C9CA 3SDJA 3KU2A 4DYMA 4QQ5A 2VTJA 4UMUA 4YURA 5L4QA 4DF3A 3F7WA 3FXWA 3DNDA 2J7TA 2P33A 5D1JA 2RKUA 3IW8A 1PXPA 4IDTA 1ZMVA 3NUXA 2G2HA 3Q04A 2C68A 5IEXA 1Z5MA 2FO0A 4IB3A 2WIPA 4CFNA 2B0QA 3G6HA 3Q4CA 5HGIA 3COKA 1W83A 3BCEA 4FRFA 3TACA 3WZDA 1YI3A 4DHIB 4FL2A 3W0OA 3UIBA 1SM2A 5EDQA 5DR2A 3KK9A 4AXFA 4YLKA 2VX1A 4H3QA 1MP8A 4K18A 5K3YA 5EDPA 4AS0A 2UZLA 4RWKA 2C5XA 3FL4A 4CKRA 2X0OA 5JGAA 3QTQA 5HLNA 3RM6A 4O4FA 4UBAA 3W2QA 1YWVA 3RTPA 1ZWSA 2GNHA 2QOKA 4MKCA 4ZTSA 3E93A 5CVGA 3U9CA 2FH9A 4ZZNA 5HVYA 3VWAA 2UZUE 3DAJA 5CWZA 5A54A 2BRGA 2PU8A 4IM3A 1M2RA 3BYUA 4YU2A 2J0IA 2XEZA 2FSLX 3DQWA 3OY3A 3N9XA 3Q5IA 3OCSA 3QF9A 4I41A 3UO5A 1TFFA 4MF1A 5FLFA 4C0TA 3OXTA 3PA5A 1KOAA 1E1VA 3LFCA 4O1PA 3NEWA 4C4HA 3JY0A 1APME 4AGCA 4M12A 2HENA 3ZFMA 4ONAA 3OOGA 4LI5A 1REJA 4Z7HA 1Q8UA 2VWVA 5DBXA 3UDTA 2FB8A 4QYHA 4N0SA 3RNIA 3R21A 4CFUA 4D28A 5HIEA 4FUYA 5ANJA 1QL6A 4C8BA 1YOLA 4QPAA 1ZLTA 2WTDA 4FSQA 4NFNA 3ZMMA 3NDMA 4BWPA 4AF3A 3L9MA 4TN6A 3QA8A 4AU8A 4FX3A 4DT9A 3KCFA 2R3KA 5AR3A 3PTGA 4YZMA 2NO3A 5KMLA 4G6LA 4PPBA 3R6XA 2FSTX 2JDSA 3QALE 4XMOA 2C47A 1OIQA 4ZTLA 5BMSA 2W1HA 4MQ2A 5E4HA 3MW1A 4LQMA 4O22A 2IPXA 4Y5QA 2OU7A 2UVXA 4DCAA 2QOBA 4DA5A 2XKFA 4MXOA 4W9WA 5LVMA 5DFPA 3KRWA 2GNLA 2Z2WA 5BVEA 5BQ0A 4I93A 3MH3A 4J95A 5AP0A 3TMOA 4UWCA 3DPKA 5DT0A 3PZHA 4FUXA 5G6VA 3BU3A 4BI1A 2FUMA 4AFJA 4L52A 3EQPA 3QWJA 2B4SB 4NJ3A 4RLLA 3R8VA 3PVBA 3VS0A 4AP7A 3POOA 4CEGA 3ZUUA 3SOCA 3VJOA 3NS9A 4BIDA 3GVUA 3DFCB 1S9IA 4K8AA 5C8NA 3PVUA 4JIAA 1QPDA 3KK8A 2HZ4A 4UXQA 3ZU7A 5BUEA 3AGLA 3I1AA 4LGGA 2HXLA 2DQ7X 5D7AA 4EK4A 2O5KA 2YAKA 3H4JA 3I5ZA 3QHWA 4M15A 5FTOA 3OY1A 5HVJA 4DC2A 3WF7A 1W7HA 3EFWA 3S0OA 2BIKB 4IAZA 5EM7A 5KBQA 5I3OA 5TT7A 4CZUA 3R2BA 2PVJA 1J91A 4QD6A 4QP1A 4FV3A 2WQOA 4J8MA 4ZTMA 2NYAA 3KRRA 4XHKB 1JKSA 3TIZA 5E8WA 4AW0A 5LCJA 2PZYA 2OIQA 2W1FA 4I94A 4ZTNA 1H1RA 2W06A 4FYOA 3DKOA 3COHA 5AMNA 4CNHA 2GNGA 3AC4A 4BI0A 1H1WA 4E6QA 4W4YA 5KX8A 2X0GA 4IZ5A 1OIUA 4PDPA 5J8IA 4PDYA 3PJ2A 4E4XA 3R8PA 2C6EA 1ZYCA 2ZV8A 3TXOA 3ORIA 5AJQA 3FXZA 4HYSA 4QP6A 5A9UA 5CZHA 4QYFA 5IQCA 3CTHA 4I24A 5EK7A 2WMUA 5KZ0A 2HCKA 5LMAA 4XG2A 3NIZA 3FEGA 3IKAA 4BCJA 2VWUA 4F09A 3CCNA 4MWIA 1PYEA 4OTGA 4F9CA 3IW4A 1UU7A 4YBJA 4IBMA 4PWNA 3LZBA 2G2IA 4AZEA 1OVEA 2Z7RA 3F5XA 4WSYA 2QR7A 2JFLA 3QTWA 1KE6A 4H36A 4YJSA 2JBPA 5JK3A 4M0YA 2W1EA 4IWPA 4I3ZA 2WKMA 1UKIA 3L8PA 5FGKA 4O6EA 4TWOA 4AN3A 4RQKA 3OMVA 3VW8A 3DK6A 1FPUA 2QOLA 3UODA 3FLSA 4FEQA 5AR5A 4F7NA 4PX6A 2ZFYA 5IQDA 4Q5EA 4QP4A 1DI9A 2VTLA 2AEGA 3R7YA 1YKRA 3C0HA 2VWZA 2WMTA 1XQZA 3M1SA 3CJFA 1OBDA 3IK3A 4L42A 4HGLA 3IO7A 2C5OA 5M4FA 2R3FA 3OW3A 3EQGA 4TNDA 3NNUA 5DVRA 4BHZA 1TZDA 4TWPA 2V5QA 2Y6OA 2OO8X 2XCHA 4OTQA 4XRJA 5BVNA 4JBOA 5HIDA 4EJNA 4JDHA 2EXMA 4JI9A 4FV0A 2IW9A 4XG4A 4E3CA 4DG0E 3GCUA 3Q4TA 4BTJA 3OWLA 2E9PA 5FEEA 4ANOA 4DEIA 4ZS4A 4MAOA 3ZO1A 2BKKA 4QP3A 4YJQA 3AGMA 3DJ7A 4AN9A 3DK7A 3UP2A 3ZO3A 3ET7A 4UMPA 3UJGA 4CGAA 1Y6BA 3ANQA 5F1ZA 5CU4A 2IZTA 4AT5A 3UPZA 2GNJA 1YI6A 3FI2A 5LVPA 4U81A 3FPMA 4J1RA 4PUZA 5IA0A 3W55A 4C34A 3EFLA 1PXJA 1R78A 4ZLOA 1URCA 3A2CA 1BLXA 4FKRA 4KIKB 4A4LA 4XV1A 3PJ3A 3BGZA 3U54A 3BHUA 4ZMEA 1PF8A 1CKPA 3NW7A 3WF5A 2WMVA 2C1AA 2BFXA 3QGYA 4ZTRA 2PZRA 4XX9A 3FI8A 5I9ZA 5IA4A 5DGZA 1ZXEA 2PVKA 5TE0A 1UKHA 2FVDA 2OIBA 2P2IA 4UZDA 3R8LA 2VUWA 5C03A 2O64A 3EQFA 4M68A 2XM8A 2OXYA 4BJJB 2XNPA 3RCDA 4L3JA 4OTPA 4YJRA 5DLSA 2C6KA 2ZB1A 4H3PA 5EYDA 3LFAA 3OT8A 3W8LA 1Q8ZA 3TKIA 4G6NA 2BHHA 3HZTA 4FTOA 5EFQA 4BZNA 5ICPA 2PE0A 1J1CA 2IWIA 4A07A 3LLAA 3EN6A 4O2ZA 4O6LA 2ITWA 2QC6A 3RZBA 4D4YA 3AMAA 4MXZA 3CLYA 3FZTA 4AE6A 4YR8A 1KUTA 2RF9A 2OZAA 4QMXA 2GTNA 4EJ7A 3WZEA 4DCEA 1J7LA 1GZOA 4YHTA 3E64A 2VTTA 3FYJX 4BN1A 2W1IA 5TKDA 4RX5A 2XNBA 2BAKA 3BI6A 2OF2A 4R8QA 4EH6A 4GYIA 5J5TA 3DBEA 4EC9A 4CCUA 5FBNC 2FYSA 3Q32A 3Q6WA 4O27B 5KBRA 3PJCA 3SHEA 4BDKA 3QWKA 3UDBA 2XCKA 4EYMA 4O7TA 4HYHA 3TN8A 5IEVA 1ZMUA 5K4JA 3CPCA 3LFEA 4LDTA 4P5QA 4FKWA 4HCTA 4UN0C 5J1VA 5DI1A 1JBPE 4BGHA 1W98A 2BFYA 3NCZA 5F94A 3LFFA 4FTKA 4AT4A 2BRHA 3QD2B 3H3CA 3DNEA 4IAFA 2PMLX 2Y4IB 4X3JA 1X8BA 4X3FA 5CTPA 1TQPA 1W2DA 3CQUA 3P78A 3PWYA 2XEYA 2NNWB 4RJ3A 2BAJA 4A9SA 3GC7A 1SNUA 4ZEGA 3CTQA 2PVHA 5HD4A 5LCKA 5CSVA 2BZHB 5DEWA 3WF8A 1URWA 2IZSA 1XWSA 4OTWA 3NAYA 4FNWA 2YIYA 3S4QA 4DEGA 3GENA 2ERKA 5LQFA 4FTQA 3VC4A 1I44A 1B6CB 3TV6A 2C6DA 2Y8OA 4RVKA 3S2PA 4CMUA 3R8UA 3ENHA 4KBKA 5IDNA 2WTKC 4OTIA 4KKGA 2YWVA 5AP7A 3NUUA 5TOZA 4F6UA 4GL9A 3AMBA 4NTSA 3JR1A 1NVQA 3NNWA 3OP5A 4TT7A 5HTIA 3CKWA 2YFXA 4GSBA 4UALA 3VVHA 2BVAA 4I6FA 5IA3A 2YISA 3NYNA 1FMKA 5KCVA 3C4EA 3MIYA 4F65A 5A4QA 2W5HA 3ATSA 2QOFA 4FV6A 3U6JA 1PMNA 2BMCA 3KXNA 2PVLA 4WA9A 2RSVA 2PY3A 3AC2A 4BCNA 5M4UA 4YTHA 4K77A 5CEQA 4JR7A 2XIYA 4AOJA 4C36A 4R7HA 5DR6A 2CKOA 2VX3A 3DDQA 3KL8A 3FLYA 4EI4A 1BL7A 4TWCA 3QQFA 1U5RA 2B1PA 4EOOA 1SVEA 3BEGA 3MFRA 3P9JA 3S95A 3DJ6A 5AR7A 3RPYA 4ID7A 1GJOA 4IB5A 3V5TA