4GEOA

P38a map kinase def-pocket penta mutant (m194a, l195a, h228a, i229a, y258a)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
326
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIAANWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDAADQLKLILRLVGTPGAELLKKISSESARNAIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title P38a MAP kinase DEF-pocket penta mutant (M194A, L195A, H228A, I229A, Y258A)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 326
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4geoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4geoA01
4I6QA 2BALA 2F9GA 3QWJA 3SLSA 5KKRB 4IFGA 3C50A 5CU2A 5A6NA 5KBQA 5M4UA 1UNGA 2QU6A 3W2QA 3O71A 4JAIA 3VS1A 3O51A 4L7FA 2BROA 2B9IA 4V0GA 3DPKA 1PF8A 2B53A 4CG9A 2ERZE 2VO6A 3G9NA 5JGAA 1J3HA 3VN9A 3PY0A 1Y57A 3WI6A 4BDGA 3TEIA 4RVKA 1ZZLA 4PPBA 3U4UA 5DT3A 4F1OA 3RKBA 3DAEA 2X8EA 1GOLA 2YAAA 5I0BA 2FSMX 4PY1A 2E9VA 5AA9A 2O65A 3OXTA 1NA7A 2ONLC 3PJ2A 4KAOA 1GY3A 4FVRA 2Z60A 2PVKA 3VS3A 4HNIA 2FUMA 2EB3A 3EZVA 5E8YA 5L2WA 4RWLA 3BGPA 2X0GA 5T3QA 3LCDA 4LOPA 5I9XA 5AV3A 3ZCLA 3SGCA 5AR3A 4E4MA 4XRJA 4CRSA 3NUUA 3R6XA 3L8VA 2ESMA 3TJDA 5ITAA 1S9JA 3R8LA 2I1MA 3HRFA 3P4KA 4CZTA 4EQMA 2W99B 4JBOA 4EUUA 3PXZA 3F7WA 2VX3A 2Y4IB 4IDVA 5IA4A 3CEKA 3GENA 4O7RA 4WRSA 1UU3A 3BE9A 3F3VA 3C9WA 4FC0A 3FXWA 4UV0A 4DFLA 3KRLA 4F9AA 3TNWA 4FGRA 4KKGA 1CM8A 3FI8A 4L6QA 3AC2A 3N51A 4ZTSA 3SG9A 4CFMA 2X7OA 4QQTA 4CKIA 2WB8A 4HGSA 4O27B 5J9LA 4QO9A 2PVFA 3RCJA 3TNPC 4M13A 4K77A 3VHKA 4YU2A 3LM5A 3D14A 4LV5A 2XNGA 1OVEA 5DOSA 4BZOA 2VTMA 4E6QA 4DGMA 3P0MA 3IK3A 3LHJA 4HGTA 3W10A 2ITQA 4BB4A 4U9AA 2J4ZA 1JAMA 1MRYA 1WBWA 3K3IA 3R8PA 4AOJA 2C5YA 3IOKA 4C4GA 2AC3A 4WNPA 5CENA 2JKKA 2R9SA 3POOA 4ANQA 5FD2A 3REPA 2G2FA 2RG6A 3BLQA 3EHAA 4BDCA 4HCUA 4IVCA 2P4IA 5F9EA 5LWNA 4U42A 4YZNA 2A4LA 2OF4A 1OUYA 4USDA 2JBOA 3L1SA 4YNEA 3GC9A 5AADA 2YM8A 5ACKA 3MB7A 3MJ2A 2HXLA 3BIZA 3Q04A 2YN8A 5JRSA 3AC3A 3FI4A 2G01A 5EQYA 2W1IA 2HW7A 5D12A 5FEDA 5HE1A 4YP8A 3GEQA 4MCVA 4QP3A 4TWOA 3KMMA 3UIXA 3WYYA 3DZQA 3A4PA 3BRBA 3DK3A 2X9FA 4BF2A 5I3RA 3DCVA 2JC6A 2OIQA 1XR1A 4FZAB 4BTJA 4RWJA 1XH4A 2W4JA 3RNYA 2OI4X 3MFSA 3ZUVA 3UG2A 3CPCA 3W1FA 2OZAB 4L46A 3EQDA 4XV9A 2GNIA 4PTGA 4N70A 5IA2A 3NDMA 2XB7A 3QCSA 4RA5A 1WBVA 2OU7A 3ODYX 3MVHA 4U40A 3RPOA 4I92A 5KHXA 4XG7A 4XJ0A 4DF3A 4EH9A 4R1VA 5LXMA 1SVGA 2VTPA 2O64A 5AP2A 3WBLA 4FBXA 5HZNA 3FHRA 1XQZA 4YPSA 4D9TA 2GTNA 4U8ZA 2OK1A 3RMFA 2XH5A 2W9ZB 1K3AA 2X9EA 4FTUA 4QD6A 4YJRA 5AM7A 4HPTE 3WE8A 2B0QA 3TM0A 3LFNA 3NSZA 4O84A 4C4IA 1O6LA 1ZOHA 4GCJA 5DR9A 3ZS5A 3BU3A 5J8IA 4ZJIA 3RPVA 4AACA 1FMKA 4F7NA 1GZOA 4GJ3A 4QMPA 5H8EA 2CCIA 5M51A 4ZS0A 4KIKA 1STCE 4FSRA 2HIWA 2WXVA 3FQEA 3RPYA 4CMOA 3ZONA 3PPJA 3F5XA 5CEIA 3QQUA 4H1JA 3C0HA 5L6WL 3BGZA 4IZ7A 2W1ZA 3LFBA 4C36A 4B99A 4CFVA 5A9UA 4LMNA 3P08A 2F2CB 3UJGA 5HTIA 2QONA 2C5VA 3ZTXA 3GCQA 4JQ7A 3V51A 4C34A 2PZ5A 4X2KA 4XNEA 4BIBA 4BRXA 4IJPA 4RBLA 3NW7A 4ASXA 5CF8A 4NL0A 2C6DA 4C4HA 2CGWA 3VUGA 4XX9A 3PYYA 5AM6A 1PXKA 1VYWA 1KV1A 4E3CA 4B9DA 3EYGA 4ZS4A 4QPAA 1V0OA 4F6SA 3HV4A 3CKWA 4YBJA 5ETAA 3ZO1A 3NW5A 5LQFA 4L68A 3MY0A 4D2SA 2Z7SA 2UW9A 3BHUA 3QTWA 3IG7A 2E9OA 4FKWA 4JNWA 3LFFA 4TRLA 5CTPA 4X2JA 4P4CA 4XG9A 1YXSA 2YLFA 4FL1A 5CI7A 4O7ZA 5AP7A 1H26A 4HOKA 2E2BA 5I9ZA 3G9LX 5EKNA 2BHEA 2C0TA 4BCIA 4BWXA 3NVKI 4LUDA 1T46A 1WZYA 2ETMA 3G33A 5EDPA 5G1XA 1DM2A 2HOGA 3HMNA 4Y95A 3FKLA 4G9CA 4K9YA 5AFVA 3C7QA 4QTDA 4RFMA 3ZFMA 4FTKA 3U4WA 3UMWA 5AV0A 4EH2A 4DYMA 3ANQA 3JS2A 4FGBA 1Q62A 4AT5A 4MBJA 4KIPA 3IPHA 5AP4A 3ZM4A 5F4NA 3WZKA 5CXHA 2OXXA 2Y6OA 1G5SA 3QRUA 1YOJA 4OTIA 2ZDUA 2ITVA 3FLQA 5LVOA 4X3JA 5IUHA 3D5XA 3FBVA 3K5UA 5H8GA 2QVSE 4O0UA 5DFPA 5C9CA 4AUAA 4JS8A 2FO0A 2P0CA 2WTIA 3IGGA 1UKHA 4KA3A 4EHZA 4R1YA 4KS7A 5AUVA 4FIHA 4LOQA 4Y8DA 5K4IA 4EH7A 5K4JA 2HZIA 3MVLA 3TJCA 1ZAOA 4FKOA 1X8BA 4TWPA 1G8SA 2X4ZA 3OWPA 3Q6UA 4OT5A 3S0OA 3GGFA 1PY5A 3ZO2A 4PPCA 5LMBA 2JIVA 1YHSA 2VTIA 3UNKA 3LXKA 5JFWA 5CEPA 2RFNA 5KCVA 4QQCA 2FSOX 3PXYA 3CR0A 4QRCA 3FHIA 1ZMUA 2QOFA 4NJDA 3UTOA 5TF9A 4BGGA 5BMSA 3PVGA 4QP9A 3WF8A 1R78A 1YXVA 1VJYA 2OICA 4JIAA 3D5UA 4LGHA 5KZ0A 3GCPA 3UOHA 4YZDA 5LVMA 2BIKB 5EI2A 3PG3A 1W0XC 1YDTE 3PWYA 3W33A 4AW1A 2OBJA 2CGVA 2XYUA 4ZTHA 4DG3E 3FY0A 5IA3A 2CDZA 1Q24A 2RFDA 2RFSA 2GNFA 4R6VA 5HICA 2X2LA 3QFVA 4FEQA 4FIGA 4IWPA 1UNLA 2HXQA 5EYKA 3GC8A 4C4JA 1RE8A 3BHHA 3KCKA 4QMNA 4ZTNA 3Q2JA 4Y83A 3BYUA 2VWYA 5F1ZA 4AZTA 4CFXA 4CLIA 4Z16A 3R00A 4MKCA 3QC4A 2XNNA 4LMUA 4AN2A 5IQBA 3DV3A 3TIYA 3LKMA 5AAFA 4F65A 5I9WA 2J9MA 3EMGA 4I5PA 5EDRA 2BAJA 4CT2A 1MP8A 5KHWA 5J5TA 4TYEA 2PVJA 3FC2A 5CVGA 3SDJA 3IO7A 3Q4UA 1TVOA 3OY1A 2DUVA 4Y46A 3DOGA 3TKHA 3RAKA 3T9IA 4RJ4A 5AUUA 2R64A 3R9HA 4DFYA 4O1OA 2VNWA 4DG0E 3IQ7A 3P78A 2XKDA 2XK7A 4NW6A 5LMAA 3RPSA 1CKJA 4YTFA 1F3MC 4S2ZA 1CTPE 3ID6C 2PVHA 4WA9A 3OOGA 2W1HA 4JXFA 5HBEA 2VWWA 3CJGA 1ZRZA 4UWBA 4Y5HA 5M06A 3HEGA 3LFEA 2W5HA 2VTLA 3G2FA 3RHKA 4BDHA 4DTBA 1OZ1A 3ROCA 2XEYA 2JDVA 5TOZA 3U55A 2QU5A 3LQ8A 4C33A 1M52A 1IA8A 5BUEA 4CKRA 2QOHA 1FINA 3BYMA 3F2NA 1OB3A 2BTRA 5FEEA 4C57A 3JVRA 4PUZA 4EOOA 3KN5A 2CMWA 4KBAA 1ZARA 3MH3A 4NSTA 3N4UA 1MQBA 3DBFA 4R8QA 4RIYB 4J7BA 4AGWA 2R0UA 4F0GA 1PKDA 3KK9A 4O6EA 3FAAA 3T8OA 4G5PA 3W2RA 4EI4A 1OUKA 2J2IB 3MTFA 2PU8A 1E9HA 1WMKA 2WTJA 3F3UA 5K5XA 4GK2A 5HBJA 3QAME 4V01A 5HBHA 4D1ZA 2FSLX 3O7LD 4QP2A 3ZBXA 2JKOA 3Q9WA 2VTQA 4DT9A 3GT8A 3UP7A 3RINA 3LMHA 4I6FA 3P7BA 4RC2A 3VAPA 1PXOA 1JSTA 2G1TA 2C1BA 2YM5A 3R7IA 2JKMA 1APME 3UYTA 1H1RA 3VS7A 3DJ5A 4XG3A 2WTKB 2QHNA 4NFNA 4D4YA 4OBQA 3LFDA 3COKA 4RIOA 3UIUA 2VTOA 1XH7A 2Y7JA 3QCQA 3QHWA 4WOVA 4IAFA 3FZRA 4V04A 5CEOA 3VC4A 3QZIA 3UP2A 1O6YA 4H36A 3SC1A 5HG5A 1PKGA 3DQXA 4LM5A 3MH2A 5E8UA 5B2LA 4ERWA 5IDPA 2I7QA 3ZLXA 4HNFA 5HCXA 4CSVA 3SVVA 4O81A 2QOOA 2QURA 1QCFA 3RP9A 4QP7A 1SMHA 5LCKA 1Q8WA 3Q6WA 1R3CA 2ZV8A 4RVLA 3A8WA 4E26A 4O7WA 4XP0A 1JVPP 4M84A 4BCGA 4RIXB 4BFMA 5C8NA 5HD4A 3ZZEA 1VZOA 3NZ0A 3RNIA 1R39A 3MH0A 4D1SA 4DGOA 5GZAA 4KIKB 3NMUF 2HYYA 3HMOA 1NVQA 5B2MA 1CSNA 1PXMA 4U3ZA 5JN2A 5BUJA 4S32A 1H00A 1JKKA 3ULIA 3ZYAA 5JRQA 4ENXA 3GP0A 2NRUA 4KUJA 4BGQA 3CIKA 4ACMA 1H1WA 1LP4A 2J5EA 5EM8A 4ZK5A 3G0FA 5T6KA 5BYYA 4MNEA 4NKSA 3QQLA 4LFIA 4XG4A 4R77A 2C6LA 3V5JA 5A54A 1KE9A 2I6LA 4AW2A 5FXRA 2PE0A 5B2KA 3W8QA 4FSNA 4JBVA 5BYZA 4K0YA 2XVDA 5ANGA 4AZEA 4IAKA 4KBCA 4IB3A 4P2KA 4QTEA 2IWIA 4LL0A 3THBA 2AC5A 1UU9A 2XP2A 2YDKA 3ORZA 3UIMA 2GPHA 5D7VA 3UQGA 4K33A 4FTQA 2C3JA 4KB8A 2YDJA 3HV3A 4TYIA 1TQIA 3DB8A 2PYWA 3FZOA 4NCTC 3DXNA 3RM6A 5JMSA 4WBBB 2R7BA 3NIEA 4NW5A 3FZTA 4Y85A 4MD8E 4AOTA 3FUPA 5E1EA 2JGZA 2C6IA 3R63A 4EK3A 2YLEA 3DKGA 5JKGA 4K11A 3AD6A 4JIKA 4CZUA 3FY2A 4KABA 2WNTA 3VBVA 4BVUA 3ZUTA 4F08A 3B2TA 5IEVA 2RL5A 3V8WA 2HWPA 3CC6A 4Q9ZA 5IU2A 4I1ZA 5L6OA 2X8DA 5I5ZA 2GQSA 2R3NA 4HCVA 5DRDA 4ERKA 4O96A 4M15A 2ZV2A 1EH4A 3R9OA 2W1FA 3JYAA 3UNZA 5C8KA 3O8UA 4EHVA 2UW8A 4G3DA 3V5WA 1L8TA 2ZM3A 1ZWSA 4PL5A 5E8SA 4HJOA 3KXXA 4F9WA 2PUIA 1YI6A 1OI9A 2GHGA 1GJOA 4UXQA 2VGOA 3KY2A 1YXXA 3BEGA 2PUNA 3QKKA 4MQ1A 5J1WA 2HY81 4RX9A 2WMTA 4JQEA 4G3EA 4AP7A 3QF9A 5TE0A 4Y5QA 1MRUA 3EQBA 3DT1A 3G5DA 3QTSA 5HVYA 3RI1A 2CNQA 5HU9A 3DFCB 2G2IA 4IAIA 4M7IA 1TQPA 4QNAA 5L2IA 3PG1A 4FZ6A 3OZ6A 4KSPA 4E20A 4O21A 3TDVA 5EQEA 4BDIA 3DS6A 3CP9A 2GCDA 4ZJJA 4X3FB 4I41A 4D2RA 4DLJA 3UZPA 4CRLA 5DLSA 5EHOA 4TPTA 3SA0A 3C4CA 5EOBA 4DCAA 3H10A 2R3OA 4HCTA 5EH0A 5EHLA 5CALA 5J5SA 2Q0BA 3PIZA 4QOXA 5AP3A 2OZAA 5IA5A 4CFNA 3A7HA 3PY1A 4ZXTA 2J90A 4A07A 3Q4CA 4WSYA 3T3VA 4ZP5A 3SW4A 4QT1A 4CVAA 2F7EE 3HGKA 3LXLA 3LPBA 5JZNA 2CLQA 5D41A 3KL8A 5IH4A 3R0TA 5IQAA 1HOWA 3QCYA 2VWBA 2C68A 3ODZX 3ZDUA 4HVHA 2UVYA 4L3PA 4HYHA 4ALUA 4BDKA 5A4TA 3MESA 2GNGA 5IMXA 4E6AA 4F6WA 4BYJA 4D4VA 3G0EA 4BHNA 4CZYB 3O0GA 3VUTA 3MS9A 2PVYA 4RQVA 5HO7A 4JDHA 3JXWA 1KOAA 3GB2A 4XLIA 1J91A 5EW9A 2OJGA 3OUKA 4B8MA 1SM2A 4I24A 4QMVA 4XBRA 5CSVA 3WF5A 4MQ2A 5K0KA 1YXTA 3ZSHA 4BBFA 1W83A 1WBNA 4U6RA 2BRNA 2ZM4A 5JT2A 3NUNA 3R04A 4IX4A 4ZY5A 5JFXA 5IQDA 2BAKA 3C5UA 2XJ0A 1LUFA 5IDNA 4G6OA 3NVMB 3NYXA 3RAHA 3DZOA 4D2VA 3R02A 3HKOA 4OW8A 4EZ7A 4EEVA 3DU8A 3Q9YA 3EQFA 5DH3A 4FL2A 3ALNA 4EWHA 3R83A 4FSQA 4FG7A 4G1WA 2OIBA 4DAWA 1SNXA 4YPDA 4FTOA 5AR7A 5EYDA 4FTRA 3QD4A 1Z9XA 2UW0A 3O2MA 4I5MA 1V1KA 5AWMA 2VTSA 3IDPA 3VUIA 5M07A 3CSVA 5BVFA 4EHEA 4CKJA 4FK3A 3DGKA 3E8EA 3U9NA 5CSPA 2OJIA 4ZMFA 3R28A 4ENYA 5FGKA 3KA0A 4JG7A 3D5WA 3SXSA 3FXXA 4RG0A 2VU3A 4PX6A 1YWVA 4RQKA 4X7QA 3PXRA 4YLKA 2ERKA 2XEZA 4KNBA 5DG5A 3PA5A 5HVJA 4BDEA 1U46A 2X2KA 4J1RA 5FTOA 4F9BA 5HIEA 4O0SA 3CCNA 5HE3A 4PMSA 4L42A 3DB6A 3RK9A 3LJ2A 3EQCA 3HV7A 3M2WA 5CSHA 4BI0A 2YJSA 3I4BA 1IASA 3KQ7A 2BUJA 3FPMA 5CSWA 1KWPA 2QOKA 2IZSA 4L52A 4MD7E 4ASEA 4M69B 3QU0A 3DAJA 4WKQA 4YMJA 3PLSA 3WE4A 2OFUA 2CN5A 4D2TA 4QMXA 3NW6A 2KTYA 3QLFA 5CAUA 2VTJA 3MPTA 2GNJA 4OTWA 2W9FB 4J71A 1WVWA 3RHXA 1FVVA 2Y4PA 2XK8A 2XS0A 3EN9A 5JH6A 2OLCA 3LOKA 5FM3A 4TL0A 4KINA 1PJKA 3ZSGA 3DFAA 3TZ8A 3GOKA 3WIKA 4ANSA 3A60A 5CQWA 3QRIA 3NCZA 3RAWA 2UZDA 3HNGA 3LCKA 4JBQA 3OTVA 3AMAA 2YACA 2BILB 3O50A 4GW8A 3BZ3A 3KRJA 3SX9A 4RX5A 4AA5A 2J0LA 4FSUA 4ZMEA 2WMAA 4FKGA 4AT3A 2G2HA 1V0BA 1B38A 4RFYA 2GS2A 1BI7A 4L44A 2ITTA 4AW0A 3KULA 2XM9A 3FZSA 1M7QA 2RSVA 3Q3BA 4NJ3A 4UBAA 5EOLA 2B55A 4JDJA 4L67A 4N4SA 5CS6A 3U8WA 3AD4A 2ETKA 3FL4A 1FMOE 4DBNA 3PJ1A 3P86A 3OHTA 1GIJA 4HVDA 3SV0A 4U43A 5LWMA 2BZIB 1UWHA 2QLQA 4IVDA 4IJ9A 3EFLA 3R2BA 4FTAA 5HHWA 4UZDA 1GIIA 5A4QA 2Y8OA 4GFOA 5JQ8A 5HG7A 3PJCA 2R3KA 3IS5A 1I44A 4MNEB 4F64A 4IM3A 1P14A 2GFCA 2VTNA 3F5PA 3GI3A 4YJNA 2IG7A 2B9HA 4O38A 4O7NA 3TXOA 2XM8A 1RDQE 2WOTA 3ORMA 4C61A 4FEWA 4NH1A 2R3PA 2ZVAA 2GFSA 3ENHA 3SOCA 3AC4A 1MRVA 4TNDA 3P23A 4RIWA 4DEAA 4ZJVA 1Q3DA 4GUEA 4IEBA 1Q3WA 2JAVA 3MW1A 3QQFA 5ANJA 5FTGA 2NP8A 4X2FA 2GSFA 2HZ0A 3F3WA 4L45A 3Q2MA 3WIGA 4ASDA 1KE6A 5KMOA 2IZUA 5BPYA 4DGNA 3K2LA 3PXKA 3PJ3A 4WBOA 3C5IA 2G15A 3I79A 4PQNA 4I5CA 4RLKA 4KSQA 1FOTA 4JJRA 4B6LA 3EKKA 4RC4A 2OSCA 2UZEA 4JRNA 3TN8A 4MH7A 2F2UA 3CS9A 4NWMA 2C3IB 4XBUA 4BI1A 4M66A 2C0IA 4W8DA 4X6RA 4IAAA 1JKSA 2X6DA 3DBQA 3QZGA 4ZTMA 3FZPA 3TIZA 3PP1A 3D2IA 5TR6A 4WO5A 4DEEA 4EC8A 3F3ZA 4EOQA 4FKTA 3TUBA 4ZEGA 3UC4A 4MK0A 1OL6A 5LMKA 1UU8A 4RVTA 5CZHA 3ZDIA 4EUTA 4EYJA 4U5JA 4DLIA 3PRFA 3UO4A 3EL8A 3FI3A 1YXUA 4LYNA 3TNIA 3NCGA 3TZ7A 4PTEA 3OT3A 3LFAA 2VZ6A 3OCTA 4Q5HA 2Z8CA 4FTJA 3ZRMA 4RFZA 4XMOA 3R8MA 4JDIA 4C38A 1TKIA 2O5KA 3E7VA 4U3YA 4XOZA 2R3GA 1HCLA 4UYAA 5BMMA 4E1ZA 4TY1A 1BYGA 4PMMA 3V8TA 1M14A 4O0VA 3QQJA 4NEUA 4RIYA 1FGIA 1Q8UA 3QD2B 4G17A 3QHRA 5LOHA 1OKYA 3UQFA 2RG5A 2X6EA 1SVEA 1GAGA 3EQRA 1B39A 4YC3A 3KXHA 3TNQB 2QOIA 1XBCA 3LAUA 2VTRA 4LUEA 4ONAA 3E63A 2JKQA 4AZVA 2Q83A 3OFMA 1R0PA 1OKWA 2GTMA 2XKEA 4FSTA 4Q2AA 4BCFA 5CAOA 5CEMA 3QTZA 3M42A 3IW5A 3E64A 3CQEA 2OFVA 3PVUA 1UVRA 5J9ZA 2CNUA 5IQCA 3EKNA 2WIPA 4WNOA 4QP1A 3KF7A 4EWQA 1Q8YA 3F61A 4FKUA 2C3KA 3AXWA 1KV2A 5BUIA 4XCUA 1PMUA 1YW2A 2B4SB 4LGGA 4PNKA 4RPVA 3DXPA 5AEPA 4USEA 4RJ3A 2Y0AA 1AGWA 4RVMA 4FT0A 3BWJA 5H8BA 4CV9A 4EOMA 2XK9A 3LFQA 4S34A 2PWLA 5F94A 3OBJA 4LV8A 4RX7A 2WPAA 4AX8A 4C7TA 4QMMA 2ITPA 4R78A 1OM1A 2C6EA 4IB5A 3H30A 5ETCA 3JUHA 4A9TA 3DBDA 3K5VA 3PSBA 4W9XA 2X81A 5HEZA 5CY3A 3VQUA 5DVRA 3OTUA 4ZLZA 2ACXA 2JD5A 1OPLA 1Q61A 3QTQA 2Z7QA 4IX3A 4W4VA 4A9YA 4G9RA 4OAVB 1M17A 3LMGA 4UMRA 2OF2A 3V6RA 1SZMA 3KVWA 4GKIA 1ZMWA 3O23A 4KS8A 2WMSA 4E4LA 4FE2A 3KXGA 4AGDA 4C3PA 4JT3A 4RIXA 4EBVA 4FODA 3GXLA 2WOUA 3VWAA 4PL4A 3EL7A 5HIBA 2F7XE 2XRUA 4EYMA 5KKRC 3R9RA 5HE2A 4FSZA 1DAWA 2UZUE 1YDSE 3OCGA 4IXPA 3WOWA 5G6VA 5IH6A 2R3QA 4HVSA 4IM2A 3SXRA 5HO6A 4BTFA 2B9JA 3CGFA 3DKFA 3VUHA 2CPKE 2YIRA 1REJA 3Q5IA 1IR3A 5HG9A 3CPBA 4F70A 3L9NA 4O0TA 1LR4A 3Q4ZA 5CT7A 4QPMA 4YTIA 1URCA 3UYSA 4BCMA 3R9NA 3RPRA 3L9MA 3SQQA 4BCQA 4USFA 3ZEWA 1OPKA 1V0PA 2BZHB 1YOMA 3ORIA 5FRIA 3R9DA 3E7OA 3PPZA 3MVJA 3Q96A 2XNBA 4LRMA 4TWNA 3VULA 2WHBA 2C6OA 3Q9ZA 4LOOA 2UUEA 4WT6A 1CKIA 3COHA 4RWKA 2QO2A 3EN4A 3QX4A 4K2RA 4L01A 4O0WA 1KE8A 3CTHA 3VJNA 5BX0A 3MGYA 3QKLA 5ACBC 4MF1A 4MD9E 3SW7A 4N0SA 3C0GA 3A4OX 5C26A 4YJPA 5K5NA 1PXLA 2H34A 3ZM9A 3FMDA 4FNZA 4AG8A 3DDQA 2VD5A 2JDOA 4N6ZA 1Q99A 4N57A 4IW0A 5AX9A 3W2PA 4FSYA 5IQGA 2QR8A 2J0JA 2YEXA 1OKVA 2WQOA 4YHFA 4CQEA 5E8XA 4QP4A 5ANKA 2Y4IC 3QTRA 2V62A 4FX3A 4IH8A 3QTIA 5EK7A 3QTXA 3AGMA 3AT4A 4IDTA 3VS0A 5E7RA 4HZRA 2PMNX 2VRXA 4FSWA 2JIIA 1R1WA 2V5QA 5HNBA 3R22A 3VVHA 3L8PA 3CD8A 4FTLA 4ZLOA 1ZOEA 5CU6A 3ZFXA 2XK6A 3NUYA 1BL6A 3ORLA 1O6KA 3KK8A 3TZMA 4AFEA 4IE9A 4MXYA 2QG7A 2R4BA 3GCUA 4QTBA 3ZEPA 3C4XA 1B6CB 3B8RA 4XHKB 2CKEA 2PE2A 3GUBA 5D10A 5EI6A 4IWQA 4AF3A 4DH5A 4IB0A 3I81A 4ITJA 4F99A 5IQHA 3TCPA 1BI8A 5GIPE 3C13A 2FGIA 5CAVA 4X2NA 2BRMA 2BKKA 4CEGA 3ZLYA 5BVDA 5I3OA 2YA9A 4X3FA 3R01A 4CV8A 5EHYA 1P5EA 1IG1A 3DK7A 3KULB 4RJ8A 5BVNA 2X2MA 4C3RA 1OL5A 5EM6A 1YQJA 3UPXA 3FYKX 2F49A 1P2AA 2GHMA 2O63A 2VAGA 3IECA 3NNWA 3U6IA 4DEGA 2UZWE 3ZBFA 1LEWA 2ONLA 3POZA 3QALE 5HD7A 1URWA 4EOKA 4RJ5A 4BIEA 2O0UA 4M0ZA 1J7IA 4FEUA 5H3QA 3EQGA 4GG5A 3GCVA 1PYXA 2CLXA 3BQRA 4EL9A 5GHVA 2YM4A 4L00A 4F6UA 1ERKA 4YNOA 3GNIB 2Z02A 3A8XA 2DS1A 4NM5A 1PXNA 4UEUA 4C58A 5KE0A 5CI6A 3MIYA 4C3FA 4YZBA 3L8SA 3BYOA 2WEIA 3LE6A 1H07A 4J99A 2XA4A 3QXOA 4MXOA 2GQRA 2WTDA 2QR7A 4BBEA 4TYHB 2HZNA 4NZWB 3ZUUA 3GQIA 4RIWB 1VR2A 2O8YA 5CU4A 2BAQA 4OBPA 4CYJA 4ZZMA 1ZYJA 3GC0A 3MDYA 1HCKA 1XHAA 3QKMA 4D5KA 3RTPA 4IVAA 1W98A 3EN6A 2HAKA 4IADA 2ITXA 4O0XA 4QPSA 3QZHA 5CASA 5M4FA 3R1YA 4LRJA 4WRGA 2I0EA 5F20A 3FMNA 4ZSAA 4MEDA 1YDRE 5JGDA 2VGPA 1LEZA 3FL5A 3NUXA 3I6WA 2QOBA 4U44A 4FKQA 1PMNA 3ZRKA 1G8AA 4NKAA 2ITZA 3R21A 2WTVA 3O8TA 3NNUA 4BC6A 2WMUA 3OWJA 3OY3A 3R8ZA 4AZWA 4YLLA 2OG8A 4FUYA 4QMWA 4YHTA 3QLGA 5DMZA 2IVVA 3EOCA 4TT7A 3R1QA 3VS4A 4KRDA 5D7AA 1JNKA 2XIZA 2XNOA 4EKLA 3II5A 1PMVA 3A2CA 1JKTA 4L3JA 1VEBA 3E8CA 3EWHA 5JZJA 4TKSA 4JQ8A 4FV8A 3L9PA 5E4HA 4UMUA 4HGLA 2YWPA 2WKMA 3SAYA 5EKOA 5EW3A 2OJFE 4XV3A 5L2SA 3QA0A 4AS0A 2BIYA 3OMVA 4RZVA 4XP2A 5DT4A 1MUOA 4EK8A 4BTKA 1O9UA 2RFEA 3CQUA 3EFWA 2XIKA 5FXQA 2UZBA 4ALWA 3N4TA 3GU4A 5GIOE 3BGQA 5E9EA 3HV6A 3R7EA 2FB8A 4I23A 4M69A 1KE7A 5JFSA 3PZHA 4QP6A 3H3CA 1YKRA 5GZ9A 4QMSA 5M08A 2I0YA 2WTWA 3KC3A 3P5KA 3KFAA 5L8JA 2E9PA 1NT2A 2UW7A 5ETIA 3HVCA 1Q97A 5FDXA 2Q0NA 4GEOA 2XCKA 2BHHA 3HL7A 1KUTA 2R3LA 5FWKK 1GIHA 2A27A 3FMMA 5HCYA 3OW4A 2A19B 4L43A 3TTJA 4ANNA 2EVAA 4IX6A 3NIZA 4II5A 3D7TA 1OITA 5AAEA 4K1BA 3VF9A 4DGGA 1NVRA 3FJQE 3FKOA 4ITHA 1QL6A 3RALA 5DHJA 2REIA 4GK3A 1PXJA 2UZNA 3ORNA 2GMXA 4H39A 4HZSA 1CMKE 4F1TA 4I0SA 2QOLA 2OO8X 3ZOSA 4BCOA 5CF6A 4WIHA 3RBWA 1QMZA 2GDOA 4A06A 4CCUA 3TV4A 4J8NA 5CU3A 4F09A 1FBNA 4DEBA 4RSSA 4WSQA 1WVXA 5AP1A 4CXAA 2PY3A 2BFYA 4FL3A 2XF0A 2IVUA 2XMYA 2CKPA 3E3BX 3TACA 5IISA 2BR1A 5EDQA 2CKOA 4UZHA 1XKKA 4BYIA 4DTAA 4CFUA 3FMJA 1UWJA 3HLLA 3O8PA 5LVPA 3G6GA 3BHTA 4FIIA 4JRVA 2OJJA 4GIIA 4AAAA 2YDIA 4FV4A 4QYHA 3ZC6A 2VTHA 1U5RA 3C4ZA 4XP3A 3MPMA 3UDBA 4BCKA 4FV3A 4E73A 5M57A 4I4EA 1A9UA 4L3LA 1H28A 3UO6A 5CEKA 2GNHA 3FLYA 3AOXA 4Z7GA 3MWUA 3I1AA 5BVKA 3D4QA 4CD0A 4MTAA 3KKVA 4JI9A 2IZTA 4ALVA 4GKHA 3BU5A 3I7CA 3K3JA 1JKLA 4CQGA 3HAVA 4M0YA 2XKFA 5A4LA 4FT9A 4S33A 3A99A 2CHLA 3VO3A 5JK3A 4YJQA 2G9XA 4FT3A 1GZ8A 3DJ7A 5BYLA 2UZOA 2UW3A 3VS5A 1WBOA 4ACHA 3PDTA 3QRKA 3UVQA 5FDPA 1OGUA 1KSWA 5HNGA 3PPKA 3QXPA 3ZSIA 4BWPA 2W7XA 4ITIA 4FEVA 2R0IA 3UOLA 3V5LA 3H0ZA 4BZDA 2PSQA 4WG3A 3PZEA 4CFFA 3EN5A 1Y8YA 4DG2E 5HGIA 1OL2A 2BZJA 3UVRA 3QL8A 4UMQA 4WNMA 3LLAA 1M2RA 1CDKA 4IC8A 4CMTA 4EH4A 3UO5A 1NY3A 2X1NA 4FA2A 5AA8A 3TWJA 4HYIA 5HVKA 3PRIA 3HZTA 4QNYA 1ZOGA 3I5ZA 2JEDA 3L8XA 4FICA 4J95A 2C6TA 4KBKA 3QWKA 4GV1A 4MF0A 5J95A 3Q5ZA 3R8UA 1F0QA 3RJCA 3VS2A 5M44A 2ETRA 5HX8A 2JIUA 4A4LA 1F5QA 4O91A 2CGUA 4XV1A 4D4RA 2PZYA 1U54A 5EG3A 4IFCA 1UV5A 3VF8A 4ANBA 4P5ZA 5J1VA 3AT3A 4G6NA 3UQCA 3KVXA 3PWDA 4FTTA 4QYEA 3MYGA 5CF4A 4UWYA 4LRKA 4D0XA 2YIWA 4BKYA 3FMEA 4IIRA 3E5AA 1S9IA 2X7FA 4KD1A 1UA2A 5FM2A 3S4QA 5HU3A 5LMKC 1DI9A 3E8DA 4AA4A 2BMCA 2WEVA 2WD1A 4MYGA 4OTFA 4XEYA 1E1VA 3A7FA 3HX4A 3NAYA 4TYGA 3FQSA 3VW8A 1K9AA 4I5HA 1AQ1A 1P4OA 3MIAA 3V01A 2R7IA 4D5HA 3AQVA 5HLWA 1YHWA 3WILA 5AP6A 3NRMA 4OTDA 3HYHA 3VS6A 2IVSA 4D2PA 4FKSA 2IO6A 4WD5A 5EW8A 4D1XA 5ICPA 5M09A 3BLRA 5GNKA 1R0EA 3D15A 4YR8A 3PE1A 2H96A 3QCXA 4I22A 3FC1X 5TO8A 1FVTA 3VUDA 4AFJA 2OKRA 3BV2A 5ANEA 4PWNA 3MBLA 4NM7A 5IUIA 5I4NA 4G5JA 3BYVA 3EQPA 5KMJA 5GZ8A 2JDRA 1ZXEA 3O7LB 2BPMA 4FIJA 4AN9A 3A61A 5C4KA 3TNHA 2PVRA 2W96B 2JLDA 3OCBA 3MI9A 5BVOA 4W8EA 3H9FA 1J7UA 2C5XA 2XNMA 3VQHA 4PP7A 2EXMA 3QZFA 2YM3A 3DKCA 4RWIA 4AU8A 3H9OA 2WMVA 4CTCA 3HRCA 1XBBA 4DBXA 2XNEA 4G2FA 4M12A 4ARKA 4AZFA 2R3HA 2WTKC 2PZPA 4O7VA 4C0TA 4GYIA 3SXFA 1ZLTA 4FYOA 4M14A 2BDFA 4Z55A 5J87A 3OF0A 2W4KA 3ATTA 3NYNA 1H08A 3OROA 1OECA 4EJNA 3BCEA 4ZIMA 1QPDA 4APPA 3EH9A 3OXZA 2PVLA 3E8NA 5HX6A 3FMLA 3EB0A 3F5GA 4XOYA 2C47A 4G3GA 4I93A 3WF7A 2ZV9A 4DC2A 3M11A 4PTCA 3I0OA 3MA3A 4G6LA 4KIQA 3OT8A 1M7NA 2ITUA 4MXCA 2BDJA 3DK6A 3F2AA 4XYFA 3BBWA 3NNXA 3QRTA 4RJ6A 4YTHA 3U9CA 4EH3A 5GJFA 1ZY4A 2PHKA 4WHZA 3DLZA 4PNIA 5E8ZA 4GVJA 4LQMA 5K3YA 5I9UA 4G3FA 1Y6BA 4I0TA 3COMA 3UZTA 4IX5A 2YITA 4FZFB 4DFNA 5EI8A 1OIRA 2WU7A 4PDYA 3NS9A 2R3RA 3PA3A 4UY9A 1M2PA 4WG5A 3LVPA 3NNVA 2KULA 4GVAA 5DE2A 2VX1A 3BEAA 1JSUA 4AW5A 4C35A 3HUCA 3IW4A 4CNHA 2PVMA 3HV5A 4ZSEA 1NXKA 3DXQA 4U7ZA 2YZAA 2HCKA 5FXSA 1CKPA 3MN3A 4F7LA 4HYSA 3KXZA 4J53A 4F63A 5IG1A 2XJ1A 4E4XA 3AT2A 4F9YA 3ZO4A 4YC6A 3TDWA 4OBOA 2WQNA 4CT1A 2W0JA 2OJ9A 3JR1A 1QPJA 4M97A 5FP5A 4B8LA 1YI4A 3C4WA 5L6PA 3GU8A 4M67A 4PDOA 2GS7A 3V6SA 3UBDA 4YGAA 2C4GA 5CEQA 3TUDA 2X8IA 3MY1A 4YJSA 3CBLA 1YOLA 3D7TB 4GJ2A 4BHZA 1UNHA 2CNVA 2HY0A 4JG6A 4W4XA 3GU6A 5JFVA 3OWLA 5A14A 4FV7A 3JY0A 3DLSA 5CX9A 1Z57A 2Z2WA 3RVGA 4QTCA 5C8MA 2VWIA 3DNEA 2GQGA 4W9WA 3RWQA 2BVAA 3TKIA 4E6CA 3VJOA 3C0IA 3FMKA 2B9FA 4U79A 5BVEA 2XKCA 4R3CA 5KMIA 4YTCA 4E5BA 1U4DA 2F7ZE 3QYWA 2DWBA 2ZOQA 3ZU7A 4NM0A 2PPQA 5DT0A 4ZLYA 3UPZA 4O83A 5BNJA 1GZKA 4GG7A 5IH5A 4LG4A 3V8SA 3LIJA 3MA6A 4JR7A 5L3AA 1G3NA 4BY9E 4DEIA 2YFXA 3F88A 3WZEA 4X2GA 3U6JA 2QOQA 1BKXA 2FSTX 3PY3A 5AP0A 4CLJA 3A62A 4QMOA 4EZ5A 2UZVA 4DFZE 4BR3A 5L2QA 2HZ4A 5TT7A 3FLSA 1XH8A 3BX5A 4EOIA 2FVDA 5LARA 4MHAA 4X3FC 3LXNA 4BGHA 1IAHA 2X39A 3FYJX 5E90A 3TG1A 2ZMCA 3LW0A 4NK9A 4ZTQA 4EK6A 4D55A 2RF9A 4DFXE 3U54A 2I40A 3IGOA 3DQWA 3F82A 3KRWA 3LQ5A 2QG5A 5BQ0A 2JDTA 3P1AA 3QC9A 2YISA 1OIUA 2F57A 3NR9A 4L9IA 2WGJA 4TYHA 4DH7A 4FEXA 4C59A 2XIYA 4QMLA 4NU1A 4I20A 3TKUA 3UODA 3GFWA 3BBTB 3C4FA 3EFJA 1WAKA 5DPVA 1ZY5A 4KRCA 4HW7A 1TQMA 3CTJA 4NCTA 5FBNC 3SRVB 2BFXA 3VIDA 3NLBA 4QTAA 2C30A 1IEPA 4O7TA 3F69A 3VBTA 2PVNA 4KIOA 2PE1A 1JQHA 3ZMMA 3NYOA 2JFLA 4FV0A 4I3ZA 3C51A 4DITA 2C3LA 4ZOGA 4EOSA 3HDMA 3UE4A 3NX8A 3PFQA 3R73A 2XK3A 4ACCA 4UN0C 2A0CX 2UVZA 4JR3A 1ZYSA 1PMEA 2ZM1A 3BYSA 4O0YA 1OBGA 2B54A 3IKAA 3UMXA 3CJFA 1NW1A 3G6HA 4R3PA 4EOPA 4GRBA 3MSSA 4BDJA 5F95A 4GSBA 5CLPA 4IACA 4FTIA 4E8AA 4IQ6A 3C1XA 2XUUA 4A4XA 3IONA 3NUPA 2OXYA 2HELA 3U87A 3GU5A 2VO3A 2P3GX 3RM7A 2WMRA 3CQWA 3F2RA 4FTMA 4HVGA 3SKCA 4O2PA 1Q4LA 4FIEA 2VWUA 3IOPA 1U54B 1OPJA 4QP8A 2NO3A 3FSKA 4H05A 3TI1A 1OL1A 1IAJA 1SNUA 4FTNA 3AMBA 3EN7A 4K18A 4U81A 3LCSA 2VWVA 5AUZA 3VBXA 5LJJA 2ITYA 4PL3A 3SD0A 4EOJA 2YABA 4GS6A 5IUGA 5CZIA 2PUUA 4HPUE 3VUKA 4A4OA 3I7BA 3BHVA 3OS3A 4BBMA 3NGAA 4D58A 2C6KA 3FSFA 4MWIA 2LAVA 3PIYA 2WFYA 3QGWA 3LMIA 3ORXA 2Z7LA 4BCHA 4UMPA 3DDPA 2IN6A 4BDBA 5E92A 4ANOA 2ZMDA 1JPAA 3NWWA 3Q9XA 2FA2A 3E92A 3EJ1A 3FLNC 4E5AX 4OR5A 2YM6A 3G51A 2YCSA 4PP9A 4A9SA 2LGCA 2PZRA 1M2QA 3KU2A 3N9XA 5DRBA 5IKWA 4GU6A 3ZC5A 2HW6A 5EM5A 1REKA 5GJDA 5AR4A 5TKDA 4FKJA 4BICA 2WELA 3GVUA 4ZY4A 4IB1A 3ZXZA 1OKZA 1QPEA 2C69A 2OWBA 3D94A 3GU7A 3KCFA 2CJMA 4L53A 3G15A 1OIYA 2YCQA 4OTHA 3BWFA 3B2WA 2UVXA 3QD3A 1J7LA 3D5VA 3DTWA 3EZRA 4IHPA 4C37A 4YLJA 5A3XA 1YHVA 4WG4A 4WUNA 5CSXA 4MX9A 5HO8A 5A4EA 2B52A 1H0VA 3ORKA 4DA5A 2WZJA 4ZSGA 3ZH8A 2P2IA 4XLVA 2JAMA 2RKUA 4ZSLA 1H1PA 2B1PA 4I6HA 2XJ2A 4ZTLA 1W84A 2HWOA 4DCEA 3FV8A 3R71A 1H8FA 3AGLA 2QO9A 3R7GA 4MXXA 2EXEA 3H9RA 5BVWA 3PVWA 4I6BA 5J7BA 4FSMA 3S95A 4QMTA 2JBPA 4IBMA 3PA4A 3R8VA 3AC1A 4RRVA 2OW3A 3NUAA 2JDSA 5FEQA 2XBAA 3F5UA 4B0GA 3ALOA 1PHKA 2IZRA 1H24A 4D9UA 2H6DA 2R3FA 3P9JA 3R7UA 4D4SA 4PRJA 3KRRA 5ANIA 1RW8A 2C5NA 3S2PA 4MBIA 3R2YA 4G16A 1XH9A 4YO6A 1ATPE 1H25A 3ET7A 3P79A 2ZB0A 3GC7A 4M68A 4QMYA 4YJUA 3I6UA 5K9IA 3CGOA 3SOAA 4PV0A 4O7SA 5L2TA 1FVRA 4BTMA 3R7VA 4IWDA 5HI2A 3SHEA 4HVIA 3LFSA 4DEHA 3UOJA 4DFBA 4UWCA 4YUQA 5AR8A 2E9UA 4FZDB 1PRYA 4FMQA 3W2OA 3UNJA 2YWVA 4NYEA 2QKRA 2OIDA 3HRBA 4QYGA 5AUYA 5KNJA 3I0QA 1J1CA 4I0RA 3W16A 4JG8A 1XBAA 3PXQA 4O1PA 4BDFA 4MXZA 2X7GA 5C03A 2GHLA 1JSVA 2HENA 2PZIA 3F7ZA 2IW9A 4QMUA 4FR4A 3R7YA 4F7JA 4X0MA 3S00A 3OCSA 4ID7A 1XH5A 2IVTA 5C27A 3DTCA 4P90A 3PUPA 3BLHA 4TNBA 2CGXA 3U51A 3UIBA 3VHEA 4GU9A 3KMWA 3EIDA 2PK9A 4IZYA 4XUFA 2EU9A 3PLAE 1YWRA 4APCA 2RIOA 1OIQA 2VWZA 3OG7A 4H58A 2A1AB 1WVYA 1QPCA 4RT7A 5EFQA 5E91A 5KZIA 5KBRA 2QCSA 4UB7A 3P7AA 4J97A 1U5QA 3OOMA 3HECA 4CFWA 3ROYA 2BRBA 2J7TA 3HMPA 4I4FA 4GK4A 4MVFA 4H3BA 4RZWA 5E8TA 2ZAZA 3KRXA 3GFEA 3RCDA 4ORKA 4AGUA 2R3IA 3FMHA 4FIFA 4BCNA 4NIFA 5HORA 1K2PA 4IAYA 4ANLA 3NAXA 5LVLA 4DEDA 5CAPA 4S31A 4TTHB 3W8LA 4ANMA 2R3JA 1H01A 4DTKA 4YZMA 4FKLA 4FT5A 3GQLA 2GU8A 5HLNA 2UW4A 1FQ1B 4K8AA 4E4NA 5I9YA 2QNJA 4G31A 4EHGA 5IQIA 2WQMA 4LI5A 1XJDA 5AUXA 4AE9A 4AQCA 4R7IA 4B7TA 4EONA 1YVJA 5ANDA 4ZSJA 2UW5A 2YIXA 2VNYA 4L8MA 5EYMA 3EQIA 4V0GB 4GT4A 2BDWA 4IVBA 4YJOA 4FKRA 1XWSA 3BQCA 4CYIA 3D0EA 3GOPA 2R2PA 5DR6A 1Q5KA 1W8CA 5AR2A 4AA0A 4AOIA 4OTPA 4Q5EA 3Q60A 2QKWB 3E88A 3AG9A 2ZYBA 3DJ6A 3PE2A 2GNLA 2OZOA 3FE3A 3FKNA 4DH8A 2R5TA 2W06A 3R1SA 4MAOA 3ANRA 3AD5A 4F1MA 4EH5A 2PTKA 3M1SA 5CNOA 5DN3A 5HLPA 3HP2A 2QOCA 3OP5A 3PXFA 5AIKA 3V5QA 4C02A 4XV2A 4E6DA 1AD5A 2UZTA 3PIXA 4NT4A 3PVBA 4BKZA 5HTCA 3CY3A 5H9BA 3TL8A 5FUTA 1ZMVA 2PMOX 3DY7A 1PXIA 3I60A 2ITWA 2PMIA 3PP0A 4NFMA 4Y73A 5AV2A 4MXAA 2WIHA 4WNKA 4OTGA 3RK5A 4EOLA 5AV4A 2W5AA 5HKMA 2XK4A 5CWZA 4J52A 4QQ5A 5IQFA 3BV3A 3CKXA 5FQDC 3IW8A 5AJQA 3EYHA 3CE3A 3LCTA 5EYCA 2OXDA 2YIQA 3ZO3A 5EM7A 4A9UA 4BCJA 3D9VA 1PW2A 1Y8GA 5HESA 4ACDA 1ZYLA 2W05A 2PMLX 1YRPA 1Y6AA 3Q4TA 3F9NA 5E8VA 1OBDA 5DGZA 3TV7A 3VW6A 3Q52A 3WYXA 4E93A 5IF1A 3TV6A 4IWOA 4FI1A 1ZYCA 5FLFA 4H3QA 1YWNA 4UMTA 3LZBA 1WBTA 3FI2A 4FV6A 5HCZA 2AUHA 3S3IA 5A46A 5IMEA 3QTUA 3DNDA 3MVMA 3QX2A 5ETFA 3E62A 2W5BA 4C8BA 3NPCA 5AAGA 2V0DA 4GFMA 3ATSA 2WMBA 4H1MA 4YHJA 4C2VA 5CF5A 4WUAA 4EH8A 1GNGA 5JEBA 4DH1A 3E87A 2UW6A 4UYNA 4DGLC 2XZSA 2EWAA 2CKQA 2CCHA 4JAJA 4ZY6A 4FTCA 3RZBA 3VUMA 4AT4A 4FKIA 5IA0A 4EH6A 5HNIX 3F3TA 4QQJA 3ACJA 4DHFA 2I0VA 4UX9A 5I9VA 2DYLA 3AC5A 2IJMA 4U41A 1LPUA 2WQBA 4O86A 4FYNA 4O82A 2VO0A 1WFCA 4JOAA 3A7IA 4YBKA 5LVNA 4TXCA 4R3RA 2PULA 4C2WA 4YZCA 5DNRA 2V7AA 3UOKA 5HQ0A 3PJ8A 3KREA 4DT8A 3LFCA 3GCSA 4XG6A 3I5NA 1MQ4A 5T68A 1YI3A 4OAUC 3V3VA 2XIRA 2YHVA 2VN9A 4FG8A 2J0MB 3D2KA 4QYYA 5KO1A 3FZ1A 3WARA 3MTLA 4HGEA 4QMQA 5B7VA 5CAQA 3JPVA 2OGVA 4IMYA 1RJBA 2H8HA 5AIRA 4Z9LA 1IA9A 1H4LA 2VTTA 1NVSA 4GFGA 2UZLA 3HDNA 5DBXA 1Q8ZA 4F9CA 2JITA 5A4CA 4RC3A 1XH6A 4I21A 5KUPA 1ND4A 4JL9A 1T45A 2V22A 2W1CA 3FQHA 4U45A 3MY5A 5FP6A 4FF8A 2IW8A 4EC9A 3QQKA 4V05A 3BHYA 4FOCA 5DWRA 2WO6A 3A7GA 3F66A 4B4LA 4DFUA 1KE5A 1A48A 2O2UA 4P5QA 2BRHA 1E1XA 3CY2A 3RZFA 4AE6A 5DEYA 4XRLA 2EB2A 3LJ0A 3FXZA 3OEZA 4O7YA 2J50A 2PUPA 3UC3A 3RAIA 3KMUA 5JGBA 2ITOA 4BCPA 3LM0A 4JLCA 5IA1A 2VUWA 4LL5A 1DI8A 2C5OA 3DA6A 5AR5A 2C0OA 5M4CA 3OVVA 5A6OA 5B0XA 4BDDA 3EFKA 5IEYA 4U80A 3H4JA 2WMWA 5M4IA 2JFMA 3UZRA 4J98A 4OTRA 1Q8TA 4O0RA 2O3PA 5IPJA 4FV1A 2EXCX 2YM7A 3QYZA 5JQ5A 5M56A 1H0WA 4YSJA 4JBPA 3QUPA 3QD0A 5DA3A 3DBCA 4CGAA 2UV2A 2VTAA 3IW6A 1ZZ2A 3MPAA 3TT0A 2W4OA 3FLWA 3HA6A 3KXNA 3SRVA 4AGCA 4R5YA 3AMYA 3KB7A 3OEFX 4ZAUA 2F4JA 1Z5MA 3ZLWA 3ERKA 2XBJA 4NM3A 3O17A 2YCFA 2W1DA 2YAKA 3OWKA 4JX3A 2YJRA 4PDSA 1UU7A 3ZXTA 4BDAA 3HP5A 2OH4A 3QGYA 1IRKA 4IC7A 5CT0A 3PSCA 4NTTA 4IZAA 2FH9A 4RLLA 3JVSA 2WTCA 3OC1A 5C01A 3ZZWA 2QHMA 4FG9A 3ZFYA 3E3PA 4E7WA 4EKKA 5KX8A 4GYGA 5FBOA 3WZUA 2YERA 2YIYA 1VYZA 5HOAA 3NUSA 3VBWA 5M55A 4BKJA 4FKVA 2NRYA 5DR2A 3RGFA 3IW7A 2V7OA 3BKBA 3CLYA 4E5WA 3KGAA 1H27A 4TYJA 5DIAA 2WMQA 3AC8A 2EUFB 3QA8A 2IW6A 2VV9A 4JVGA 4GT5A 5KMMA 4FNYA 3LLTA 1I09A 2BZKB 2J0IA 1Y91A 4R7BA 3Q53A 2QO7A 2VX0A 4YJVA 3P7CA 3QBNA 4NTSA 4YJTA 5GJGA 4PDPA 5FG8A 4F4PA 3ACKA 5DI1A 4Z3VA 5H2UA 2Z7RA 2BKZA 2W1GA 3MV5A 3WF9A 5L4QA 2Y6MA 4KWPA 1RQQA 3G90X 3VRYA 4CTBA 4HYUA 3BPRA 4W4YA 4R5SA 4X6QC 3UGCA 4EZ3A 3E93A 5AP5A 4FNXA 4O7LA 4NIFB 4X21A 5HG8A 4FVQA 5CYIA 5IEXA 3TTIA 4DE4A 3W32A 5C1QB 1SYKA 5AX3A 3PSDA 5EQPA 4AXAA 3HUBA 3DAKA 4XH6A 3QQHA 4D28A 5KMKA 1GZNA 1PXPA 3MB6A 5D1JA 4ASZA 4ZZOA 2GS6A 3LXPA 1JWHA 2QODA 3QUEA 3BI6A 4AZSA 1L3RE 2W17A 4FV9A 3Q32A 4TWCA 3V04A 5CU0A 1SVHA 3BE2A 3IDBA 3BU6A 4YC8A 1PYEA 3PTGA 4RJ7A 2WMXA 3W18A 4C62A 4FV2A 4BIDA 3OBGA 4MBLA 3HMMA 4KKHA 3OD6X 4D2WA 4Z7HA 3HAMA 2XNPA 4PMPA 5FTQA 3KF4A 4O2ZA 3ZHPC 3CXWA 3ELJA 4QMZA 2YZLA 2QLUA 1BUHA 4QYFA 4BZNA 2ZDTA 4G34A 5J7HA 4PF4A 2BRGA 3OW3A 4FVPA 3CTQA 4OUCA 5J9YA 3ETAA 4S30A 3DKOA 1BLXA 4FZ7A 4O22A 2W1EA 2RGPA 3MJ1A 3LCOA 4GUBA 3R7OA 4AWIA 5KMNA 2J5FA 4F0IA 2ITNA 4CG8A 3OXIA 4OLIA 1OMWA 5GINE 4OT6A 3C4EA 4GMYA 5HE0A 4DH3A 3BELA 4XS2A 1BX6A 2J0KA 2ZV7A 4R7HA 2HK5A 2ZB1A 4FV5A 2XRWA 3FPQA 3D7ZA 3S1HA 3B8QA 4J96A 3LQ3A 4YZ9A 3VBQA 2P55A 1ZYDA 3F6XA 2H9VA 3JY9A 2C1AA 4RMZA 4RX8A 5AUWA 4C4EA 3DBEA 3R1NA 2QQ7A 5C4LA 1WBPA 4FUXA 2XIXA 5CXZA 3NEWA 2I0HA 4BWKA 3U6HA 4GIHA 3ORTA 4U0IA 3WZDA 4EQUA 4AN3A 4DINA 1XO2B 3ENMA 2AYPA 1KOBA 1H1QA 4ZZNA 4FOBA 2CN8A 4OTQA 5CANA 1W7HA 3QQGA 4L7SA 4UXLA 5K0XA 3W55A 2P2HA 4O6LA 1JBPE 5AUTA 3ORPA 2R3MA 4FNWA 4C4FA 2VWXA 5IZFA 4YO4A 4LGDA 2BTSA 5IQEA 4J8MA 4FT7A 3T3UA 3VBYA 3OUNB 2QC6A 3ULZA 3O96A 4DN5A 4UALA 4XG8A 5AMNA 1H1SA 2V55A 5D9HA 4OGRA 4GT3A 4ZTRA 4EK4A 2Y9QA 5CNNA 3L9LA 3A7JA 4F7SA 1BL7A 3FLZA 4Y72A 5JSMA 5LCJA 3HMIA 3MFTA 3N4VA 3K54A 4GH2A 3UVPA 3QUDA 4EBWA 5ANOA 4YSMA 5M53A 1P4FA 5CVFA 2QD9A 2SRCA 3IDCA 4N6YA 1Q41A 1JLUE 4XG2A 2PL0A 3FEGA 5CQUA 5J79A 4A9RA 2WU6A 2NPQA 3KXMA 4H3PA 3W2CA 4GL9A 2VO7A 4A7CA 4EORA 3KN6A 2XCHA 3FDNA 3T9TA 5HTBA 3KEXA 5L8KA 5DYJA 3WF6A 4M3QA 5KMLA 1DS5A 2C6MA 2J6MA 3TZ9A 2WQEA 4FK6A 4TZRA 2NNWB 3V5PA 1OL7A 3MH1A 3SG8A 2QI8A 3WZJA 2E9NA 3W2SA 3R30A 3GBZA 2J51A 2CSNA 4JX7A 4JDKA 5DEWA 1WBSA 4RA4A 4W4WA 4I94A 4PMTA 3V5TA 4EJ7A 1JOWB 2XYNA 1DAYA 2P33A 3LJ1A 1FPUA 4K6ZA 2ZJWA 4TN6A 5CVHA 3QRJA 4BL1A 4KKEA 4CMUA 5L8LA 4NUSA 3RWPA 4P7EA 3VNTA 2B7AA 4M8TA 3H0YA 4Q9SA 1WCCA 2OH0E 1W82A 4F0FA 4MWHA 3VRZA 3ZLSA 3MFUA 4BI2A 4G3CA 4YURA 3TUCA 2BCJA 2FYSA 1A06A 2WAJA 5E8WA 2YCRA 1UKIA 1BMKA 1FGKA 3UG1A 4ACGA 3CD3A 5E1SA 1J1BA 2DQ7X 4EK5A 3HA8A 3RK7A 5D11A 3COIA 4PPAA 2IPXA 5HIDA 4D0WA 3EQHA 3MFRA 3FWQA 4U97A 3ZRLA 3D83A 4IANA 3ITZA 4CCBA 4BN1A 4MNFA 3NYVA 1U59A 4IZ5A 4TW9A 4EQCA 2X4FA 4IAZA 4RGJA 5AV1A 2A2AA 4IM0A 4FKPA
chains in the Genus database with same CATH superfamily
4I6QA 2BALA 2F9GA 3QWJA 3SLSA 5KKRB 4IFGA 3C50A 5CU2A 5A6NA 5KBQA 5M4UA 1UNGA 2QU6A 3W2QA 3O71A 4JAIA 3VS1A 3O51A 4L7FA 2BROA 2B9IA 4V0GA 3DPKA 1PF8A 2B53A 4CG9A 2ERZE 2VO6A 3G9NA 5JGAA 1J3HA 3VN9A 3PY0A 1Y57A 3WI6A 4BDGA 3TEIA 4RVKA 1ZZLA 4PPBA 3U4UA 5DT3A 4F1OA 3RKBA 3DAEA 2X8EA 1GOLA 2YAAA 5I0BA 2FSMX 4PY1A 2E9VA 5AA9A 2O65A 3OXTA 1NA7A 2ONLC 3PJ2A 4KAOA 1GY3A 4FVRA 2Z60A 2PVKA 3VS3A 4HNIA 2FUMA 2EB3A 3EZVA 5E8YA 5L2WA 4RWLA 3BGPA 2X0GA 5T3QA 3LCDA 4LOPA 5I9XA 5AV3A 3ZCLA 3SGCA 5AR3A 4E4MA 4XRJA 4CRSA 3NUUA 3R6XA 3L8VA 2ESMA 3TJDA 5ITAA 1S9JA 3R8LA 2I1MA 3HRFA 3P4KA 4CZTA 4EQMA 2W99B 4JBOA 4EUUA 3PXZA 3F7WA 2VX3A 2Y4IB 4IDVA 5IA4A 3CEKA 3GENA 4O7RA 4WRSA 1UU3A 3BE9A 3F3VA 3C9WA 4FC0A 3FXWA 4UV0A 4DFLA 3KRLA 4F9AA 3TNWA 4FGRA 4LDTA 4KKGA 1CM8A 3FI8A 4L6QA 3AC2A 3N51A 4ZTSA 3SG9A 4CFMA 2X7OA 4QQTA 4CKIA 2WB8A 4HGSA 4O27B 5J9LA 4QO9A 2PVFA 3RCJA 3TNPC 4M13A 4K77A 3VHKA 4YU2A 1XMLA 3LM5A 3D14A 4LV5A 2XNGA 1OVEA 4AXDA 5DOSA 4BZOA 2VTMA 2IEWA 4E6QA 4DGMA 3P0MA 3IK3A 3LHJA 4HGTA 3W10A 2ITQA 4BB4A 4U9AA 2J4ZA 1ST4A 1JAMA 1MRYA 1WBWA 3K3IA 3R8PA 4AOJA 2C5YA 3IOKA 4C4GA 2AC3A 3W0OA 4WNPA 5CENA 2JKKA 2R9SA 3POOA 4ANQA 3W0RA 5FD2A 3REPA 2G2FA 2RG6A 3BLQA 3EHAA 4BDCA 4HCUA 4IVCA 2P4IA 5F9EA 5LWNA 4U42A 4YZNA 2A4LA 2OF4A 1OUYA 4USDA 2JBOA 3L1SA 4YNEA 3GC9A 5AADA 2YM8A 5ACKA 3MB7A 3MJ2A 2HXLA 3BIZA 3Q04A 2YN8A 5JRSA 3AC3A 3FI4A 2G01A 5EQYA 2W1IA 2HW7A 5D12A 5FEDA 5HE1A 4YP8A 3GEQA 4MCVA 4QP3A 4TWOA 3KMMA 3UIXA 3WYYA 3DZQA 3A4PA 3BRBA 3DK3A 2X9FA 4BF2A 5I3RA 3DCVA 2JC6A 2OIQA 4O4FA 1XR1A 4FZAB 4BTJA 4RWJA 1XH4A 2W4JA 3RNYA 2OI4X 3MFSA 3ZUVA 3UG2A 3CPCA 3W1FA 2OZAB 4L46A 3EQDA 4XV9A 2GNIA 4PTGA 4N70A 5IA2A 3NDMA 2XB7A 3QCSA 4RA5A 1WBVA 2OU7A 3ODYX 3MVHA 4U40A 3RPOA 4I92A 5KHXA 4XG7A 4XJ0A 4DF3A 4EH9A 4R1VA 5LXMA 1SVGA 2VTPA 2O64A 5AP2A 3WBLA 4FBXA 5HZNA 3FHRA 1XQZA 4YPSA 4D9TA 2GTNA 4U8ZA 2OK1A 3RMFA 2XH5A 2W9ZB 1K3AA 2X9EA 4FTUA 4QD6A 4YJRA 5AM7A 4HPTE 3WE8A 2B0QA 3TM0A 3LFNA 3NSZA 4O84A 4C4IA 1O6LA 1ZOHA 4GCJA 5DR9A 3ZS5A 3BU3A 5J8IA 4ZJIA 3RPVA 4AACA 1FMKA 4F7NA 1GZOA 4GJ3A 4QMPA 5H8EA 2CCIA 5M51A 4ZS0A 4KIKA 1STCE 4FSRA 2HIWA 2WXVA 3VONA 3FQEA 3RPYA 4CMOA 3ZONA 3PPJA 3F5XA 5CEIA 3QQUA 4H1JA 3C0HA 5L6WL 3BGZA 4IZ7A 2W1ZA 3LFBA 4C36A 4B99A 4CFVA 5A9UA 4LMNA 3P08A 2F2CB 3UJGA 5HTIA 2QONA 2C5VA 3ZTXA 3GCQA 4JQ7A 3V51A 4C34A 2PZ5A 4X2KA 4XNEA 4BIBA 4BRXA 4IJPA 4RBLA 3NW7A 4ASXA 5CF8A 4NL0A 2C6DA 4C4HA 2CGWA 3VUGA 4XX9A 3PYYA 5AM6A 1PXKA 1VYWA 1KV1A 4E3CA 4B9DA 3EYGA 4ZS4A 4QPAA 1V0OA 4F6SA 3HV4A 3CKWA 4YBJA 5ETAA 3ZO1A 3NW5A 5LQFA 4L68A 3MY0A 4D2SA 2Z7SA 2UW9A 3BHUA 3QTWA 3IG7A 2E9OA 4FKWA 4JNWA 3LFFA 4TRLA 5CTPA 4X2JA 4P4CA 4XG9A 1YXSA 2YLFA 4FL1A 5CI7A 4O7ZA 5AP7A 1H26A 4HOKA 2E2BA 5I9ZA 3G9LX 5EKNA 2BHEA 2C0TA 4BCIA 4BWXA 3NVKI 4LUDA 1T46A 3PUFC 1WZYA 2ETMA 3G33A 5EDPA 5G1XA 1DM2A 2HOGA 3HMNA 4Y95A 3FKLA 4G9CA 4K9YA 5AFVA 3C7QA 4QTDA 4RFMA 3ZFMA 4FTKA 3U4WA 3UMWA 5AV0A 4DDGA 4EH2A 4DYMA 3ANQA 3JS2A 4FGBA 1Q62A 4AT5A 4MBJA 4KIPA 3IPHA 5AP4A 3ZM4A 5F4NA 3WZKA 5CXHA 2OXXA 2Y6OA 1G5SA 3QRUA 1YOJA 4OTIA 2ZDUA 2ITVA 3FLQA 5LVOA 4X3JA 5IUHA 3D5XA 3FBVA 3K5UA 5H8GA 2QVSE 4O0UA 5DFPA 2IF8A 5C9CA 4JS8A 4AUAA 2FO0A 2P0CA 2WTIA 3IGGA 1UKHA 4KA3A 4EHZA 4R1YA 4KS7A 5AUVA 4FIHA 4LOQA 4Y8DA 5K4IA 4EH7A 5K4JA 2HZIA 3MVLA 3TJCA 1ZAOA 4FKOA 1X8BA 4TWPA 1G8SA 2X4ZA 3OWPA 4DHZA 3Q6UA 4OT5A 3S0OA 3GGFA 1PY5A 3ZO2A 4PPCA 5LMBA 2JIVA 1YHSA 2VTIA 3UNKA 3LXKA 5JFWA 5CEPA 2RFNA 5KCVA 4QQCA 2FSOX 3PXYA 3CR0A 4QRCA 3FHIA 1ZMUA 2QOFA 4NJDA 3UTOA 5TF9A 4BGGA 5BMSA 3PVGA 4QP9A 3WF8A 1R78A 1YXVA 1VJYA 2OICA 4JIAA 3D5UA 4LGHA 5KZ0A 3GCPA 3UOHA 4YZDA 5LVMA 2BIKB 5EI2A 3PG3A 1W0XC 1YDTE 3PWYA 3W33A 4AW1A 2OBJA 2CGVA 2XYUA 4ZTHA 4DG3E 3FY0A 5IA3A 2CDZA 1Q24A 2RFDA 2RFSA 2GNFA 4R6VA 5HICA 2X2LA 3QFVA 4FEQA 4FIGA 4IWPA 1UNLA 2HXQA 5EYKA 3GC8A 4C4JA 1RE8A 3BHHA 3KCKA 4QMNA 4ZTNA 3Q2JA 4Y83A 3BYUA 2VWYA 5F1ZA 4AZTA 4CFXA 4CLIA 4Z16A 3R00A 4MKCA 3QC4A 2XNNA 4LMUA 4AN2A 5IQBA 3DV3A 3TIYA 3LKMA 5AAFA 4F65A 5I9WA 2J9MA 3EMGA 4I5PA 5EDRA 2BAJA 4CT2A 1MP8A 5KHWA 5J5TA 4TYEA 2PVJA 3FC2A 5CVGA 3SDJA 3IO7A 3Q4UA 1TVOA 1W2CA 3OY1A 2DUVA 4Y46A 3DOGA 3TKHA 3RAKA 3T9IA 4RJ4A 5AUUA 2R64A 3R9HA 4DFYA 4O1OA 2VNWA 4DG0E 3IQ7A 3P78A 2XKDA 2XK7A 4NW6A 5LMAA 3RPSA 1CKJA 4YTFA 1F3MC 4S2ZA 1CTPE 3ID6C 2PVHA 4WA9A 3OOGA 2W1HA 4JXFA 5HBEA 2VWWA 3CJGA 1ZRZA 4UWBA 4Y5HA 5M06A 3HEGA 3LFEA 2W5HA 2VTLA 3G2FA 3RHKA 4BDHA 4DTBA 1OZ1A 3ROCA 2XEYA 2JDVA 5TOZA 3U55A 2QU5A 3LQ8A 4C33A 1M52A 1IA8A 5BUEA 4CKRA 2QOHA 1FINA 3BYMA 3F2NA 1OB3A 2BTRA 5FEEA 4C57A 2NYAA 3JVRA 4PUZA 4EOOA 3KN5A 2CMWA 4KBAA 1ZARA 3MH3A 4NSTA 3N4UA 1MQBA 3DBFA 4R8QA 4RIYB 4J7BA 4AGWA 2R0UA 4F0GA 1PKDA 3KK9A 4O6EA 3FAAA 3T8OA 4G5PA 3W2RA 4EI4A 1OUKA 2J2IB 3MTFA 2PU8A 1E9HA 1WMKA 2WTJA 3F3UA 5K5XA 4QEBA 4GK2A 5HBJA 3QAME 4V01A 5HBHA 4D1ZA 2FSLX 3O7LD 4QP2A 3ZBXA 2JKOA 3Q9WA 2VTQA 4DT9A 3GT8A 3UP7A 3RINA 3LMHA 4I6FA 3P7BA 4RC2A 3VAPA 1PXOA 1JSTA 2G1TA 2C1BA 2YM5A 3R7IA 2JKMA 1APME 3UYTA 1H1RA 3VS7A 3DJ5A 4XG3A 2WTKB 2QHNA 4NFNA 4D4YA 4OBQA 3LFDA 3COKA 4RIOA 3UIUA 2VTOA 1XH7A 2Y7JA 3QCQA 3QHWA 4WOVA 4IAFA 3FZRA 4V04A 5CEOA 3VC4A 3QZIA 3UP2A 1O6YA 4H36A 3SC1A 5HG5A 1PKGA 3DQXA 4LM5A 3MH2A 5E8UA 5B2LA 4ERWA 5IDPA 2I7QA 3ZLXA 4HNFA 5HCXA 4CSVA 3SVVA 4O81A 2QOOA 2QURA 1QCFA 3RP9A 4QP7A 1SMHA 5LCKA 1Q8WA 3Q6WA 1R3CA 2ZV8A 4RVLA 3A8WA 4E26A 4O7WA 4XP0A 1JVPP 4M84A 4BCGA 4RIXB 4BFMA 5C8NA 5HD4A 3ZZEA 1VZOA 3NZ0A 3RNIA 1R39A 3MH0A 4D1SA 4DGOA 5GZAA 4KIKB 3NMUF 2HYYA 3HMOA 1NVQA 5B2MA 1CSNA 1PXMA 4U3ZA 5JN2A 5BUJA 4S32A 1H00A 1JKKA 3ULIA 3ZYAA 5JRQA 4ENXA 3GP0A 2NRUA 4KUJA 4BGQA 3CIKA 4ACMA 1H1WA 1LP4A 2J5EA 5EM8A 4ZK5A 3G0FA 5T6KA 5BYYA 4MNEA 4NKSA 3QQLA 4LFIA 4XG4A 4R77A 2C6LA 3V5JA 5A54A 1KE9A 2I6LA 4AW2A 5FXRA 2PE0A 5B2KA 3W8QA 4FSNA 4JBVA 5BYZA 4K0YA 2XVDA 5ANGA 4AZEA 4IAKA 4KBCA 4IB3A 4P2KA 4AQKA 4QTEA 2IWIA 4LL0A 3THBA 2AC5A 1UU9A 2XP2A 2YDKA 3ORZA 3UIMA 2GPHA 5D7VA 3UQGA 4K33A 4FTQA 2C3JA 4KB8A 2YDJA 3HV3A 4TYIA 3AKJA 1TQIA 3DB8A 2PYWA 3FZOA 4NCTC 3DXNA 3RM6A 5JMSA 4WBBB 2R7BA 3NIEA 4NW5A 3FZTA 4Y85A 4MD8E 4AOTA 3FUPA 5E1EA 2JGZA 2C6IA 3R63A 4EK3A 2YLEA 3DKGA 5JKGA 4K11A 3AD6A 4JIKA 4CZUA 3FY2A 4KABA 2WNTA 3VBVA 4BVUA 4AXCA 3ZUTA 4F08A 2ZFYA 3B2TA 5IEVA 2RL5A 3V8WA 2HWPA 3CC6A 4Q9ZA 5IU2A 4I1ZA 5L6OA 2X8DA 5I5ZA 2GQSA 2R3NA 4HCVA 5DRDA 2XAOA 4ERKA 4O96A 4M15A 2ZV2A 1EH4A 3R9OA 2W1FA 3JYAA 3UNZA 5C8KA 3O8UA 4EHVA 2UW8A 4G3DA 3V5WA 1L8TA 2ZM3A 1ZWSA 4PL5A 5E8SA 4HJOA 3KXXA 4F9WA 2PUIA 1YI6A 1OI9A 2GHGA 1GJOA 4UXQA 2VGOA 3KY2A 1YXXA 3BEGA 2PUNA 3QKKA 4MQ1A 5J1WA 2HY81 4RX9A 2WMTA 4JQEA 4G3EA 4AP7A 3QF9A 5TE0A 4Y5QA 1MRUA 3EQBA 3DT1A 3G5DA 3QTSA 5HVYA 3RI1A 2CNQA 5HU9A 3DFCB 2G2IA 4IAIA 4M7IA 1TQPA 4QNAA 5L2IA 3BLAA 3PG1A 4FZ6A 3OZ6A 4KSPA 4E20A 4O21A 3TDVA 5EQEA 4BDIA 3DS6A 3CP9A 2GCDA 4ZJJA 4X3FB 4I41A 4D2RA 1TZDA 4DLJA 3UZPA 4CRLA 5DLSA 5EHOA 4TPTA 3SA0A 3C4CA 5EOBA 4DCAA 4O4EA 3H10A 2R3OA 4HCTA 5EH0A 5EHLA 5CALA 5J5SA 2Q0BA 3PIZA 4QOXA 5AP3A 2OZAA 5IA5A 4CFNA 3A7HA 3PY1A 4ZXTA 2J90A 4A07A 3Q4CA 4WSYA 3T3VA 4ZP5A 3SW4A 4QT1A 4CVAA 2F7EE 3HGKA 3LXLA 3LPBA 5JZNA 2CLQA 5D41A 3KL8A 5IH4A 3R0TA 5IQAA 1HOWA 3QCYA 2VWBA 2C68A 3ODZX 3ZDUA 4HVHA 2UVYA 4L3PA 4HYHA 4ALUA 4BDKA 5A4TA 3MESA 2GNGA 5IMXA 4E6AA 4F6WA 4BYJA 4D4VA 3G0EA 4BHNA 4CZYB 3O0GA 3VUTA 3MS9A 2PVYA 4RQVA 5HO7A 4JDHA 3JXWA 1KOAA 3GB2A 4XLIA 1J91A 5EW9A 2OJGA 3AKLA 3OUKA 4B8MA 1SM2A 4I24A 4QMVA 4XBRA 5CSVA 3WF5A 4MQ2A 5K0KA 1YXTA 3ZSHA 4BBFA 1W83A 1WBNA 4U6RA 2BRNA 2ZM4A 5JT2A 3NUNA 3R04A 4IX4A 4ZY5A 5JFXA 3P5JC 5IQDA 2BAKA 3C5UA 2XJ0A 1LUFA 5IDNA 4G6OA 3NVMB 3NYXA 3RAHA 3DZOA 4D2VA 3R02A 3HKOA 4OW8A 4EZ7A 4EEVA 3DU8A 3Q9YA 3EQFA 5DH3A 4FL2A 3ALNA 4EWHA 3R83A 4FSQA 4FG7A 4G1WA 2OIBA 4DAWA 1SNXA 4YPDA 4FTOA 3UDTA 5AR7A 5EYDA 4FTRA 3QD4A 1Z9XA 4MUQA 2UW0A 3O2MA 4I5MA 1V1KA 5AWMA 2VTSA 3IDPA 3VUIA 5M07A 3CSVA 5BVFA 4EHEA 4CKJA 4FK3A 3DGKA 3E8EA 3U9NA 5CSPA 2OJIA 4FJVA 4ZMFA 3R28A 4ENYA 5FGKA 3KA0A 4JG7A 3D5WA 3SXSA 3FXXA 4RG0A 2VU3A 4PX6A 1YWVA 4RQKA 4X7QA 3PXRA 4YLKA 2ERKA 2XEZA 4KNBA 5DG5A 3PA5A 5HVJA 4BDEA 1U46A 2X2KA 4J1RA 5FTOA 4F9BA 5HIEA 4O0SA 3CCNA 5HE3A 4PMSA 4L42A 3DB6A 3RK9A 3LJ2A 3EQCA 3HV7A 3M2WA 5CSHA 4BI0A 2YJSA 3I4BA 1IASA 3KQ7A 2BUJA 3FPMA 5CSWA 1KWPA 2QOKA 2IZSA 4L52A 4MD7E 4ASEA 4M69B 3QU0A 3DAJA 4WKQA 4YMJA 3PLSA 3WE4A 2OFUA 2CN5A 4D2TA 4QMXA 3NW6A 2KTYA 3QLFA 5CAUA 2VTJA 3MPTA 2GNJA 4OTWA 2W9FB 4J71A 1W2FA 1WVWA 3RHXA 1FVVA 2Y4PA 2XK8A 2XS0A 3EN9A 5JH6A 2OLCA 3LOKA 5FM3A 4TL0A 4KINA 1PJKA 3ZSGA 3DFAA 3TZ8A 3GOKA 3WIKA 4ANSA 3A60A 5CQWA 3QRIA 1ST0A 3NCZA 3RAWA 2UZDA 3HNGA 3LCKA 4JBQA 3OTVA 3AMAA 2YACA 2BILB 3O50A 4GW8A 3BZ3A 3KRJA 3SX9A 4RX5A 4AA5A 2J0LA 4FSUA 4ZMEA 2WMAA 4FKGA 4AT3A 2G2HA 1V0BA 1B38A 4RFYA 2GS2A 1BI7A 4L44A 2ITTA 4AW0A 3KULA 2XM9A 3FZSA 1M7QA 2RSVA 3Q3BA 4NJ3A 4UBAA 5EOLA 2B55A 4JDJA 4L67A 4N4SA 3AKKA 2A98A 5CS6A 1VLRA 3U8WA 3AD4A 2ETKA 3FL4A 1FMOE 4DBNA 3PJ1A 3P86A 3OHTA 1GIJA 4HVDA 3SV0A 4U43A 5LWMA 2BZIB 1UWHA 2QLQA 4IVDA 4IJ9A 3EFLA 3R2BA 4FTAA 5HHWA 4UZDA 1GIIA 5A4QA 2Y8OA 4GFOA 4FRFA 5JQ8A 5HG7A 3PJCA 2R3KA 3IS5A 1I44A 4MNEB 4F64A 4IM3A 1P14A 2GFCA 2VTNA 3F5PA 3GI3A 4YJNA 2IG7A 2B9HA 4O38A 4O7NA 3TXOA 2XM8A 1RDQE 2WOTA 3ORMA 4C61A 4FEWA 4NH1A 2R3PA 2ZVAA 2GFSA 3ENHA 3SOCA 3AC4A 1MRVA 4TNDA 3P23A 4RIWA 4DEAA 4ZJVA 1Q3DA 4GUEA 4IEBA 1Q3WA 2JAVA 3MW1A 3QQFA 5ANJA 5FTGA 2NP8A 4X2FA 2GSFA 2HZ0A 3F3WA 4L45A 3Q2MA 3WIGA 4ASDA 1KE6A 5KMOA 2IZUA 5BPYA 4DGNA 3K2LA 3PXKA 3PJ3A 4WBOA 3C5IA 2G15A 3I79A 4PQNA 4I5CA 4RLKA 4KSQA 1FOTA 4JJRA 4B6LA 3EKKA 4RC4A 2OSCA 2UZEA 4JRNA 3TN8A 4MH7A 2F2UA 3CS9A 4NWMA 2C3IB 4XBUA 4BI1A 4M66A 2C0IA 4W8DA 4X6RA 4IAAA 1JKSA 2X6DA 3DBQA 3QZGA 4ZTMA 3FZPA 3TIZA 3PP1A 3D2IA 5TR6A 4WO5A 4DEEA 4EC8A 3F3ZA 4EOQA 4FKTA 3TUBA 4ZEGA 4O4CA 1XMMA 3UC4A 4MK0A 1OL6A 5LMKA 2XANA 1UU8A 4RVTA 5CZHA 3ZDIA 4EUTA 4EYJA 4U5JA 4DLIA 3PRFA 3UO4A 3EL8A 3FI3A 1YXUA 4LYNA 3TNIA 3NCGA 3TZ7A 3BL9A 4PTEA 3OT3A 3LFAA 2VZ6A 3OCTA 4Q5HA 2Z8CA 4FTJA 3ZRMA 4RFZA 4XMOA 3R8MA 4JDIA 4C38A 1TKIA 2O5KA 3E7VA 4U3YA 4XOZA 2R3GA 1HCLA 4UYAA 5BMMA 4E1ZA 4TY1A 1BYGA 4PMMA 3V8TA 1M14A 4O0VA 3QQJA 4NEUA 4RIYA 1FGIA 1Q8UA 3QD2B 4G17A 3QHRA 5LOHA 1OKYA 3UQFA 2RG5A 2X6EA 1SVEA 1GAGA 3EQRA 1B39A 4YC3A 3KXHA 3TNQB 2QOIA 1XBCA 3LAUA 2VTRA 4LUEA 4ONAA 3E63A 2JKQA 4AZVA 2Q83A 3OFMA 1R0PA 1OKWA 2GTMA 2XKEA 4FSTA 4Q2AA 4BCFA 5CAOA 5CEMA 3QTZA 3M42A 3IW5A 3E64A 3CQEA 2OFVA 3PVUA 1UVRA 5J9ZA 2CNUA 5IQCA 3EKNA 2WIPA 4WNOA 4QP1A 3KF7A 4EWQA 1Q8YA 3F61A 4FKUA 2C3KA 3AXWA 1KV2A 5BUIA 4XCUA 1PMUA 1YW2A 2B4SB 4LGGA 4PNKA 4RPVA 3DXPA 5AEPA 4USEA 4RJ3A 2Y0AA 1AGWA 4RVMA 4FT0A 3BWJA 5H8BA 4CV9A 4EOMA 2XK9A 3LFQA 4S34A 2PWLA 5F94A 2X0PA 3OBJA 4LV8A 4RX7A 2WPAA 4AX8A 4C7TA 4QMMA 2ITPA 4R78A 1OM1A 2C6EA 4IB5A 3H30A 5ETCA 3JUHA 4A9TA 3DBDA 3K5VA 3PSBA 4W9XA 2X81A 5HEZA 5CY3A 3VQUA 5DVRA 3OTUA 4ZLZA 2ACXA 2JD5A 1OPLA 1Q61A 3QTQA 2Z7QA 4IX3A 4W4VA 4A9YA 4G9RA 4OAVB 1M17A 3LMGA 4UMRA 2OF2A 3V6RA 1SZMA 3KVWA 4GKIA 1ZMWA 3O23A 4KS8A 2WMSA 4E4LA 4FE2A 3KXGA 4AGDA 4C3PA 4JT3A 4RIXA 4EBVA 4FODA 3GXLA 2WOUA 3VWAA 4PL4A 3EL7A 5HIBA 2F7XE 2XRUA 4EYMA 5KKRC 3R9RA 5HE2A 4FSZA 1DAWA 2UZUE 1YDSE 3OCGA 4IXPA 3WOWA 5G6VA 5IH6A 2R3QA 4HVSA 4IM2A 3SXRA 5HO6A 4BTFA 2B9JA 3CGFA 3DKFA 3VUHA 2CPKE 2YIRA 1REJA 3Q5IA 1IR3A 5HG9A 3CPBA 4F70A 3L9NA 4O0TA 1LR4A 3Q4ZA 5CT7A 4QPMA 4YTIA 1URCA 3UYSA 4BCMA 3R9NA 3RPRA 3L9MA 3SQQA 4BCQA 4USFA 3ZEWA 1OPKA 1V0PA 2BZHB 1YOMA 3ORIA 5FRIA 3R9DA 3E7OA 3PPZA 3MVJA 3Q96A 2XNBA 4LRMA 4TWNA 3VULA 2WHBA 2C6OA 3Q9ZA 4LOOA 2UUEA 4WT6A 1CKIA 3COHA 4RWKA 2QO2A 3EN4A 3QX4A 4K2RA 4L01A 4O0WA 1KE8A 3CTHA 3VJNA 5BX0A 3W0MA 3MGYA 3QKLA 5ACBC 4MF1A 4MD9E 3SW7A 4N0SA 3C0GA 3A4OX 5C26A 4YJPA 5K5NA 1PXLA 2H34A 3ZM9A 3FMDA 4FNZA 4AG8A 3DDQA 2VD5A 2JDOA 4N6ZA 1Q99A 4N57A 4IW0A 5AX9A 3W2PA 4FSYA 5IQGA 2QR8A 2J0JA 2YEXA 1OKVA 2WQOA 4YHFA 4CQEA 5E8XA 4QP4A 5ANKA 1TFFA 2Y4IC 3QTRA 2V62A 4FX3A 4IH8A 3QTIA 5EK7A 3QTXA 3AGMA 3O5AA 3AT4A 4IDTA 3VS0A 5E7RA 4HZRA 2PMNX 2VRXA 4FSWA 2JIIA 1R1WA 2V5QA 5HNBA 3R22A 3VVHA 3L8PA 3CD8A 4FTLA 4ZLOA 1ZOEA 5CU6A 3ZFXA 2XK6A 3NUYA 1BL6A 3ORLA 1O6KA 3KK8A 3TZMA 4AFEA 4IE9A 4MXYA 2QG7A 2R4BA 3GCUA 4QTBA 3ZEPA 3C4XA 1B6CB 3B8RA 4XHKB 2CKEA 2PE2A 3GUBA 5D10A 5EI6A 4IWQA 4AF3A 4DH5A 4IB0A 3I81A 4ITJA 4F99A 5IQHA 3TCPA 1BI8A 5GIPE 3C13A 2FGIA 5CAVA 4X2NA 2BRMA 2BKKA 4CEGA 3ZLYA 5BVDA 5I3OA 2YA9A 4X3FA 3R01A 4CV8A 5EHYA 1P5EA 1IG1A 3DK7A 3KULB 4RJ8A 5BVNA 2X2MA 4C3RA 1OL5A 5EM6A 1YQJA 3UPXA 3FYKX 2F49A 1P2AA 2GHMA 2O63A 2VAGA 3IECA 3NNWA 3U6IA 4DEGA 2UZWE 3ZBFA 1LEWA 2ONLA 3POZA 3QALE 5HD7A 1URWA 4EOKA 4RJ5A 4BIEA 2O0UA 4M0ZA 1J7IA 4FEUA 5H3QA 3EQGA 4GG5A 3GCVA 1PYXA 2CLXA 3BQRA 4EL9A 5GHVA 2YM4A 4L00A 4F6UA 1ERKA 1W2DA 4YNOA 3TMOA 3GNIB 2Z02A 3A8XA 2DS1A 4NM5A 1PXNA 4UEUA 4C58A 5KE0A 5CI6A 3MIYA 4C3FA 4YZBA 3L8SA 3BYOA 2WEIA 3LE6A 1H07A 4J99A 2XA4A 3QXOA 4MXOA 2GQRA 2WTDA 2QR7A 4BBEA 4TYHB 2HZNA 4NZWB 3ZUUA 3GQIA 4RIWB 1VR2A 2O8YA 5CU4A 2BAQA 4OBPA 4CYJA 4ZZMA 1ZYJA 3GC0A 3MDYA 1HCKA 1XHAA 3QKMA 4D5KA 3RTPA 4IVAA 1W98A 3EN6A 2HAKA 4IADA 2ITXA 4O0XA 4QPSA 3QZHA 5CASA 5M4FA 3R1YA 4LRJA 4WRGA 2I0EA 5F20A 3FMNA 4ZSAA 4MEDA 1YDRE 5JGDA 2VGPA 1LEZA 3FL5A 3NUXA 3W0NA 3I6WA 2QOBA 4U44A 4FKQA 1PMNA 3ZRKA 1G8AA 4NKAA 2ITZA 3R21A 2WTVA 3O8TA 3NNUA 4BC6A 2WMUA 3OWJA 3OY3A 3R8ZA 4AZWA 4YLLA 2OG8A 4FUYA 4QMWA 4YHTA 3QLGA 5DMZA 2IVVA 3EOCA 4TT7A 3R1QA 3NFGB 3VS4A 4KRDA 3KIOC 5D7AA 1JNKA 2XIZA 2XNOA 4EKLA 3II5A 1PMVA 3A2CA 1JKTA 4L3JA 1VEBA 3E8CA 3EWHA 5JZJA 4TKSA 4JQ8A 4FV8A 3L9PA 5E4HA 4UMUA 4HGLA 2YWPA 2WKMA 3SAYA 5EKOA 5EW3A 2OJFE 4XV3A 5L2SA 3QA0A 4AS0A 2BIYA 3OMVA 4RZVA 4XP2A 5DT4A 1MUOA 4EK8A