4GEVA

E. coli thymidylate synthase y209w variant in complex with substrate and a cofactor analog
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLWSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A remote mutation affects the hydride transfer by disrupting concerted protein motions in thymidylate synthase.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Escherichia coli
total genus 79
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4gevA00
1BQ1A 2TDDA 3BZ0A 1AXWA 1NJDA 1JTQA 4E5OA 3V8HA 1KCEA 3HB8A 4GEVA 1RTSA 1J3JC 1QZFA 1THYA 4H0UA 1TJSA 4KNZA 3QG2A 1EV5A 4EINA 2RDAA 3BYXA 1NJBA 3DGAC 1J3IC 1TVUA 3N5EA 4PSGA 4XSCA 3KJRA 4FOAA 1TSVA 3INVA 1TRGA 4DPDA 2RD8A 2VF0A 1NJEA 2G8DA 1SEJA 1EVGA 1F4DA 1F4BA 4JEFA 1BKOA 4G6WX 1I00A 3IK0A 1NJAA 1BJGA 5H39A 1TDCA 1ZPRA 2TDMA 1BP6A 2H2QA 1EVFA 3DL5A 4FOXA 5FCTA 3EGYX 1JU6A 2BBQA 3EBUA 3TMSA 1BQ2A 3BNZA 1TDUA 4EILA 1B5EA 3B5BA 1BDUA 1NJCA 2TSCA 4FOGA 1B5DA 4O1UA 2KCEA 3IHIA 4GD7A 5HS3A 1F28A 1AN5A 1JG0A 3JSUA 1JUJA 1TSYA 1TYSA 1YPVA 3H9KA 3BGXA 1QQQA 1KZIA 3K2HA 2OIPA 4ECKA 1F4GA 3IRMA 5J7WA 1VZAA 4Q0EA 3QGTA 4KYAA 1B49A 1HW3A 4DPHA 1TDAA 3BHRA 1TSDA 3EAWX 1TLCA 4LRRA 3EDWX 1JUTA 4H0RA 1BO8A 2G89A 3DG8C 3EF9A 1TSZA 4EB4A 1SYNA 1AOBA 1EV8A 3IK1A 1VZDA 3B9HA 3EHIX 4UP1A 1HZWA 4GYHA 1TSNA 3UM5A 1VZEA 2TSRA 3KGBA 3N5GA 1BO7A 4DQ1A 1JMGA 1BSPA 1VZBA 3HBBA 3UWLB 3IJZA 4XSEA 4G2OX 3BFIA 4KY8A 3GG5A 2A9WA 3NRRA 1TVVA 1KZJA 5WRNA 4DP3A 1LCBA 1BIDA 1F4FA 1AJMA 4FGTA 4H1IA 1F4CA 1BP0A 5H38A 1TSWA 1B02A 1BSFA 3BHLA 3QJ7A 1NCEA 4O1XD 1JMIA 1F4EA 1TSLA 3EJLA 1BKPA 1J3KC 1JMHA 2G8XA 3UM8A 1BPJA 3IRNA 4TMSA 3KJSA 1DNAA 2G86A 4Q0DA 3DL6A 4IRRA 3N5EB 3GH2X 1FWMA 1HVYA 3GH0A 1JTUA 4XSDA 5H3AA 1TLSA 1FFLA 1LCEA 2FTQA 3UM6A 4EZ8A 2G8AA 2RD8B 3UWLA 2FTNA 1CI7A 4KY4A 1HW4A 1TVWA 1TSXA 1TSMA 2AAZA 3CLBA 4IQBA 1DDUA 4O1XA 1JMFA 4F2VA 3I3RA 3C06A 3CL9A 5BY6A 3C0AA 4E28A 1VZCA 3IX6A 3HJ3A 1TDBA 3OB7A 2FTOX 4IQQA 1LCAA 4ISWA 4FQSA 1AIQA 1TISA 3IROA 4KPWA 2VETA 4ISKA 3ED7A 4O7UA 2ONBA
chains in the Genus database with same CATH superfamily
1BQ1A 2TDDA 3BZ0A 1AXWA 1NJDA 1JTQA 4E5OA 3V8HA 1KCEA 3HB8A 4GEVA 1RTSA 1J3JC 1QZFA 1THYA 4H0UA 1TJSA 4KNZA 3QG2A 1EV5A 4EINA 2RDAA 3BYXA 1NJBA 3DGAC 1J3IC 1TVUA 3N5EA 4PSGA 4XSCA 3KJRA 4FOAA 1TSVA 3INVA 1TRGA 4DPDA 2RD8A 2VF0A 1NJEA 2G8DA 1SEJA 1EVGA 1F4DA 1F4BA 4JEFA 1BKOA 4G6WX 1I00A 3IK0A 1NJAA 1BJGA 5H39A 1TDCA 1ZPRA 2TDMA 1BP6A 2H2QA 1EVFA 3DL5A 4FOXA 5FCTA 3EGYX 1JU6A 2BBQA 3EBUA 3TMSA 1BQ2A 3BNZA 1TDUA 4EILA 1B5EA 3B5BA 1BDUA 1NJCA 2TSCA 4FOGA 1B5DA 4O1UA 2KCEA 3IHIA 4GD7A 5HS3A 1F28A 1AN5A 1JG0A 3JSUA 1JUJA 1TSYA 1TYSA 1YPVA 3H9KA 3BGXA 1QQQA 1KZIA 3K2HA 2OIPA 4ECKA 1F4GA 3IRMA 5J7WA 1VZAA 4Q0EA 3QGTA 4KYAA 1B49A 1HW3A 4DPHA 1TDAA 3BHRA 1TSDA 3EAWX 1TLCA 4LRRA 3EDWX 1JUTA 4H0RA 1BO8A 2G89A 3DG8C 3EF9A 1TSZA 4EB4A 1SYNA 1AOBA 1EV8A 3IK1A 1VZDA 3B9HA 3EHIX 4UP1A 1HZWA 4GYHA 1TSNA 3UM5A 1VZEA 2TSRA 3KGBA 3N5GA 1BO7A 4DQ1A 1JMGA 1BSPA 1VZBA 3HBBA 3UWLB 3IJZA 4XSEA 4G2OX 3BFIA 4KY8A 3GG5A 2A9WA 3NRRA 1TVVA 1KZJA 5WRNA 4DP3A 1LCBA 1BIDA 1F4FA 1AJMA 4FGTA 4H1IA 1F4CA 1BP0A 5H38A 1TSWA 1B02A 1BSFA 3BHLA 3QJ7A 1NCEA 4O1XD 1JMIA 1F4EA 1TSLA 3EJLA 1BKPA 1J3KC 1JMHA 2G8XA 3UM8A 1BPJA 3IRNA 4TMSA 3KJSA 1DNAA 2G86A 4Q0DA 3DL6A 4IRRA 3N5EB 3GH2X 1FWMA 1HVYA 3GH0A 1JTUA 4XSDA 5H3AA 1TLSA 1FFLA 1LCEA 2FTQA 3UM6A 4EZ8A 2G8AA 2RD8B 3UWLA 2FTNA 1CI7A 4KY4A 1HW4A 1TVWA 1TSXA 1TSMA 2AAZA 3CLBA 4IQBA 1DDUA 4O1XA 1JMFA 4F2VA 3I3RA 3C06A 3CL9A 5BY6A 3C0AA 4E28A 1VZCA 3IX6A 3HJ3A 1TDBA 3OB7A 2FTOX 4IQQA 1LCAA 4ISWA 4FQSA 1AIQA 1TISA 3IROA 4KPWA 2VETA 4ISKA 3ED7A 4O7UA 2ONBA
chains in the Genus database with same CATH topology
1BQ1A 2TDDA 3BZ0A 1AXWA 1NJDA 1JTQA 4E5OA 3V8HA 1KCEA 3HB8A 4GEVA 1RTSA 1J3JC 1QZFA 1THYA 4H0UA 1TJSA 4KNZA 3QG2A 1EV5A 4EINA 2RDAA 3BYXA 1NJBA 3DGAC 1J3IC 1TVUA 3N5EA 4PSGA 4XSCA 3KJRA 4FOAA 1TSVA 3INVA 1TRGA 4DPDA 2RD8A 2VF0A 1NJEA 2G8DA 1SEJA 1EVGA 1F4DA 1F4BA 4JEFA 1BKOA 4G6WX 1I00A 3IK0A 1NJAA 1BJGA 5H39A 1TDCA 1ZPRA 2TDMA 1BP6A 2H2QA 1EVFA 3DL5A 4FOXA 5FCTA 3EGYX 1JU6A 2BBQA 3EBUA 3TMSA 1BQ2A 3BNZA 1TDUA 4EILA 1B5EA 3B5BA 1BDUA 1NJCA 2TSCA 4FOGA 1B5DA 4O1UA 2KCEA 3IHIA 4GD7A 5HS3A 1F28A 1AN5A 1JG0A 3JSUA 1JUJA 1TSYA 1TYSA 1YPVA 3H9KA 3BGXA 1QQQA 1KZIA 3K2HA 2OIPA 4ECKA 1F4GA 3IRMA 5J7WA 1VZAA 4Q0EA 3QGTA 4KYAA 1B49A 1HW3A 4DPHA 1TDAA 3BHRA 1TSDA 3EAWX 1TLCA 4LRRA 3EDWX 1JUTA 4H0RA 1BO8A 2G89A 3DG8C 3EF9A 1TSZA 4EB4A 1SYNA 1AOBA 1EV8A 3IK1A 1VZDA 3B9HA 3EHIX 4UP1A 1HZWA 4GYHA 1TSNA 3UM5A 1VZEA 2TSRA 3KGBA 3N5GA 1BO7A 4DQ1A 1JMGA 1BSPA 1VZBA 3HBBA 3UWLB 3IJZA 4XSEA 4G2OX 3BFIA 4KY8A 3GG5A 2A9WA 3NRRA 1TVVA 1KZJA 5WRNA 4DP3A 1LCBA 1BIDA 1F4FA 1AJMA 4FGTA 4H1IA 1F4CA 1BP0A 5H38A 1TSWA 1B02A 1BSFA 3BHLA 3QJ7A 1NCEA 4O1XD 1JMIA 1F4EA 1TSLA 3EJLA 1BKPA 1J3KC 1JMHA 2G8XA 3UM8A 1BPJA 3IRNA 4TMSA 3KJSA 1DNAA 2G86A 4Q0DA 3DL6A 4IRRA 3N5EB 3GH2X 1FWMA 1HVYA 3GH0A 1JTUA 4XSDA 5H3AA 1TLSA 1FFLA 1LCEA 2FTQA 3UM6A 4EZ8A 2G8AA 2RD8B 3UWLA 2FTNA 1CI7A 4KY4A 1HW4A 1TVWA 1TSXA 1TSMA 2AAZA 3CLBA 4IQBA 1DDUA 4O1XA 1JMFA 4F2VA 3I3RA 3C06A 3CL9A 5BY6A 3C0AA 4E28A 1VZCA 3IX6A 3HJ3A 1TDBA 3OB7A 2FTOX 4IQQA 1LCAA 4ISWA 4FQSA 1AIQA 1TISA 3IROA 4KPWA 2VETA 4ISKA 3ED7A 4O7UA 2ONBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQ1 A;  2TDD A;  3BZ0 A;  1AXW A;  1NJD A;  1JTQ A;  4E5O A;  3V8H A;  1KCE A;  3HB8 A;  4GEV A;  1RTS A;  1J3J C;  1QZF A;  1THY A;  4H0U A;  1TJS A;  4KNZ A;  3QG2 A;  1EV5 A;  4EIN A;  2RDA A;  3BYX A;  1NJB A;  3DGA C;  1J3I C;  1TVU A;  3N5E A;  4PSG A;  4XSC A;  3KJR A;  4FOA A;  1TSV A;  3INV A;  1TRG A;  4DPD A;  2RD8 A;  2VF0 A;  1NJE A;  2G8D A;  1SEJ A;  1EVG A;  1F4D A;  1F4B A;  4JEF A;  1BKO A;  4G6W X;  1I00 A;  3IK0 A;  1NJA A;  1BJG A;  5H39 A;  1TDC A;  1ZPR A;  2TDM A;  1BP6 A;  2H2Q A;  1EVF A;  3DL5 A;  4FOX A;  5FCT A;  3EGY X;  1JU6 A;  2BBQ A;  3EBU A;  3TMS A;  1BQ2 A;  3BNZ A;  1TDU A;  4EIL A;  1B5E A;  3B5B A;  1BDU A;  1NJC A;  2TSC A;  4FOG A;  1B5D A;  4O1U A;  2KCE A;  3IHI A;  4GD7 A;  5HS3 A;  1F28 A;  1AN5 A;  1JG0 A;  3JSU A;  1JUJ A;  1TSY A;  1TYS A;  1YPV A;  3H9K A;  3BGX A;  1QQQ A;  1KZI A;  3K2H A;  2OIP A;  4ECK A;  1F4G A;  3IRM A;  5J7W A;  1VZA A;  4Q0E A;  3QGT A;  4KYA A;  1B49 A;  1HW3 A;  4DPH A;  1TDA A;  3BHR A;  1TSD A;  3EAW X;  1TLC A;  4LRR A;  3EDW X;  1JUT A;  4H0R A;  1BO8 A;  2G89 A;  3DG8 C;  3EF9 A;  1TSZ A;  4EB4 A;  1SYN A;  1AOB A;  1EV8 A;  3IK1 A;  1VZD A;  3B9H A;  3EHI X;  4UP1 A;  1HZW A;  4GYH A;  1TSN A;  3UM5 A;  1VZE A;  2TSR A;  3KGB A;  3N5G A;  1BO7 A;  4DQ1 A;  1JMG A;  1BSP A;  1VZB A;  3HBB A;  3UWL B;  3IJZ A;  4XSE A;  4G2O X;  3BFI A;  4KY8 A;  3GG5 A;  2A9W A;  3NRR A;  1TVV A;  1KZJ A;  5WRN A;  4DP3 A;  1LCB A;  1BID A;  1F4F A;  1AJM A;  4FGT A;  4H1I A;  1F4C A;  1BP0 A;  5H38 A;  1TSW A;  1B02 A;  1BSF A;  3BHL A;  3QJ7 A;  1NCE A;  4O1X D;  1JMI A;  1F4E A;  1TSL A;  3EJL A;  1BKP A;  1J3K C;  1JMH A;  2G8X A;  3UM8 A;  1BPJ A;  3IRN A;  4TMS A;  3KJS A;  1DNA A;  2G86 A;  4Q0D A;  3DL6 A;  4IRR A;  3N5E B;  3GH2 X;  1FWM A;  1HVY A;  3GH0 A;  1JTU A;  4XSD A;  5H3A A;  1TLS A;  1FFL A;  1LCE A;  2FTQ A;  3UM6 A;  4EZ8 A;  2G8A A;  2RD8 B;  3UWL A;  2FTN A;  1CI7 A;  4KY4 A;  1HW4 A;  1TVW A;  1TSX A;  1TSM A;  2AAZ A;  3CLB A;  4IQB A;  1DDU A;  4O1X A;  1JMF A;  4F2V A;  3I3R A;  3C06 A;  3CL9 A;  5BY6 A;  3C0A A;  4E28 A;  1VZC A;  3IX6 A;  3HJ3 A;  1TDB A;  3OB7 A;  2FTO X;  4IQQ A;  1LCA A;  4ISW A;  4FQS A;  1AIQ A;  1TIS A;  3IRO A;  4KPW A;  2VET A;  4ISK A;  3ED7 A;  4O7U A;  2ONB A; 
#chains in the Genus database with same CATH topology
 1BQ1 A;  2TDD A;  3BZ0 A;  1AXW A;  1NJD A;  1JTQ A;  4E5O A;  3V8H A;  1KCE A;  3HB8 A;  4GEV A;  1RTS A;  1J3J C;  1QZF A;  1THY A;  4H0U A;  1TJS A;  4KNZ A;  3QG2 A;  1EV5 A;  4EIN A;  2RDA A;  3BYX A;  1NJB A;  3DGA C;  1J3I C;  1TVU A;  3N5E A;  4PSG A;  4XSC A;  3KJR A;  4FOA A;  1TSV A;  3INV A;  1TRG A;  4DPD A;  2RD8 A;  2VF0 A;  1NJE A;  2G8D A;  1SEJ A;  1EVG A;  1F4D A;  1F4B A;  4JEF A;  1BKO A;  4G6W X;  1I00 A;  3IK0 A;  1NJA A;  1BJG A;  5H39 A;  1TDC A;  1ZPR A;  2TDM A;  1BP6 A;  2H2Q A;  1EVF A;  3DL5 A;  4FOX A;  5FCT A;  3EGY X;  1JU6 A;  2BBQ A;  3EBU A;  3TMS A;  1BQ2 A;  3BNZ A;  1TDU A;  4EIL A;  1B5E A;  3B5B A;  1BDU A;  1NJC A;  2TSC A;  4FOG A;  1B5D A;  4O1U A;  2KCE A;  3IHI A;  4GD7 A;  5HS3 A;  1F28 A;  1AN5 A;  1JG0 A;  3JSU A;  1JUJ A;  1TSY A;  1TYS A;  1YPV A;  3H9K A;  3BGX A;  1QQQ A;  1KZI A;  3K2H A;  2OIP A;  4ECK A;  1F4G A;  3IRM A;  5J7W A;  1VZA A;  4Q0E A;  3QGT A;  4KYA A;  1B49 A;  1HW3 A;  4DPH A;  1TDA A;  3BHR A;  1TSD A;  3EAW X;  1TLC A;  4LRR A;  3EDW X;  1JUT A;  4H0R A;  1BO8 A;  2G89 A;  3DG8 C;  3EF9 A;  1TSZ A;  4EB4 A;  1SYN A;  1AOB A;  1EV8 A;  3IK1 A;  1VZD A;  3B9H A;  3EHI X;  4UP1 A;  1HZW A;  4GYH A;  1TSN A;  3UM5 A;  1VZE A;  2TSR A;  3KGB A;  3N5G A;  1BO7 A;  4DQ1 A;  1JMG A;  1BSP A;  1VZB A;  3HBB A;  3UWL B;  3IJZ A;  4XSE A;  4G2O X;  3BFI A;  4KY8 A;  3GG5 A;  2A9W A;  3NRR A;  1TVV A;  1KZJ A;  5WRN A;  4DP3 A;  1LCB A;  1BID A;  1F4F A;  1AJM A;  4FGT A;  4H1I A;  1F4C A;  1BP0 A;  5H38 A;  1TSW A;  1B02 A;  1BSF A;  3BHL A;  3QJ7 A;  1NCE A;  4O1X D;  1JMI A;  1F4E A;  1TSL A;  3EJL A;  1BKP A;  1J3K C;  1JMH A;  2G8X A;  3UM8 A;  1BPJ A;  3IRN A;  4TMS A;  3KJS A;  1DNA A;  2G86 A;  4Q0D A;  3DL6 A;  4IRR A;  3N5E B;  3GH2 X;  1FWM A;  1HVY A;  3GH0 A;  1JTU A;  4XSD A;  5H3A A;  1TLS A;  1FFL A;  1LCE A;  2FTQ A;  3UM6 A;  4EZ8 A;  2G8A A;  2RD8 B;  3UWL A;  2FTN A;  1CI7 A;  4KY4 A;  1HW4 A;  1TVW A;  1TSX A;  1TSM A;  2AAZ A;  3CLB A;  4IQB A;  1DDU A;  4O1X A;  1JMF A;  4F2V A;  3I3R A;  3C06 A;  3CL9 A;  5BY6 A;  3C0A A;  4E28 A;  1VZC A;  3IX6 A;  3HJ3 A;  1TDB A;  3OB7 A;  2FTO X;  4IQQ A;  1LCA A;  4ISW A;  4FQS A;  1AIQ A;  1TIS A;  3IRO A;  4KPW A;  2VET A;  4ISK A;  3ED7 A;  4O7U A;  2ONB A; 
#chains in the Genus database with same CATH homology
 1BQ1 A;  2TDD A;  3BZ0 A;  1AXW A;  1NJD A;  1JTQ A;  4E5O A;  3V8H A;  1KCE A;  3HB8 A;  4GEV A;  1RTS A;  1J3J C;  1QZF A;  1THY A;  4H0U A;  1TJS A;  4KNZ A;  3QG2 A;  1EV5 A;  4EIN A;  2RDA A;  3BYX A;  1NJB A;  3DGA C;  1J3I C;  1TVU A;  3N5E A;  4PSG A;  4XSC A;  3KJR A;  4FOA A;  1TSV A;  3INV A;  1TRG A;  4DPD A;  2RD8 A;  2VF0 A;  1NJE A;  2G8D A;  1SEJ A;  1EVG A;  1F4D A;  1F4B A;  4JEF A;  1BKO A;  4G6W X;  1I00 A;  3IK0 A;  1NJA A;  1BJG A;  5H39 A;  1TDC A;  1ZPR A;  2TDM A;  1BP6 A;  2H2Q A;  1EVF A;  3DL5 A;  4FOX A;  5FCT A;  3EGY X;  1JU6 A;  2BBQ A;  3EBU A;  3TMS A;  1BQ2 A;  3BNZ A;  1TDU A;  4EIL A;  1B5E A;  3B5B A;  1BDU A;  1NJC A;  2TSC A;  4FOG A;  1B5D A;  4O1U A;  2KCE A;  3IHI A;  4GD7 A;  5HS3 A;  1F28 A;  1AN5 A;  1JG0 A;  3JSU A;  1JUJ A;  1TSY A;  1TYS A;  1YPV A;  3H9K A;  3BGX A;  1QQQ A;  1KZI A;  3K2H A;  2OIP A;  4ECK A;  1F4G A;  3IRM A;  5J7W A;  1VZA A;  4Q0E A;  3QGT A;  4KYA A;  1B49 A;  1HW3 A;  4DPH A;  1TDA A;  3BHR A;  1TSD A;  3EAW X;  1TLC A;  4LRR A;  3EDW X;  1JUT A;  4H0R A;  1BO8 A;  2G89 A;  3DG8 C;  3EF9 A;  1TSZ A;  4EB4 A;  1SYN A;  1AOB A;  1EV8 A;  3IK1 A;  1VZD A;  3B9H A;  3EHI X;  4UP1 A;  1HZW A;  4GYH A;  1TSN A;  3UM5 A;  1VZE A;  2TSR A;  3KGB A;  3N5G A;  1BO7 A;  4DQ1 A;  1JMG A;  1BSP A;  1VZB A;  3HBB A;  3UWL B;  3IJZ A;  4XSE A;  4G2O X;  3BFI A;  4KY8 A;  3GG5 A;  2A9W A;  3NRR A;  1TVV A;  1KZJ A;  5WRN A;  4DP3 A;  1LCB A;  1BID A;  1F4F A;  1AJM A;  4FGT A;  4H1I A;  1F4C A;  1BP0 A;  5H38 A;  1TSW A;  1B02 A;  1BSF A;  3BHL A;  3QJ7 A;  1NCE A;  4O1X D;  1JMI A;  1F4E A;  1TSL A;  3EJL A;  1BKP A;  1J3K C;  1JMH A;  2G8X A;  3UM8 A;  1BPJ A;  3IRN A;  4TMS A;  3KJS A;  1DNA A;  2G86 A;  4Q0D A;  3DL6 A;  4IRR A;  3N5E B;  3GH2 X;  1FWM A;  1HVY A;  3GH0 A;  1JTU A;  4XSD A;  5H3A A;  1TLS A;  1FFL A;  1LCE A;  2FTQ A;  3UM6 A;  4EZ8 A;  2G8A A;  2RD8 B;  3UWL A;  2FTN A;  1CI7 A;  4KY4 A;  1HW4 A;  1TVW A;  1TSX A;  1TSM A;  2AAZ A;  3CLB A;  4IQB A;  1DDU A;  4O1X A;  1JMF A;  4F2V A;  3I3R A;  3C06 A;  3CL9 A;  5BY6 A;  3C0A A;  4E28 A;  1VZC A;  3IX6 A;  3HJ3 A;  1TDB A;  3OB7 A;  2FTO X;  4IQQ A;  1LCA A;  4ISW A;  4FQS A;  1AIQ A;  1TIS A;  3IRO A;  4KPW A;  2VET A;  4ISK A;  3ED7 A;  4O7U A;  2ONB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...