4GF0A

Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
208
structure length
208
Chain Sequence
MVMLTLYFTPGTISVAVAIAIEEAALPYQPVRVDFATAEQTKPDYLAINPKGRVPALRLEDDTILTETGALLDYVAAIAPKAGLVPTDPTAAAQMRSAMYYLASTMHVAHAHKMRGSRWAKQQSSFEDMTAQVPETMAACADFVESDILRGPYVLGEDFSLADPYLFVVCNWLDGDGVDTAAYPKITTFMQQMTARASVAAVKDKGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of glutahtione transferase homolog from sulfitobacter, TARGET EFI-501084, with bound glutathione
rcsb
source organism Sulfitobacter
molecule tags Transferase
total genus 76
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gf0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gf0A01
2LRCA 2RM5A 1XWKA 4WF5A 1LU4A 5IMZA 2WB9A 2IMDA 6GSWA 5GZZB 4P3YB 3KGKA 3D5JA 1OYJA 2B3SA 2C3QA 1K0MA 3HD5A 2HRKA 2VL3A 5ECKB 4ISDA 4KA0A 1SJZA 4CDOA 1EOHA 4ZB6A 1HYUA 2HLSA 3EU4A 3QDNA 2I4AA 1TI3A 1XWCA 4KCEA 4JE1A 1MDKA 2OBIA 3FEUA 4GRFA 1OC9A 1ZGNA 4GLTA 1Z7RA 2IPAA 2GQKA 2ZNMA 1O6JA 3DKSA 4HEA2 5A4VA 1ML6A 4PNFA 1NW2A 3IV4A 5J9CA 2EIOA 2DJ1A 2VAFA 3ZMKA 4BVXA 4EC0A 3KH7A 1XFLA 5KEJA 3HKRA 4TOPA 1NSWA 5ECOB 1CQHA 1THXA 1TP9A 3F8UA 1WIKA 2GSRA 4I2TA 2UZ8A 4XS1A 3FZ5A 3HVVA 2O85A 3ME8A 2GTUA 5DJMA 3ZFLA 5G1KA 3ZTLA 3APSA 4ID0A 5ECQB 1ABAA 4K9ZA 1F2EA 3Q74A 2WFCA 2DJJA 4BA7A 4AJ7A 3QFBC 1UN2A 2L4CA 5ID2A 2DIYA 3VWXA 2IMEA 2NBSA 4ECCA 4XS4B 5HR3A 5ECRB 3GTUB 4MJBA 3L78A 4JZQA 1HD2A 2F8FA 1YKCA 3IXRA 2O89A 3TKPA 3SBCA 2DJKA 4POBA 5CNWA 1U88A 1N8JA 5HR2A 2V6OA 3PH9A 5DBQA 3A5WA 2VCXA 2DIZA 4TR4A 3BJ5A 4MMMA 1SL0B 5IMVA 2JL4A 4USSA 5D73A 5ELAA 12GSA 1FW1A 4FIWA 3TRQA 1B8XA 1S3AA 4I8BA 5FWGA 2E0QA 2GSSA 4LMWA 1AUCA 1KEBA 4BWQA 2E2MA 3UVHA 3LXZA 2KUCA 2MMAA 3KCMA 3BOAA 14GSA 4MH3A 5E4WA 1Q4JA 5COHA 4OFTA 1XXUA 4PTSA 2ES7A 3LSZA 3FW2A 3GHAA 2H66A 4K7IA 3F6FA 1WWJA 4RQXA 5D9VA 2VCQA 1XW9A 4ZL7A 1XOAA 4TVEA 1LJRA 1E2YA 2HSMB 2OE3A 4G19A 2YV7A 3FYGA 1GSYA 3ERWA 3QFAC 3KTBA 2BJXA 1B9YC 3L0HA 3J7Yk 1E6BA 3TKSA 1AC1A 4RQRA 3LQ7A 4PNGA 1J08A 1YKAA 1G7EA 4L0UA 2ON5A 3KXOA 1K3YA 5D9TA 1GUHA 1H75A 4YQMA 5HR0A 2HFDA 3C8EA 2KLXA 1AXDA 1NHYA 3R2QA 3H1NA 3F9UA 4XS4A 3GTUA 4IW9A 4HQSA 1ST9A 2YCDA 5INYA 1PRXA 5IPGA 3F0IA 2HSYA 2LQOA 3QAGA 2HNLA 3UVTA 2X8GA 1G6YA 2IFQB 2C4JA 4HI7A 2MMZA 5HQPA 5KN3A 3GN3A 1TRSA 2PWJA 1THOA 3KH9A 4JR4A 2OADA 4GQCA 3NZNA 3GV1A 3GKKA 4ZBAA 3AY8A 7GSSA 1GTAA 2HXKA 5CRGA 4AGSA 4O32A 2H0IA 2GS3A 2DJ3A 1LBKA 4HU7A 2V2GA 4OWYA 4PQIA 3APQA 4IBPA 4KE3A 4EDYA 4ZXGA 1VRSD 1ZL9A 1T3BA 3IOSA 5LNKe 2FGXA 2H19A 4G0IA 3GL3A 3WT2A 5ECMB 2LNTA 3G7IA 1VF1A 1W4VA 3IK7A 2FY6A 1GSFA 2B1KA 3UIWA 4KAEA 5HR1A 5IO0A 1RW1A 2CAQA 2NTOA 2I1UA 4PUFC 2AAWA 3KP8A 2WRTA 4IJIA 2PVQA 1O8XA 3I69A 3M3MA 3C7MA 2LRNA 2HSMA 3RHBA 1EZKA 1FB6A 3EMPA 2CA8A 1Y25A 2YWMA 3GURA 2FCHA 4POLA 1UA5A 2L59A 2Z9SA 2HE3A 4G0KA 1JZDA 4XRDA 4D73B 1BG5A 5CO3A 4HJ2A 3FR6A 5G30A 4TR1A 3O76A 1XIYA 2HRFA 1SJIA 4OCFA 4EUYA 4KUNA 1SKRB 3DVXA 1HNCA 3RHCA 5J3RA 1TJDA 2JZSA 1OC3A 1GLPA 2VL9A 4WETA 2VCZA 2HQTA 3RDWA 2H0GA 3VK9A 1A2MA 2HI7A 1GUMA 3IE3A 3W6GA 2IFQA 5JCWA 2JSZA 2H1AA 3TJBA 2PVOC 3GH9A 4BPYA 1TU8A 1PKZA 3LFLA 1EGOA 3WYWA 3BD2A 3H79A 3ERGA 4KX4A 3ERFA 1GSQA 2VOCA 3GKNA 4G9HA 3LXTA 1M9BA 2I9HA 1DE2A 4YQUA 4EKZA 2JSYA 2MBSA 4MF7A 2WS2A 5H5QA 1TRVA 3ZVJA 4TKYA 2HRAA 1B4QA 4ML1A 3C73A 2YWNA 1YEPA 4IS0A 2CZ3A 1GRXA 3M0FA 4EL1A 3WGDA 2TRCP 4PGTA 3N5OA 3K8NA 4XTSA 2EIQA 4K7OA 4BVYB 1H4OA 1GULA 3DWVA 1O73A 3F4TA 3M8NA 2K8SA 3P7XA 1V57A 3TB2A 1SYXA 4F0BA 1TOFA 3TOTA 5CP1A 4PQ1A 1K3OA 3QOUA 1X9MB 4F0CA 2FWFA 5ABRA 1ERWA 4POMA 2H72A 5GSSA 2RLIA 5F05A 2B7KA 2GQMA 9GSSA 4LLRA 4V1Ap 1PMTA 2E7PA 2H01A 4HUAA 1M9AA 3HA9A 4O5RA 4KB3A 3FY7A 4MABA 2CQ9A 4ACSA 4JU5A 1MDIA 3ZRDA 4AJ6A 2MZCA 4MJEA 2ZUPA 3A2WA 1VF2A 4Q5FA 1BQ7A 2AUVA 2BMXA 3DD3A 5F0GA 2WDUA 2JADA 6GSYA 2ZCTA 3KJYA 3WT1A 5IMFA 1PX6A 1JZWA 2H6XA 5A4UA 3CTFA 1QFNA 3ME7A 4I5QA 1FB0A 3L9SA 3KIJA 1GL8A 1M2DA 3QAWA 3BBYA 1V9WA 2HZEB 2GT6A 3IDVA 3TDGA 2LSTA 4IP6A 4NV5A 4WXTA 3L9VA 4K2DA 2L6DA 3IHQA 2M72A 1SKWB 2PPTA 3ZL5A 2JACA 2V32A 4WF4A 1AIUA 2XBQA 2NDOA 5DJLA 3QPMA 8GSSA 2XPDA 4X1UA 2O87A 1QK8A 1TK0B 3FKFA 1FG4A 2OE0A 2FUG2 3HJMA 4ILFA 3PR8A 1GSDA 5AGYA 2H71A 2GSTA 4GQFA 1PKWA 3H93A 1B4PA 2R37A 1S3DA 3UBLA 2M80A 4X43A 2YN1A 1TU7A 2FHEA 4ZIJA 1Z5YE 5J4UA 1K3LA 1Z7PA 2REMA 4XCSA 3ZFBA 4V1Ag 3D21A 4IJ3A 4MJAA 1J9BA 2L6CA 16GSA 2VL2C 2YJHA 2JU5A 1GNWA 4MA9A 3P90A 4L5LA 1W89A 4G0LA 2DMMA 1EWXA 5L71A 4MZCA 4DSSB 2F3MA 4OFMA 3WGXA 1KTEA 4EE0A 1O81A 3ZITA 3GA4A 4L0WA 3HY2A 3WD6A 1JFUA 11GSA 6GSTA 1K0CA 4AJ8A 1Z9HA 4GSTA 1TK8B 2LS5A 3F6DA 5ECHB 2GZPA 2B7JA 1GSSA 5H5RA 1AAZA 4ML6A 3E3EA 3D4TA 1UVZA 3GKMA 4N11A 5GSTA 1WMJA 1OC8A 4O92A 1R26A 1GTUA 4OMVA 5IOXA 4F9ZA 3LWAA 5IIZA 3UL3A 2PERA 4TXVA 3CSJA 1XWGA 3US3A 5C04A 5G2ZA 2H1DA 2H1BA 4GTUA 4XHMA 1C72A 1JLWA 1PA3A 3SWLA 3VURA 4IQ1A 1DUGA 3GSTA 3M9JA 2V6KA 4N30A 2HZEA 3Q18A 2X64A 3ZMLA 3CTGA 1EV9A 3DMLA 2FA8A 5AIVA 1BX9A 3IBHA 1OKTA 2FLSA 4N10A 5B6NA 4HJMA 2L57A 4E8EA 2CX4A 3DVWA 1EEMA 1JZRA 3F4RA 2FNOA 1FAAA 2CVBA 3CRUA 4ECJA 4MDCA 3G7YA 6GSVA 1ZCPA 4GSSA 1I9DA 4K8MA 3ED3A 3MWHA 3EU3A 6GSUA 1FO5A 1SKSB 3MSZA 1B9XC 4ZBBA 3W8JA 1BYEA 1M2BA 3KZQA 1KBNA 1U3IA 1EGRA 13GSA 2BTOT 4EF0A 5F06A 3LORA 3A3TA 2R3XA 2F51A 4V2LA 2WGRA 4MJCA 4GXZA 2IWTA 4NWYA 5AN1A 2AB6A 2YOIA 1EEJA 4TRXA 2VM2A 2L5LA 3D22A 1SK1A 2DC5A 4EXJA 20GSA 3HCZA 2ALBA 3KMNA 2YP6A 3J7Yb 4RI6A 4JEDA 3IPZA 4WBRD 1PL2A 3F63A 1GH2A 3CMIA 4HZ4A 2C8UA 5DAKB 2OACA 5CRWA 3G7JA 3WGEA 5ECPB 1PX7A 2H30A 2K6VA 1TXXA 5LD0A 4YAVA 2LJAA 4F82A 3VWWA 2B5EA 2CAIA 3M1GA 3HYPA 5LCZA 2AJQB 2RUEA 4FQUA 5DCHA 4QL9A 3TKRA 3HZ4A 4BWSA 5D9XA 1U87A 4LL4B 5IQYA 5DQSA 1AQWA 3L9UA 2DLXA 1QUWA 4TR3A 4H86A 1ERTA 1OE7A 1OKDA 1URMA 1UC7A 2B6MA 1GNEA 3EWLA 1A23A 1WE0A 3VWVA 2K9FA 3F3QA 2P31A 4KH7A 1VF4A 3EVIA 3V1WA 2MYGA 4PUAA 5D96A 1XBSA 2TIRA 2QSIA 4OCEA 4DSRA 4IGJA 3ZLPA 3HDCA 3VLNA 3IAS2 1MD3A 1XPVA 1PGTA 2WULA 5ELGA 4WR5A 1HQOA 4EVMA 2GGTA 1DE1A 5B8BA 3FR9A 2L5OA 1EOGA 2TRXA 2KP2A 4GWRA 2YPMA 3NOFA 1XCCA 1X9WB 4PURA 1MTCA 1OAZA 2JZRA 1IYHA 2H70A 2IMIA 5AISA 2EIRA 5B6MA 4KNDA 4TR0A 2N5AA 1KNGA 1TW9A 3CYNA 1Z6MA 5F07A 5JCGA 4MF6A 2H73A 5HFIA 3UJ1A 5HFKA 1IYIA 1F37A 5D9WA 4ULXA 3GX8A 3FRCA 2FWHA 1AQXA 3GIXA 5DAKA 5CREA 3OR5A 3DGQA 1PQNA 3APOA 3UMAA 1F3AA 4PXOA 3GMFA 3HVSA 4FYCA 3HJPA 3QD9A 1SD8A 3CXGA 1WOUA 3NIVA 5IO2A 2AHEA 1RK4A 5GAND 3BCKA 2XPEA 4K0NA 4J57E 3GRXA 2DSAA 1SJ6A 1XVWA 2HRKB 2X99A 5DDLA 2MMOA 2KP1A 3RPNA 2LKUA 4XIHA 2KOKA 5IMDA 4NMUA 2NVLA 4MLYA 2H6YA 3FZAA 4IHUA 4MPGA 1TK5B 4AF2A 2H6ZA 1YF1A 3KP9A 1BAYA 3QR6A 2GDRA 3O3TA 1GP1A 3DIEA 4Z7XA 1FVJA 2VL2A 1TRWA 3RPPA 2K8VA 3UEMA 2LV3A 4NPBA 2C80A 2A2SA 5AIXA 2IL3A 3P8WA 3C1SA 1J0FA 4BVXB 3P2AA 2DMLA 4DEJA 4IN0A 3GNJA 2J9HA 2QKEA 3LG6A 4KDUA 2VLTA 5CAXA 5KN1A 3HZ8A 1O8WA 1TDIA 2NPBA 3O6TA 1GSUA 1GLQA 4K1FA 3GKXA 3ZYWA 1WPIA 1JHBA 1GTBA 4F03A 2OKAA 2WZ9A 5A4WA 1Y6EA 2A4VA 3H8QA 4X0XA 6GSXA 2MMNA 3LYKA 1X5DA 3L4NA 1WRYA 4DVCA 2J23A 1SENA 4G10A 2H8LA 1A24A 3KD0A 4OD7A 1YQ1A 3LEFA 3KEBA 5EY6A 2B5YA 4D73A 3IR4A 1SK2A 4MCUA 1FVKA 18GSA 3UARA 4K7NA 3U6VA 1M2AA 2OA7A 3TRPA 2B5XA 2A2RA 5HFGA 4NAXA 1M99A 2LQQA 5A5KA 5D93A 2P5RA 3HXSA 1U6TA 4FO5A 2PMTA 4ECIA 4XS6A 5F8BA 2H75A 4HU9A 5J41A 2FA4A 3CSHA 1ILOA 3MNGA 2WCIA 2C0DA 4V2MA 5EVOA 1QQ2A 2AYTA 2CT6A 4NHZA 1PSQA 4KGIA 4OO5A 4GCIA 2B1LA 2V41A 1NHOA 1FHEA 3FHKA 1YDKA 1QXHA 2VCWA 2LTKA 2F8AA 2D2ZA 4EO3A 5EL8A 4MP4A 1K0DA 1F6MC 3TJKA 2N5BA 2YV9A 1T00A 2DJ0A 2IJYA 3TJFA 1SYRA 3MAKA 4WEYA 1OE8A 2R4VA 3ZREA 4TXOB 4WBJA 4N0ZA 1YY7A 3E0UA 3QAVA 5CRHA 3JCML 2RUFA 4YH2A 3E9JB 3I43A 5JWQB 4G2EA 1YJ6A 2FWEA 1USBA 2WJUA 4BVYA 1ON4A 2YWOA 5IOWA 2XHFA 4GSNA 2YANA 5DVBA 2FD3A 3R3EA 1R5AA 1WP0A 3BCIA 4ZBDA 5E59A 4TN8A 2VD1A 1K0AA 1ZZYA 5H5SA 4KW6A 3VWUA 4Q5QA 2HT9A 2ON7A 4OO4A 5CRDA 2DJ2A 5ENUA 1F3BA 1YZXA 2IIYA 3PPUA 5DCGA 3VI7A 5JWRB 3IC8A 3VFIA 1SL2B 1F9MA 1QMVA 1ZYEA 4OFNA 3F3RA 4E8HA 1TKDB 4NHWA 2C3NA 3HHVA 1T8EB 4Q5NA 3QCPA 1M7TA 5DQYA 2M46A 2LJKA 4KSMA 4NV2A 3GFKA 4KF9A 4MPFA 1T4ZA 2CZ2A 2HSHA 1A0FA 1PD21 1ZMAA 2MBTA 3FK8A 2V1MA 2PBJA 4JRRA 2H0HA 3EYTA 3H4KA 4IP1A 2R2JA 2XBIA 3D6IA 3UAPA 1TI1A 2C0EA 3Q6OA 1XZOA 1XVQA 1R4WA 3TCOA 1WJKA 2PN8A 3ZIJA 1X0RA 2IMKA 2GZYA 4LL1B 3FR3A 1O85A 1ACVA 3CBUA 2VCTA 3DRNA 1SK0A 4IKHA 1TTZA 3EINA 3IAM2 3U5RE 2PU9C 4ZB8A 5C00A 1CQGA 5G5EA 2CVDA 2X8HA 4PQHA 2YNXA 1V40A 4TXOA 3A2VA 2VCVA 5CYYA 2N5FA 1G0TA 1AQVA 3UOMA 2QGVA 5KN0A 2CVKA 4ZL8A 5IM9A 2JZTA 3I9V2 2VIMA 2PGTA 3TRXA 2C0FA 2IMFA 2L4QA 2I81A 1I5GA 2G2QA 4MZBA 1FOVA 2LRTA 1Z6NA 3DEXA 19GSA 3EMXA 1A2LA 4K0GA 3ZZXA 1MEKA 4POKA 4DSSA 1VF3A 4NXIA 3A2XA 2EC4A 3GX0A 5FHIA 2O7KA 3TUEA 1K0OA 4N0VA 1A2JA 2C3TA 2CV4A 3C71A 3KTLA 4I97A 3TGZA 4TR1B 4WKWA 1DBYA 4MK3A 3DYRA 2LEGA 2VD0A 2PUKC 2XC2A 5G31A 5JWOB 2VM1A 2K18A 3TJJA 4BL7B 1T4YA 1NM3A 5J5NA 2AV4A 1PN9A 3FZ4A 5IMAA 1GSEA 3LYPA 4F2IA 3CSIA 1GTIA 3N9JA 4ZILA 5GAPD 3IRAA 4KCAA 4JR6A 3MDKA 3F4SA 2RIIA 2H1GA 1ERVA 4FYBA 1Z3EA 1G6WA 1B48A 2LUSA 2VLUA 1SD9A 2O8VB 4KSOA 1EP8A 4RI7A 5ECLB 3TOUA 3TKSE 4J2FA 2RM6A 22GSA 2HRNA 1JZOA 3GL5A 4JBBA 2X8CA 4FH8A 4I2UA 3IK9A 1GUKA 3EC3A 2QC7A 1DSBA 2IN3A 1X5EA 2YJ7A 4YAPA 1X9SB 4QQ7A 4QL7A 2YZHA 5IMCA 5JCUA 2I3YA 4ZL9A 2GT5A 1XW5A 4L5OA 4TW5A 2LJRA 3VI5A 4HQZA 1JLVA 4KDXA 2C0GA 2KHPA 2YWIA 2LNSA 1HNBA 1X5CA 4HDEA 1XW6A 4MH2A 1AW9A 1EV4A 3TJGA 1PL1A 10GSA 3ZVJD 3D4MA 5G5FA 2GSQA 1HNAA 1YEXA 3EURA 1MD4A 5ECIB 5D8IA 3M9KA 3ISOA 3CRTA 5DALB 1XOBA 1EP7A 4GF0A 2R5GA 4XRAA 3IC4A 5IPHA 2VO4A 3TKSC 1ZYQB 4RUVA 1M0UA 4ZB9A 2F9SA 4LMVA 1V58A 4BL7A 3GH6A 2HYXA 1XWAA 3HJOA 4CHSA 5J9BA 4FYUA 1VGLA 3VPTA 3S9FA 1T7PB 1T1VA 3RAZA 1U3AA 3C1RA 3EE2A 2VLVA 6GSSA 5BMUA 1R5PA 3PGTA 1XWBA 3W8SA 2DBCA 3GUSA 1OC9B 2OJLA 1ERUA 1SU9A 1TRUA 1QGVA 4Q5RA 3UBKA 1Q98A 1R7HA 2OBKA 2CX3A 4L8EA 3RBTA 4HS1A 1A8YA 3GSSA 1O7UA 5EPFA 1OVNA 4KDYA 3KM6A 1ZOFA 4YQVA 5FT3A 4K6XA 4V2NA 4IVFA 2OE1A 3IA1A 3ZIVA 4PX1A 2H74A 4IQAA 4HOJA 3GYKA 2VUPA 5G1LA 2E2GA 1K0BA 2HZFA 5B8AA 3TKQA 4EDZA 2G0FA 4HZ2A 5ECSA 1MDJA 4MZWA 3G9BA 2GVPA 1G7OA 1GWCA 2P0GA 1N2AA 3I6AA 2P5QA 2H76A 4ECBA 2C1YA 4J56E 1BJXA 3Q19A 2FWGA 2R6KA 4I6XA 17GSA 1A8LA 1RQMA 5ECNB 3QMXA 2HSNB 1K0NA 2GQLA 5ID2B 2YZUA 1V2AA 3DXBA 3PINA 4LA1A 4CW9A 4MF5A 4IELA 1V98A 1A0RP 5B7CA 4O7HA 3LGCA 1S3CA 3LJRA 1SL1B 5DALA 3HVXA 3VPQA 3KMOA 1BEDA 5KN2A 3FZ9A 1YF0A 3D0ZA 4DSQA 4WR4A 2GLRA 2GZZA
chains in the Genus database with same CATH superfamily
2LRCA 5A5HB 2RM5A 1XWKA 4WF5A 1LU4A 5IMZA 2WB9A 2IMDA 6GSWA 5GZZB 4P3YB 3KGKA 3D5JA 1OYJA 4Z2RA 2R0PA 2B3SA 2C3QA 4CY8A 1K0MA 3HD5A 2HRKA 2VL3A 5ECKB 4ISDA 2WW1A 4KA0A 1SJZA 4CDOA 1EOHA 4ZB6A 1HYUA 2HLSA 3EU4A 3QDNA 2I4AA 1TI3A 1XWCA 4KCEA 4JE1A 1MDKA 2OBIA 3FEUA 4GRFA 1OC9A 4W66A 1ZGNA 4GLTA 1Z7RA 2IPAA 2A2PA 2GQKA 2ZNMA 5J40A 1O6JA 3DKSA 4HEA2 5A4VA 1ML6A 4PNFA 1XG8A 1NW2A 3IV4A 5J9CA 2EIOA 2DJ1A 2VAFA 3ZMKA 4BVXA 4EC0A 3KH7A 4GDFA 1N25A 1XFLA 5KEJA 2O5VA 3HKRA 3CQFA 4TOPA 1NSWA 5ECOB 1CQHA 1THXA 1TP9A 3F8UA 1WIKA 3TU3B 2GSRA 4I2TA 2UZ8A 4XS1A 3FZ5A 3HVVA 2O85A 3ME8A 2GTUA 5DJMA 3ZFLA 4YKFA 5G1KA 3ZTLA 3APSA 4ID0A 4AKGA 5ECQB 1ABAA 4K9ZA 1F2EA 3Q74A 2WFCA 2DJJA 4BA7A 4AJ7A 2HSNA 3QFBC 1UN2A 2L4CA 5ID2A 2DIYA 3VWXA 2IMEA 2NBSA 4ECCA 4XS4B 5HR3A 5ECRB 3GTUB 4MJBA 3L78A 4JZQA 1HD2A 2F8FA 1YKCA 3IXRA 2O89A 3TKPA 3SBCA 2DJKA 4POBA 5CNWA 1U88A 1N8JA 5HR2A 2V6OA 3PH9A 5DBQA 3A5WA 2VCXA 2DIZA 4TR4A 3BJ5A 4MMMA 1SL0B 5IMVA 2JL4A 4USSA 5D73A 5ELAA 5A34B 12GSA 1FW1A 4FIWA 3TRQA 1B8XA 1S3AA 4I8BA 5FWGA 2E0QA 2GSSA 4LMWA 1AUCA 1KEBA 4BWQA 2E2MA 3UVHA 3LXZA 2KUCA 2MMAA 3KCMA 3BOAA 14GSA 4MH3A 5E4WA 1Q4JA 5COHA 4OFTA 1XXUA 4PTSA 2ES7A 3LSZA 3FW2A 3GHAA 4QMKA 2H66A 4K7IA 3F6FA 1WWJA 4RQXA 4CY6A 5D9VA 2VCQA 1XW9A 4ZL7A 1XOAA 4TVEA 1LJRA 1E2YA 2HSMB 2OE3A 4G19A 2YV7A 3FYGA 1GSYA 3ERWA 3QFAC 3KTBA 2BJXA 1B9YC 3L0HA 4ZB7A 3J7Yk 1E6BA 3TKSA 1AC1A 4RQRA 3LQ7A 4PNGA 1J08A 1YKAA 1G7EA 4L0UA 2ON5A 3KXOA 1K3YA 3A5IA 5D9TA 1GUHA 1H75A 4YQMA 5HR0A 2HFDA 3C8EA 2KLXA 1AXDA 1NHYA 3R2QA 3H1NA 3F9UA 4XS4A 3GTUA 4IW9A 4HQSA 1ST9A 2YCDA 5INYA 1PRXA 5IPGA 3F0IA 2HSYA 2LQOA 3QAGA 2HNLA 3UVTA 2X8GA 1G6YA 3LW9A 2IFQB 2C4JA 4HI7A 2MMZA 5HQPA 5KN3A 3GN3A 1TRSA 2PWJA 1THOA 3KH9A 4JR4A 2OADA 4GQCA 3NZNA 3GV1A 3GKKA 4ZBAA 3AY8A 7GSSA 1GTAA 2HXKA 5CRGA 4AGSA 4O32A 2H0IA 4AKXB 2GS3A 2DJ3A 1LBKA 4HU7A 2V2GA 4OWYA 4PQIA 3APQA 4IBPA 4KE3A 4EDYA 4ZXGA 1VRSD 4Z2UA 1ZL9A 1T3BA 3IOSA 5LNKe 2FGXA 2H19A 4G0IA 3GL3A 3WT2A 1BF5A 5ECMB 2LNTA 3G7IA 1VF1A 1W4VA 3IK7A 2FY6A 1GSFA 2B1KA 3UIWA 4KAEA 5HR1A 5IO0A 1RW1A 2CAQA 2NTOA 2I1UA 4PUFC 2AAWA 2WRTA 3KP8A 4IJIA 2O3EA 2PVQA 1O8XA 3I69A 3M3MA 3C7MA 2LRNA 2HSMA 3RHBA 1EZKA 1FB6A 3EMPA 2CA8A 1Y25A 2YWMA 3GURA 2FCHA 4POLA 1UA5A 2L59A 2Z9SA 2HE3A 4G0KA 1JZDA 1BG1A 4ICYA 4XRDA 4D73B 1BG5A 5CO3A 4HJ2A 3FR6A 5G30A 4TR1A 3O76A 1XIYA 2HRFA 1SJIA 4OCFA 4EUYA 4KUNA 1SKRB 3DVXA 1HNCA 3RHCA 5J3RA 1TJDA 2JZSA 1OC3A 1GLPA 2VL9A 4WETA 2VCZA 2HQTA 3RDWA 2H0GA 3VK9A 1A2MA 2HI7A 1GUMA 3IE3A 3W6GA 2IFQA 5JCWA 2JSZA 2H1AA 3TJBA 2PVOC 3GH9A 4BPYA 1TU8A 1PKZA 3LFLA 1EGOA 3WYWA 3BD2A 3H79A 3ERGA 4KX4A 5KOWA 3ERFA 1GSQA 2VOCA 3GKNA 4G9HA 3LXTA 4EIQA 1M9BA 2I9HA 1DE2A 4YQUA 4EKZA 2JSYA 2MBSA 4MF7A 2WS2A 5H5QA 1TRVA 3ZVJA 4TKYA 2HRAA 1B4QA 4ML1A 3C73A 2YWNA 1YEPA 4IS0A 2CZ3A 1GRXA 3M0FA 4EL1A 3WGDA 2TRCP 4PGTA 3N5OA 3K8NA 4XTSA 2OT3A 2EIQA 4K7OA 1SVLA 4BVYB 1H4OA 1GULA 3DWVA 4HSCX 1O73A 3F4TA 3M8NA 2K8SA 3P7XA 1V57A 4PI0C 3TB2A 1SYXA 4F0BA 1TOFA 3TOTA 5CP1A 4PQ1A 1K3OA 3QOUA 1X9MB 4F0CA 2FWFA 5ABRA 1ERWA 4POMA 2H72A 5GSSA 2RLIA 5F05A 2B7KA 2WW2A 2GQMA 9GSSA 4LLRA 4V1Ap 1PMTA 2EFEA 2E7PA 4AKHA 2H01A 4HUAA 1M9AA 3HA9A 4O5RA 4KB3A 2H1LA 3FY7A 4MABA 2CQ9A 4ACSA 4JU5A 1MDIA 3ZRDA 4AJ6A 2MZCA 4MJEA 2ZUPA 3CWGA 3A2WA 1VF2A 4Q5FA 1BQ7A 2AUVA 2BMXA 3DD3A 5F0GA 2WDUA 1ZYNA 2JADA 6GSYA 2ZCTA 3KJYA 3WT1A 5IMFA 1PX6A 1JZWA 2H6XA 5A4UA 3CTFA 1QFNA 3ME7A 4I5QA 1FB0A 3L9SA 3KIJA 1GL8A 1M2DA 3QAWA 4YKGA 3BBYA 1V9WA 2HZEB 2GT6A 2R0CA 3IDVA 3TDGA 2LSTA 4IP6A 4NV5A 4WXTA 3L9VA 4K2DA 2L6DA 3IHQA 2M72A 1SKWB 2PPTA 3ZL5A 2JACA 2V32A 4WF4A 1AIUA 2XBQA 2NDOA 5DJLA 3QPMA 8GSSA 2XPDA 4X1UA 2O87A 1QK8A 1TK0B 2WW3A 3FKFA 1FG4A 2OE0A 2FUG2 3HJMA 4ILFA 1ZYPA 3PR8A 1GSDA 5AGYA 2H71A 2GSTA 4GQFA 1M3JA 1PKWA 3H93A 2VKZG 1B4PA 2R37A 1S3DA 3UBLA 2M80A 4X43A 2YN1A 1TU7A 2FHEA 4ZIJA 1Z5YE 5J4UA 1K3LA 1Z7PA 2REMA 4XCSA 3ZFBA 4V1Ag 3D21A 4IJ3A 1SVOA 4MJAA 1J9BA 2L6CA 16GSA 2VL2C 2YJHA 2JU5A 1GNWA 4MA9A 3P90A 4L5LA 1W89A 4G0LA 2DMMA 1EWXA 5L71A 4MZCA 4DSSB 2F3MA 4OFMA 3WGXA 1KTEA 4EE0A 1O81A 3ZITA 3GA4A 4L0WA 3HY2A 3WD6A 1JFUA 11GSA 4EIPA 6GSTA 1K0CA 4AJ8A 1Z9HA 4GSTA 1TK8B 2LS5A 3F6DA 5ECHB 2GZPA 2B7JA 1GSSA 5H5RA 1AAZA 4ML6A 3MYDA 3E3EA 3D4TA 1UVZA 3GKMA 4N11A 5GSTA 1WMJA 1OC8A 4O92A 1R26A 1GTUA 4OMVA 5IOXA 4F9ZA 3LWAA 1FOHA 5A5HA 3UL3A 5IIZA 2PERA 2A4HA 4TXVA 3CSJA 1XWGA 3US3A 5C04A 5G2ZA 3HVNA 2H1DA 2H1BA 4GTUA 4XHMA 1C72A 1JLWA 1PA3A 3SWLA 3VURA 5J47A 4IQ1A 1DUGA 3GSTA 1YEWC 3M9JA 2V6KA 4N30A 2HZEA 3Q18A 2X64A 3ZMLA 3CTGA 1EV9A 3DMLA 2FA8A 5AIVA 1BX9A 3IBHA 1OKTA 2FLSA 4N10A 5B6NA 4HJMA 2L57A 4E8EA 2CX4A 3DVWA 1EEMA 1JZRA 3F4RA 2FNOA 1FAAA 2CVBA 3CRUA 4ECJA 4MDCA 3G7YA 6GSVA 1ZCPA 4GSSA 1I9DA 4K8MA 3ED3A 3MWHA 3EU3A 6GSUA 1PFOA 1FO5A 1SKSB 3MSZA 1B9XC 4ZBBA 3W8JA 1BYEA 1M2BA 3KZQA 1KBNA 1U3IA 1EGRA 13GSA 2BTOT 4EF0A 5F06A 3LORA 3A3TA 2R3XA 2F51A 4V2LA 2WGRA 4MJCA 4GXZA 4BIKA 2IWTA 4NWYA 5AN1A 2AB6A 2YOIA 1EEJA 4TRXA 2VM2A 2L5LA 3D22A 1SK1A 2DC5A 4EXJA 20GSA 3HCZA 2ALBA 3KMNA 2YP6A 1Y1UA 3J7Yb 4RI6A 4JEDA 3IPZA 4WBRD 1PL2A 1TXUA 3F63A 1GH2A 3CMIA 4HZ4A 2C8UA 5DAKB 2OACA 5CRWA 3G7JA 3WGEA 5KOXA 5ECPB 1PX7A 2H30A 2K6VA 1TXXA 5LD0A 4YAVA 2LJAA 4F82A 3VWWA 2B5EA 2CAIA 3M1GA 3HYPA 5LCZA 2AJQB 2UV8G 2RUEA 4FQUA 5DCHA 4QL9A 3TKRA 3HZ4A 5A34A 4BWSA 5D9XA 1U87A 4LL4B 5IQYA 5DQSA 1AQWA 3L9UA 2DLXA 1QUWA 4TR3A 4H86A 1ERTA 1OE7A 1OKDA 1URMA 1UC7A 2B6MA 1GNEA 4G01A 3EWLA 1A23A 1WE0A 2X4AA 3VWVA 2K9FA 3F3QA 2P31A 4KH7A 1VF4A 3EVIA 3V1WA 2MYGA 4PUAA 5D96A 1XBSA 2TIRA 2QSIA 4OCEA 4DSRA 4IGJA 3ZLPA 3HDCA 3VLNA 2EFCA 2R0GA 1MD3A 1XPVA 3IAS2 1PGTA 2WULA 5ELGA 4WR5A 1HQOA 4EVMA 2GGTA 1DE1A 5B8BA 3FR9A 2L5OA 1EOGA 2TRXA 2KP2A 4GWRA 2YPMA 3NOFA 1XCCA 1X9WB 4PURA 1MTCA 1OAZA 2JZRA 1IYHA 2H70A 2IMIA 5AISA 2EIRA 5B6MA 4KNDA 4TR0A 2N5AA 4E68A 1KNGA 3CHXC 1TW9A 3CYNA 1Z6MA 5F07A 5JCGA 4MF6A 2H73A 5HFIA 5J4VA 2QA2A 2X49A 3UJ1A 5HFKA 1IYIA 1F37A 5D9WA 4ULXA 3GX8A 3FRCA 2FWHA 1AQXA 3GIXA 5DAKA 5CREA 3OR5A 3DGQA 1PQNA 3APOA 3UMAA 1F3AA 4PXOA 3GMFA 3HVSA 4FYCA 3HJPA 1SD8A 3CXGA 3QD9A 1WOUA 3NIVA 5IO2A 2AHEA 1RK4A 5GAND 3BCKA 2XPEA 4K0NA 4J57E 3GRXA 2DSAA 1SJ6A 1XVWA 2HRKB 2X99A 5DDLA 2MMOA 3EPTA 2KP1A 3RPNA 2LKUA 4XIHA 2KOKA 5IMDA 4NMUA 2NVLA 4MLYA 2H6YA 1SVMA 3FZAA 4IHUA 4MPGA 1TK5B 4AF2A 2H6ZA 5BRTA 1YF1A 3KP9A 1BAYA 1S4BP 3QR6A 2GDRA 3O3TA 1GP1A 3DIEA 4Z7XA 1FVJA 2VL2A 1TRWA 3RPPA 1I1IP 4AKIA 2K8VA 3UEMA 2LV3A 4NPBA 2C80A 2A2SA 5AIXA 2IL3A 3P8WA 4K2XA 4A5PA 3C1SA 2WZSA 1J0FA 4BVXB 3P2AA 2DMLA 4DEJA 4IN0A 3GNJA 2J9HA 2QKEA 3LG6A 4KDUA 2VLTA 4Z2TA 5CAXA 5KN1A 2O36A 3HZ8A 1O8WA 1TDIA 2NPBA 3O6TA 1GSUA 1GLQA 4K1FA 3GKXA 3ZYWA 1WPIA 1JHBA 1GTBA 4F03A 2OKAA 2WZ9A 5A4WA 1Y6EA 2A4VA 3H8QA 4X0XA 6GSXA 2MMNA 3LYKA 1X5DA 3L4NA 1WRYA 4DVCA 2J23A 1SENA 4G10A 2H8LA 1A24A 3KD0A 4OD7A 1YQ1A 3LEFA 3KEBA 5EY6A 2B5YA 4D73A 3IR4A 1SK2A 4MCUA 1FVKA 18GSA 3UARA 4K7NA 3U6VA 1M2AA 2OA7A 3TRPA 2B5XA 2A2RA 5HFGA 4NAXA 1M99A 2LQQA 5A5KA 5D93A 2P5RA 3HXSA 1U6TA 4FO5A 2PMTA 4ECIA 4XS6A 5F8BA 2H75A 4HU9A 5J41A 2FA4A 3CSHA 1ILOA 3MNGA 2WCIA 2C0DA 4V2MA 5EVOA 1QQ2A 2AYTA 2CT6A 4NHZA 1PSQA 4KGIA 4OO5A 4GCIA 2B1LA 2V41A 5A1NB 1NHOA 1FHEA 3FHKA 1YDKA 1QXHA 2VCWA 2LTKA 2F8AA 2D2ZA 4EO3A 5EL8A 4MP4A 1K0DA 1F6MC 3TJKA 2N5BA 2YV9A 1T00A 2DJ0A 2IJYA 3TJFA 1SYRA 3MAKA 4WEYA 1OE8A 2R4VA 3ZREA 4TXOB 4WBJA 4N0ZA 1YY7A 3E0UA 3QAVA 5CRHA 3JCML 2RUFA 4YH2A 1S3RA 3E9JB 3I43A 5JWQB 4G2EA 1YJ6A 2FWEA 1USBA 2WJUA 4BVYA 1ON4A 2YWOA 5IOWA 4MNNA 2XHFA 4GSNA 2YANA 5DVBA 2FD3A 3R3EA 1R5AA 1WP0A 3BCIA 4ZBDA 5E59A 4TN8A 2VD1A 1K0AA 1ZZYA 5H5SA 4KW6A 3VWUA 4Q5QA 2HT9A 2ON7A 4OO4A 5CRDA 2DJ2A 5ENUA 1F3BA 1YZXA 2IIYA 3PPUA 5DCGA 3VI7A 5JWRB 3IC8A 3VFIA 1SL2B 1F9MA 2WVXB 1QMVA 1ZYEA 4OFNA 4X4JA 3F3RA 4E8HA 1TKDB 4NHWA 2C3NA 3HHVA 1T8EB 4Q5NA 3QCPA 1M7TA 5DQYA 2M46A 2LJKA 4KSMA 4NV2A 3GFKA 4KF9A 4MPFA 1T4ZA 2CZ2A 2HSHA 1A0FA 1PD21 1ZMAA 2MBTA 3FK8A 2V1MA 2PBJA 4JRRA 2H0HA 3EYTA 3H4KA 4IP1A 2R2JA 2XBIA 3D6IA 3UAPA 1TI1A 2C0EA 3Q6OA 1XZOA 1XVQA 1R4WA 3TCOA 1WJKA 2PN8A 3ZIJA 1X0RA 2IMKA 2GZYA 4LL1B 5A1NA 3FR3A 1O85A 1ACVA 3CBUA 2VCTA 3DRNA 2EFDA 1SK0A 4IKHA 1TTZA 3EINA 3IAM2 3U5RE 2PU9C 4ZB8A 5C00A 1CQGA 5G5EA 2QA1A 2CVDA 2X8HA 4PI2C 4PQHA 2YNXA 1V40A 4TXOA 3A2VA 2VCVA 5CYYA 2N5FA 1G0TA 1AQVA 3UOMA 2QGVA 5KN0A 2CVKA 4ZL8A 4PHZC 5IM9A 2JZTA 3I9V2 2VIMA 2PGTA 3TRXA 2C0FA 2IMFA 2L4QA 2I81A 1I5GA 2G2QA 4MZBA 2WW0A 1FOVA 2LRTA 1Z6NA 4O5QA 3DEXA 19GSA 3EMXA 1A2LA 4K0GA 3ZZXA 1MEKA 4POKA 3RGBC 2EFHA 4DSSA 1VF3A 4NXIA 3A2XA 2EC4A 1PN0A 3GX0A 5FHIA 2O7KA 3TUEA 1K0OA 4N0VA 1A2JA 2C3TA 2CV4A 3C71A 3KTLA 4I97A 3TGZA 4TR1B 4WKWA 2WVXA 1DBYA 4MK3A 3DYRA 2LEGA 2VD0A 2PUKC 2XC2A 5G31A 5JWOB 2VM1A 2K18A 3TJJA 4BL7B 1T4YA 1NM3A 5J5NA 2AV4A 1PN9A 3FZ4A 5IMAA 1GSEA 3LYPA 4F2IA 3CSIA 1GTIA 3N9JA 4ZILA 5GAPD 3IRAA 4KCAA 4JR6A 5BMUB 3MDKA 3F4SA 3FMWA 2RIIA 2H1GA 1ERVA 4FYBA 1Z3EA 1G6WA 1B48A 2LUSA 2VLUA 1SD9A 1M3IA 5J4YA 2O8VB 4KSOA 1EP8A 4RI7A 5ECLB 3TOUA 3TKSE 4J2FA 2RM6A 3RFRC 22GSA 2HRNA 1JZOA 3GL5A 4JBBA 2X8CA 4FH8A 4I2UA 3IK9A 3EC3A 1GUKA 2QC7A 1DSBA 2IN3A 1X5EA 2YJ7A 4YAPA 1X9SB 4N3ZA 4QQ7A 4QL7A 2YZHA 5IMCA 5JCUA 2I3YA 4ZL9A 2GT5A 1XW5A 4L5OA 4TW5A 2LJRA 3VI5A 4HQZA 1JLVA 4KDXA 2C0GA 2KHPA 2YWIA 2LNSA 1HNBA 1X5CA 4HDEA 1XW6A 3IHGA 4MH2A 1AW9A 1EV4A 3TJGA 1PL1A 10GSA 3ZVJD 3D4MA 5G5FA 2GSQA 1HNAA 1YEXA 3EURA 1MD4A 5ECIB 5D8IA 3M9KA 3ISOA 3CRTA 5DALB 1XOBA 1EP7A 4GF0A 2R5GA 4XRAA 3IC4A 5IPHA 2VO4A 3TKSC 3HMJG 1ZYQB 4K5RA 4RUVA 1M0UA 3MIXA 2WVZA 4ZB9A 2F9SA 4LMVA 4AI6A 1V58A 4BL7A 3GH6A 2HYXA 1YVLA 1XWAA 3HJOA 4CHSA 5J9BA 4FYUA 1VGLA 3VPTA 3S9FA 1T7PB 1T1VA 3RAZA 1U3AA 3C1RA 3EE2A 2VLVA 6GSSA 5BMUA 4FXYP 2DKHA 1R5PA 3PGTA 1XWBA 3W8SA 2DBCA 3GUSA 1OC9B 2OJLA 4K5SA 1ERUA 1SU9A 1TRUA 1QGVA 4Q5RA 3UBKA 1Q98A 1R7HA 2OBKA 2CX3A 4L8EA 3RBTA 4HS1A 1A8YA 3GSSA 1O7UA 2WVYA 5EPFA 1OVNA 4KDYA 3KM6A 1ZOFA 4O5UA 4YQVA 5FT3A 4K6XA 4V2NA 4IVFA 2OE1A 3IA1A 3ZIVA 4PX1A 2H74A 4IQAA 4HOJA 3GYKA 2VUPA 5G1LA 2E2GA 1K0BA 2HZFA 5B8AA 3TKQA 4EDZA 2G0FA 4HZ2A 5ECSA 1MDJA 4MZWA 3G9BA 2GVPA 1G7OA 1GWCA 2P0GA 1N2AA 3I6AA 2P5QA 2H76A 4ECBA 2C1YA 4J56E 1BJXA 3Q19A 2FWGA 2R6KA 4I6XA 17GSA 1A8LA 1RQMA 5ECNB 3QMXA 2DKIA 2HSNB 1K0NA 2GQLA 5ID2B 2YZUA 1V2AA 3DXBA 3PINA 4LA1A 4CW9A 4MF5A 4IELA 1V98A 1A0RP 5B7CA 4O7HA 3LGCA 1S3CA 3LJRA 1SL1B 5DALA 3HVXA 3VPQA 3KMOA 1BEDA 5KN2A 3FZ9A 1YF0A 3D0ZA 4DSQA 4WR4A 2GLRA 2GZZA
chains in the Genus database with same CATH topology
2LRCA 5A5HB 2RM5A 1XWKA 4WF5A 1LU4A 5IMZA 2WB9A 2IMDA 6GSWA 5GZZB 4P3YB 3KGKA 3D5JA 1OYJA 4Z2RA 2R0PA 2B3SA 2C3QA 4CY8A 1K0MA 3HD5A 2HRKA 2VL3A 5ECKB 4ISDA 4KA0A 1SJZA 4CDOA 1EOHA 4ZB6A 1HYUA 2HLSA 3EU4A 3QDNA 2I4AA 1TI3A 1XWCA 4KCEA 4JE1A 1MDKA 2OBIA 3FEUA 4GRFA 1OC9A 4W66A 1ZGNA 4GLTA 1Z7RA 2IPAA 2A2PA 2GQKA 2ZNMA 5J40A 1O6JA 3DKSA 4HEA2 5A4VA 1ML6A 4PNFA 1NW2A 3IV4A 5J9CA 2EIOA 2DJ1A 2VAFA 3ZMKA 4BVXA 4EC0A 3KH7A 4GDFA 1N25A 1XFLA 5KEJA 2O5VA 3HKRA 4TOPA 1NSWA 5ECOB 1CQHA 1THXA 1TP9A 3F8UA 1WIKA 3TU3B 2GSRA 4I2TA 2UZ8A 4XS1A 3FZ5A 3HVVA 2O85A 3ME8A 2GTUA 5DJMA 3ZFLA 4YKFA 5G1KA 3ZTLA 3APSA 4ID0A 4AKGA 5ECQB 1ABAA 4K9ZA 1F2EA 3Q74A 2WFCA 2DJJA 4BA7A 4AJ7A 2HSNA 3QFBC 1UN2A 2L4CA 5ID2A 2DIYA 3VWXA 2IMEA 2NBSA 4ECCA 4XS4B 5HR3A 5ECRB 3GTUB 4MJBA 3L78A 4JZQA 1HD2A 2F8FA 1YKCA 3IXRA 2O89A 3TKPA 3SBCA 2DJKA 4POBA 5CNWA 1U88A 1N8JA 5HR2A 2V6OA 3PH9A 5DBQA 3A5WA 2VCXA 2DIZA 4TR4A 3BJ5A 4MMMA 1SL0B 5IMVA 2JL4A 4USSA 5D73A 5ELAA 5A34B 12GSA 1FW1A 4FIWA 3TRQA 1B8XA 1S3AA 4I8BA 5FWGA 2E0QA 2GSSA 4LMWA 1AUCA 1KEBA 4BWQA 2E2MA 3UVHA 3LXZA 2KUCA 2MMAA 3KCMA 3BOAA 14GSA 4MH3A 5E4WA 1Q4JA 5COHA 4OFTA 1XXUA 4PTSA 2ES7A 3LSZA 3FW2A 3GHAA 4QMKA 2H66A 4K7IA 3F6FA 1WWJA 4RQXA 4CY6A 5D9VA 2VCQA 1XW9A 4ZL7A 1XOAA 4TVEA 1LJRA 1E2YA 2HSMB 2OE3A 4G19A 2YV7A 3FYGA 1GSYA 3ERWA 3QFAC 3KTBA 2BJXA 1B9YC 3L0HA 4ZB7A 3J7Yk 1E6BA 3TKSA 1AC1A 4RQRA 3LQ7A 4PNGA 1J08A 1YKAA 1G7EA 4L0UA 2ON5A 3KXOA 1K3YA 3A5IA 5D9TA 1GUHA 1H75A 4YQMA 5HR0A 2HFDA 3C8EA 2KLXA 1AXDA 1NHYA 3R2QA 3H1NA 3F9UA 4XS4A 3GTUA 4IW9A 4HQSA 1ST9A 2YCDA 5INYA 1PRXA 5IPGA 3F0IA 2HSYA 2LQOA 3QAGA 2HNLA 3UVTA 2X8GA 1G6YA 3LW9A 2IFQB 2C4JA 4HI7A 2MMZA 5HQPA 5KN3A 3GN3A 1TRSA 2PWJA 1THOA 3KH9A 4JR4A 2OADA 4GQCA 3NZNA 3GV1A 3GKKA 4ZBAA 3AY8A 7GSSA 1GTAA 2HXKA 5CRGA 4AGSA 4O32A 2H0IA 4AKXB 2GS3A 2DJ3A 1LBKA 4HU7A 2V2GA 4OWYA 4PQIA 3APQA 4IBPA 4KE3A 4EDYA 4ZXGA 1VRSD 4Z2UA 1ZL9A 1T3BA 3IOSA 5LNKe 2FGXA 2H19A 4G0IA 3GL3A 3WT2A 1BF5A 5ECMB 2LNTA 3G7IA 1VF1A 1W4VA 3IK7A 2FY6A 1GSFA 2B1KA 3UIWA 4KAEA 5HR1A 5IO0A 1RW1A 2CAQA 2NTOA 2I1UA 4PUFC 2AAWA 3KP8A 2WRTA 4IJIA 2PVQA 1O8XA 3I69A 3M3MA 3C7MA 2LRNA 2HSMA 3RHBA 1EZKA 1FB6A 3EMPA 2CA8A 1Y25A 2YWMA 3GURA 2FCHA 4POLA 1UA5A 2L59A 2Z9SA 2HE3A 4G0KA 1JZDA 1BG1A 4ICYA 4XRDA 4D73B 1BG5A 5CO3A 4HJ2A 3FR6A 5G30A 4TR1A 3O76A 1XIYA 2HRFA 1SJIA 4OCFA 4EUYA 4KUNA 1SKRB 3DVXA 1HNCA 3RHCA 5J3RA 1TJDA 2JZSA 1OC3A 1GLPA 2VL9A 4WETA 2VCZA 2HQTA 3RDWA 2H0GA 3VK9A 1A2MA 2HI7A 1GUMA 3IE3A 3W6GA 2IFQA 5JCWA 2JSZA 2H1AA 3TJBA 2PVOC 3GH9A 4BPYA 1TU8A 1PKZA 3LFLA 1EGOA 3WYWA 3BD2A 3H79A 3ERGA 4KX4A 5KOWA 3ERFA 1GSQA 2VOCA 3GKNA 4G9HA 3LXTA 4EIQA 1M9BA 2I9HA 1DE2A 4YQUA 4EKZA 2JSYA 2MBSA 4MF7A 2WS2A 5H5QA 1TRVA 3ZVJA 4TKYA 2HRAA 1B4QA 4ML1A 3C73A 2YWNA 1YEPA 4IS0A 2CZ3A 1GRXA 3M0FA 4EL1A 3WGDA 2TRCP 4PGTA 3N5OA 3K8NA 4XTSA 2OT3A 2EIQA 4K7OA 1SVLA 4BVYB 1H4OA 1GULA 3DWVA 1O73A 3F4TA 3M8NA 2K8SA 3P7XA 1V57A 3TB2A 1SYXA 4F0BA 1TOFA 3TOTA 5CP1A 4PQ1A 1K3OA 3QOUA 1X9MB 4F0CA 2FWFA 5ABRA 1ERWA 4POMA 2H72A 5GSSA 2RLIA 5F05A 2B7KA 2GQMA 9GSSA 4LLRA 4V1Ap 1PMTA 2EFEA 2E7PA 4AKHA 2H01A 4HUAA 1M9AA 3HA9A 4O5RA 4KB3A 2H1LA 3FY7A 4MABA 2CQ9A 4ACSA 4JU5A 1MDIA 3ZRDA 4AJ6A 2MZCA 4MJEA 2ZUPA 3CWGA 3A2WA 1VF2A 4Q5FA 1BQ7A 2AUVA 2BMXA 3DD3A 5F0GA 2WDUA 1ZYNA 2JADA 6GSYA 2ZCTA 3KJYA 3WT1A 5IMFA 1PX6A 1JZWA 2H6XA 5A4UA 3CTFA 1QFNA 3ME7A 4I5QA 1FB0A 3L9SA 3KIJA 1GL8A 1M2DA 3QAWA 4YKGA 3BBYA 1V9WA 2HZEB 2GT6A 2R0CA 3IDVA 3TDGA 2LSTA 4IP6A 4NV5A 4WXTA 3L9VA 4K2DA 2L6DA 3IHQA 2M72A 1SKWB 2PPTA 3ZL5A 2JACA 2V32A 4WF4A 1AIUA 2XBQA 2NDOA 5DJLA 3QPMA 8GSSA 2XPDA 4X1UA 2O87A 1QK8A 1TK0B 3FKFA 1FG4A 2OE0A 2FUG2 3HJMA 4ILFA 1ZYPA 3PR8A 1GSDA 5AGYA 2H71A 2GSTA 4GQFA 1PKWA 3H93A 2VKZG 1B4PA 2R37A 1S3DA 3UBLA 2M80A 4X43A 2YN1A 1TU7A 2FHEA 4ZIJA 1Z5YE 5J4UA 1K3LA 1Z7PA 2REMA 4XCSA 3ZFBA 4V1Ag 3D21A 4IJ3A 1SVOA 4MJAA 1J9BA 2L6CA 16GSA 2VL2C 2YJHA 2JU5A 1GNWA 4MA9A 3P90A 4L5LA 1W89A 4G0LA 2DMMA 1EWXA 5L71A 4MZCA 4DSSB 2F3MA 4OFMA 3WGXA 1KTEA 4EE0A 1O81A 3ZITA 3GA4A 4L0WA 3HY2A 3WD6A 1JFUA 11GSA 4EIPA 6GSTA 1K0CA 4AJ8A 1Z9HA 4GSTA 1TK8B 2LS5A 3F6DA 5ECHB 2GZPA 2B7JA 1GSSA 5H5RA 1AAZA 4ML6A 3MYDA 3E3EA 3D4TA 1UVZA 3GKMA 4N11A 5GSTA 1WMJA 1OC8A 4O92A 1R26A 1GTUA 4OMVA 5IOXA 4F9ZA 3LWAA 1FOHA 5A5HA 3UL3A 5IIZA 2PERA 2A4HA 4TXVA 3CSJA 1XWGA 3US3A 5C04A 5G2ZA 2H1DA 2H1BA 4GTUA 4XHMA 1C72A 1JLWA 1PA3A 3SWLA 3VURA 5J47A 4IQ1A 1DUGA 3GSTA 3M9JA 2V6KA 4N30A 2HZEA 3Q18A 2X64A 3ZMLA 3CTGA 1EV9A 3DMLA 2FA8A 5AIVA 1BX9A 3IBHA 1OKTA 2FLSA 4N10A 5B6NA 4HJMA 2L57A 4E8EA 2CX4A 3DVWA 1EEMA 1JZRA 3F4RA 2FNOA 1FAAA 2CVBA 3CRUA 4ECJA 4MDCA 3G7YA 6GSVA 1ZCPA 4GSSA 1I9DA 4K8MA 3ED3A 3MWHA 3EU3A 6GSUA 1FO5A 1SKSB 3MSZA 1B9XC 4ZBBA 3W8JA 1BYEA 1M2BA 3KZQA 1KBNA 1U3IA 1EGRA 13GSA 2BTOT 4EF0A 5F06A 3LORA 3A3TA 2R3XA 2F51A 4V2LA 2WGRA 4MJCA 4GXZA 2IWTA 4NWYA 5AN1A 2AB6A 2YOIA 1EEJA 4TRXA 2VM2A 2L5LA 3D22A 1SK1A 2DC5A 4EXJA 20GSA 3HCZA 2ALBA 3KMNA 2YP6A 1Y1UA 3J7Yb 4RI6A 4JEDA 3IPZA 4WBRD 1PL2A 1TXUA 3F63A 1GH2A 3CMIA 4HZ4A 2C8UA 5DAKB 2OACA 5CRWA 3G7JA 3WGEA 5KOXA 5ECPB 1PX7A 2H30A 2K6VA 1TXXA 5LD0A 4YAVA 2LJAA 4F82A 3VWWA 2B5EA 2CAIA 3M1GA 3HYPA 5LCZA 2AJQB 2UV8G 2RUEA 4FQUA 5DCHA 4QL9A 3TKRA 3HZ4A 5A34A 4BWSA 5D9XA 1U87A 4LL4B 5IQYA 5DQSA 1AQWA 3L9UA 2DLXA 1QUWA 4TR3A 4H86A 1ERTA 1OE7A 1OKDA 1URMA 1UC7A 2B6MA 1GNEA 4G01A 3EWLA 1A23A 1WE0A 2X4AA 3VWVA 2K9FA 3F3QA 2P31A 4KH7A 1VF4A 3EVIA 3V1WA 2MYGA 4PUAA 5D96A 1XBSA 2TIRA 2QSIA 4OCEA 4DSRA 4IGJA 3ZLPA 3HDCA 3VLNA 2EFCA 2R0GA 1MD3A 1XPVA 3IAS2 1PGTA 2WULA 5ELGA 4WR5A 1HQOA 4EVMA 2GGTA 1DE1A 5B8BA 3FR9A 2L5OA 1EOGA 2TRXA 2KP2A 4GWRA 2YPMA 3NOFA 1XCCA 1X9WB 4PURA 1MTCA 1OAZA 2JZRA 1IYHA 2H70A 2IMIA 5AISA 2EIRA 5B6MA 4KNDA 4TR0A 2N5AA 4E68A 1KNGA 1TW9A 3CYNA 1Z6MA 5F07A 5JCGA 4MF6A 2H73A 5HFIA 5J4VA 2QA2A 2X49A 3UJ1A 5HFKA 1IYIA 1F37A 5D9WA 4ULXA 3GX8A 3FRCA 2FWHA 1AQXA 3GIXA 5DAKA 5CREA 3OR5A 3DGQA 1PQNA 3APOA 3UMAA 1F3AA 4PXOA 3GMFA 3HVSA 4FYCA 3HJPA 1SD8A 3CXGA 3QD9A 1WOUA 3NIVA 5IO2A 2AHEA 1RK4A 5GAND 3BCKA 2XPEA 4K0NA 4J57E 3GRXA 2DSAA 1SJ6A 1XVWA 2HRKB 2X99A 5DDLA 2MMOA 3EPTA 2KP1A 3RPNA 2LKUA 4XIHA 2KOKA 5IMDA 4NMUA 2NVLA 4MLYA 2H6YA 1SVMA 3FZAA 4IHUA 4MPGA 1TK5B 4AF2A 2H6ZA 5BRTA 1YF1A 3KP9A 1BAYA 3QR6A 2GDRA 3O3TA 1GP1A 3DIEA 4Z7XA 1FVJA 2VL2A 1TRWA 3RPPA 4AKIA 2K8VA 3UEMA 2LV3A 4NPBA 2C80A 2A2SA 5AIXA 2IL3A 3P8WA 4K2XA 4A5PA 3C1SA 1J0FA 4BVXB 3P2AA 2DMLA 4DEJA 4IN0A 3GNJA 2J9HA 2QKEA 3LG6A 4KDUA 2VLTA 4Z2TA 5CAXA 5KN1A 3HZ8A 1O8WA 1TDIA 2NPBA 3O6TA 1GSUA 1GLQA 4K1FA 3GKXA 3ZYWA 1WPIA 1JHBA 1GTBA 4F03A 2OKAA 2WZ9A 5A4WA 1Y6EA 2A4VA 3H8QA 4X0XA 6GSXA 2MMNA 3LYKA 1X5DA 3L4NA 1WRYA 4DVCA 2J23A 1SENA 4G10A 2H8LA 1A24A 3KD0A 4OD7A 1YQ1A 3LEFA 3KEBA 5EY6A 2B5YA 4D73A 3IR4A 1SK2A 4MCUA 1FVKA 18GSA 3UARA 4K7NA 3U6VA 1M2AA 2OA7A 3TRPA 2B5XA 2A2RA 5HFGA 4NAXA 1M99A 2LQQA 5A5KA 5D93A 2P5RA 3HXSA 1U6TA 4FO5A 2PMTA 4ECIA 4XS6A 5F8BA 2H75A 4HU9A 5J41A 2FA4A 3CSHA 1ILOA 3MNGA 2WCIA 2C0DA 4V2MA 5EVOA 1QQ2A 2AYTA 2CT6A 4NHZA 1PSQA 4KGIA 4OO5A 4GCIA 2B1LA 2V41A 5A1NB 1NHOA 1FHEA 3FHKA 1YDKA 1QXHA 2VCWA 2LTKA 2F8AA 2D2ZA 4EO3A 5EL8A 4MP4A 1K0DA 1F6MC 3TJKA 2N5BA 2YV9A 1T00A 2DJ0A 2IJYA 3TJFA 1SYRA 3MAKA 4WEYA 1OE8A 2R4VA 3ZREA 4TXOB 4WBJA 4N0ZA 1YY7A 3E0UA 3QAVA 5CRHA 3JCML 2RUFA 4YH2A 3E9JB 3I43A 5JWQB 4G2EA 1YJ6A 2FWEA 1USBA 2WJUA 4BVYA 1ON4A 2YWOA 5IOWA 4MNNA 2XHFA 4GSNA 2YANA 5DVBA 2FD3A 3R3EA 1R5AA 1WP0A 3BCIA 4ZBDA 5E59A 4TN8A 2VD1A 1K0AA 1ZZYA 5H5SA 4KW6A 3VWUA 4Q5QA 2HT9A 2ON7A 4OO4A 5CRDA 2DJ2A 5ENUA 1F3BA 1YZXA 2IIYA 3PPUA 5DCGA 3VI7A 5JWRB 3IC8A 3VFIA 1SL2B 1F9MA 1QMVA 1ZYEA 4OFNA 4X4JA 3F3RA 4E8HA 1TKDB 4NHWA 2C3NA 3HHVA 1T8EB 4Q5NA 3QCPA 1M7TA 5DQYA 2M46A 2LJKA 4KSMA 4NV2A 3GFKA 4KF9A 4MPFA 1T4ZA 2CZ2A 2HSHA 1A0FA 1PD21 1ZMAA 2MBTA 3FK8A 2V1MA 2PBJA 4JRRA 2H0HA 3EYTA 3H4KA 4IP1A 2R2JA 2XBIA 3D6IA 3UAPA 1TI1A 2C0EA 3Q6OA 1XZOA 1XVQA 1R4WA 3TCOA 1WJKA 2PN8A 3ZIJA 1X0RA 2IMKA 2GZYA 4LL1B 5A1NA 3FR3A 1O85A 1ACVA 3CBUA 2VCTA 3DRNA 2EFDA 1SK0A 4IKHA 1TTZA 3EINA 3IAM2 3U5RE 2PU9C 4ZB8A 5C00A 1CQGA 5G5EA 2QA1A 2CVDA 2X8HA 4PQHA 2YNXA 1V40A 4TXOA 3A2VA 2VCVA 5CYYA 2N5FA 1G0TA 1AQVA 3UOMA 2QGVA 5KN0A 2CVKA 4ZL8A 5IM9A 2JZTA 3I9V2 2VIMA 2PGTA 3TRXA 2C0FA 2IMFA 2L4QA 2I81A 1I5GA 2G2QA 4MZBA 1FOVA 2LRTA 1Z6NA 4O5QA 3DEXA 19GSA 3EMXA 1A2LA 4K0GA 3ZZXA 1MEKA 4POKA 4DSSA 2EFHA 1VF3A 4NXIA 3A2XA 2EC4A 1PN0A 3GX0A 5FHIA 2O7KA 3TUEA 1K0OA 4N0VA 1A2JA 2C3TA 2CV4A 3C71A 3KTLA 4I97A 3TGZA 4TR1B 4WKWA 1DBYA 4MK3A 3DYRA 2LEGA 2VD0A 2PUKC 2XC2A 5G31A 5JWOB 2VM1A 2K18A 3TJJA 4BL7B 1T4YA 1NM3A 5J5NA 2AV4A 1PN9A 3FZ4A 5IMAA 1GSEA 3LYPA 4F2IA 3CSIA 1GTIA 3N9JA 4ZILA 5GAPD 3IRAA 4KCAA 4JR6A 5BMUB 3MDKA 3F4SA 3FMWA 2RIIA 2H1GA 1ERVA 4FYBA 1Z3EA 1G6WA 1B48A 2LUSA 2VLUA 1SD9A 5J4YA 2O8VB 4KSOA 1EP8A 4RI7A 5ECLB 3TOUA 3TKSE 4J2FA 2RM6A 22GSA 2HRNA 1JZOA 3GL5A 4JBBA 2X8CA 4FH8A 4I2UA 3IK9A 1GUKA 3EC3A 2QC7A 1DSBA 2IN3A 1X5EA 2YJ7A 4YAPA 1X9SB 4N3ZA 4QQ7A 4QL7A 2YZHA 5IMCA 5JCUA 2I3YA 4ZL9A 2GT5A 1XW5A 4L5OA 4TW5A 2LJRA 3VI5A 4HQZA 1JLVA 4KDXA 2C0GA 2KHPA 2YWIA 2LNSA 1HNBA 1X5CA 4HDEA 1XW6A 3IHGA 4MH2A 1AW9A 1EV4A 3TJGA 1PL1A 10GSA 3ZVJD 3D4MA 5G5FA 2GSQA 1HNAA 1YEXA 3EURA 1MD4A 5ECIB 5D8IA 3M9KA 3ISOA 3CRTA 5DALB 1XOBA 1EP7A 4GF0A 2R5GA 4XRAA 3IC4A 5IPHA 2VO4A 3TKSC 3HMJG 1ZYQB 4K5RA 4RUVA 1M0UA 3MIXA 4ZB9A 2F9SA 4LMVA 4AI6A 1V58A 4BL7A 3GH6A 2HYXA 1YVLA 1XWAA 3HJOA 4CHSA 5J9BA 4FYUA 1VGLA 3VPTA 3S9FA 1T7PB 1T1VA 3RAZA 1U3AA 3C1RA 3EE2A 2VLVA 6GSSA 5BMUA 2DKHA 1R5PA 3PGTA 1XWBA 3W8SA 2DBCA 3GUSA 1OC9B 2OJLA 4K5SA 1ERUA 1SU9A 1TRUA 1QGVA 4Q5RA 3UBKA 1Q98A 1R7HA 2OBKA 2CX3A 4L8EA 3RBTA 4HS1A 1A8YA 3GSSA 1O7UA 5EPFA 1OVNA 4KDYA 3KM6A 1ZOFA 4O5UA 4YQVA 5FT3A 4K6XA 4V2NA 4IVFA 2OE1A 3IA1A 3ZIVA 4PX1A 2H74A 4IQAA 4HOJA 3GYKA 2VUPA 5G1LA 2E2GA 1K0BA 2HZFA 5B8AA 3TKQA 4EDZA 2G0FA 4HZ2A 5ECSA 1MDJA 4MZWA 3G9BA 2GVPA 1G7OA 1GWCA 2P0GA 1N2AA 3I6AA 2P5QA 2H76A 4ECBA 2C1YA 4J56E 1BJXA 3Q19A 2FWGA 2R6KA 4I6XA 17GSA 1A8LA 1RQMA 5ECNB 3QMXA 2DKIA 2HSNB 1K0NA 2GQLA 5ID2B 2YZUA 1V2AA 3DXBA 3PINA 4LA1A 4CW9A 4MF5A 4IELA 1V98A 1A0RP 5B7CA 4O7HA 3LGCA 1S3CA 3LJRA 1SL1B 5DALA 3HVXA 3VPQA 3KMOA 1BEDA 5KN2A 3FZ9A 1YF0A 3D0ZA 4DSQA 4WR4A 2GLRA 2GZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRC A;  2RM5 A;  1XWK A;  4WF5 A;  1LU4 A;  5IMZ A;  2WB9 A;  2IMD A;  6GSW A;  5GZZ B;  4P3Y B;  3KGK A;  3D5J A;  1OYJ A;  2B3S A;  2C3Q A;  1K0M A;  3HD5 A;  2HRK A;  2VL3 A;  5ECK B;  4ISD A;  4KA0 A;  1SJZ A;  4CDO A;  1EOH A;  4ZB6 A;  1HYU A;  2HLS A;  3EU4 A;  3QDN A;  2I4A A;  1TI3 A;  1XWC A;  4KCE A;  4JE1 A;  1MDK A;  2OBI A;  3FEU A;  4GRF A;  1OC9 A;  1ZGN A;  4GLT A;  1Z7R A;  2IPA A;  2GQK A;  2ZNM A;  1O6J A;  3DKS A;  4HEA 2;  5A4V A;  1ML6 A;  4PNF A;  1NW2 A;  3IV4 A;  5J9C A;  2EIO A;  2DJ1 A;  2VAF A;  3ZMK A;  4BVX A;  4EC0 A;  3KH7 A;  1XFL A;  5KEJ A;  3HKR A;  4TOP A;  1NSW A;  5ECO B;  1CQH A;  1THX A;  1TP9 A;  3F8U A;  1WIK A;  2GSR A;  4I2T A;  2UZ8 A;  4XS1 A;  3FZ5 A;  3HVV A;  2O85 A;  3ME8 A;  2GTU A;  5DJM A;  3ZFL A;  5G1K A;  3ZTL A;  3APS A;  4ID0 A;  5ECQ B;  1ABA A;  4K9Z A;  1F2E A;  3Q74 A;  2WFC A;  2DJJ A;  4BA7 A;  4AJ7 A;  3QFB C;  1UN2 A;  2L4C A;  5ID2 A;  2DIY A;  3VWX A;  2IME A;  2NBS A;  4ECC A;  4XS4 B;  5HR3 A;  5ECR B;  3GTU B;  4MJB A;  3L78 A;  4JZQ A;  1HD2 A;  2F8F A;  1YKC A;  3IXR A;  2O89 A;  3TKP A;  3SBC A;  2DJK A;  4POB A;  5CNW A;  1U88 A;  1N8J A;  5HR2 A;  2V6O A;  3PH9 A;  5DBQ A;  3A5W A;  2VCX A;  2DIZ A;  4TR4 A;  3BJ5 A;  4MMM A;  1SL0 B;  5IMV A;  2JL4 A;  4USS A;  5D73 A;  5ELA A;  12GS A;  1FW1 A;  4FIW A;  3TRQ A;  1B8X A;  1S3A A;  4I8B A;  5FWG A;  2E0Q A;  2GSS A;  4LMW A;  1AUC A;  1KEB A;  4BWQ A;  2E2M A;  3UVH A;  3LXZ A;  2KUC A;  2MMA A;  3KCM A;  3BOA A;  14GS A;  4MH3 A;  5E4W A;  1Q4J A;  5COH A;  4OFT A;  1XXU A;  4PTS A;  2ES7 A;  3LSZ A;  3FW2 A;  3GHA A;  2H66 A;  4K7I A;  3F6F A;  1WWJ A;  4RQX A;  5D9V A;  2VCQ A;  1XW9 A;  4ZL7 A;  1XOA A;  4TVE A;  1LJR A;  1E2Y A;  2HSM B;  2OE3 A;  4G19 A;  2YV7 A;  3FYG A;  1GSY A;  3ERW A;  3QFA C;  3KTB A;  2BJX A;  1B9Y C;  3L0H A;  3J7Y k;  1E6B A;  3TKS A;  1AC1 A;  4RQR A;  3LQ7 A;  4PNG A;  1J08 A;  1YKA A;  1G7E A;  4L0U A;  2ON5 A;  3KXO A;  1K3Y A;  5D9T A;  1GUH A;  1H75 A;  4YQM A;  5HR0 A;  2HFD A;  3C8E A;  2KLX A;  1AXD A;  1NHY A;  3R2Q A;  3H1N A;  3F9U A;  4XS4 A;  3GTU A;  4IW9 A;  4HQS A;  1ST9 A;  2YCD A;  5INY A;  1PRX A;  5IPG A;  3F0I A;  2HSY A;  2LQO A;  3QAG A;  2HNL A;  3UVT A;  2X8G A;  1G6Y A;  2IFQ B;  2C4J A;  4HI7 A;  2MMZ A;  5HQP A;  5KN3 A;  3GN3 A;  1TRS A;  2PWJ A;  1THO A;  3KH9 A;  4JR4 A;  2OAD A;  4GQC A;  3NZN A;  3GV1 A;  3GKK A;  4ZBA A;  3AY8 A;  7GSS A;  1GTA A;  2HXK A;  5CRG A;  4AGS A;  4O32 A;  2H0I A;  2GS3 A;  2DJ3 A;  1LBK A;  4HU7 A;  2V2G A;  4OWY A;  4PQI A;  3APQ A;  4IBP A;  4KE3 A;  4EDY A;  4ZXG A;  1VRS D;  1ZL9 A;  1T3B A;  3IOS A;  5LNK e;  2FGX A;  2H19 A;  4G0I A;  3GL3 A;  3WT2 A;  5ECM B;  2LNT A;  3G7I A;  1VF1 A;  1W4V A;  3IK7 A;  2FY6 A;  1GSF A;  2B1K A;  3UIW A;  4KAE A;  5HR1 A;  5IO0 A;  1RW1 A;  2CAQ A;  2NTO A;  2I1U A;  4PUF C;  2AAW A;  3KP8 A;  2WRT A;  4IJI A;  2PVQ A;  1O8X A;  3I69 A;  3M3M A;  3C7M A;  2LRN A;  2HSM A;  3RHB A;  1EZK A;  1FB6 A;  3EMP A;  2CA8 A;  1Y25 A;  2YWM A;  3GUR A;  2FCH A;  4POL A;  1UA5 A;  2L59 A;  2Z9S A;  2HE3 A;  4G0K A;  1JZD A;  4XRD A;  4D73 B;  1BG5 A;  5CO3 A;  4HJ2 A;  3FR6 A;  5G30 A;  4TR1 A;  3O76 A;  1XIY A;  2HRF A;  1SJI A;  4OCF A;  4EUY A;  4KUN A;  1SKR B;  3DVX A;  1HNC A;  3RHC A;  5J3R A;  1TJD A;  2JZS A;  1OC3 A;  1GLP A;  2VL9 A;  4WET A;  2VCZ A;  2HQT A;  3RDW A;  2H0G A;  3VK9 A;  1A2M A;  2HI7 A;  1GUM A;  3IE3 A;  3W6G A;  2IFQ A;  5JCW A;  2JSZ A;  2H1A A;  3TJB A;  2PVO C;  3GH9 A;  4BPY A;  1TU8 A;  1PKZ A;  3LFL A;  1EGO A;  3WYW A;  3BD2 A;  3H79 A;  3ERG A;  4KX4 A;  3ERF A;  1GSQ A;  2VOC A;  3GKN A;  4G9H A;  3LXT A;  1M9B A;  2I9H A;  1DE2 A;  4YQU A;  4EKZ A;  2JSY A;  2MBS A;  4MF7 A;  2WS2 A;  5H5Q A;  1TRV A;  3ZVJ A;  4TKY A;  2HRA A;  1B4Q A;  4ML1 A;  3C73 A;  2YWN A;  1YEP A;  4IS0 A;  2CZ3 A;  1GRX A;  3M0F A;  4EL1 A;  3WGD A;  2TRC P;  4PGT A;  3N5O A;  3K8N A;  4XTS A;  2EIQ A;  4K7O A;  4BVY B;  1H4O A;  1GUL A;  3DWV A;  1O73 A;  3F4T A;  3M8N A;  2K8S A;  3P7X A;  1V57 A;  3TB2 A;  1SYX A;  4F0B A;  1TOF A;  3TOT A;  5CP1 A;  4PQ1 A;  1K3O A;  3QOU A;  1X9M B;  4F0C A;  2FWF A;  5ABR A;  1ERW A;  4POM A;  2H72 A;  5GSS A;  2RLI A;  5F05 A;  2B7K A;  2GQM A;  9GSS A;  4LLR A;  4V1A p;  1PMT A;  2E7P A;  2H01 A;  4HUA A;  1M9A A;  3HA9 A;  4O5R A;  4KB3 A;  3FY7 A;  4MAB A;  2CQ9 A;  4ACS A;  4JU5 A;  1MDI A;  3ZRD A;  4AJ6 A;  2MZC A;  4MJE A;  2ZUP A;  3A2W A;  1VF2 A;  4Q5F A;  1BQ7 A;  2AUV A;  2BMX A;  3DD3 A;  5F0G A;  2WDU A;  2JAD A;  6GSY A;  2ZCT A;  3KJY A;  3WT1 A;  5IMF A;  1PX6 A;  1JZW A;  2H6X A;  5A4U A;  3CTF A;  1QFN A;  3ME7 A;  4I5Q A;  1FB0 A;  3L9S A;  3KIJ A;  1GL8 A;  1M2D A;  3QAW A;  3BBY A;  1V9W A;  2HZE B;  2GT6 A;  3IDV A;  3TDG A;  2LST A;  4IP6 A;  4NV5 A;  4WXT A;  3L9V A;  4K2D A;  2L6D A;  3IHQ A;  2M72 A;  1SKW B;  2PPT A;  3ZL5 A;  2JAC A;  2V32 A;  4WF4 A;  1AIU A;  2XBQ A;  2NDO A;  5DJL A;  3QPM A;  8GSS A;  2XPD A;  4X1U A;  2O87 A;  1QK8 A;  1TK0 B;  3FKF A;  1FG4 A;  2OE0 A;  2FUG 2;  3HJM A;  4ILF A;  3PR8 A;  1GSD A;  5AGY A;  2H71 A;  2GST A;  4GQF A;  1PKW A;  3H93 A;  1B4P A;  2R37 A;  1S3D A;  3UBL A;  2M80 A;  4X43 A;  2YN1 A;  1TU7 A;  2FHE A;  4ZIJ A;  1Z5Y E;  5J4U A;  1K3L A;  1Z7P A;  2REM A;  4XCS A;  3ZFB A;  4V1A g;  3D21 A;  4IJ3 A;  4MJA A;  1J9B A;  2L6C A;  16GS A;  2VL2 C;  2YJH A;  2JU5 A;  1GNW A;  4MA9 A;  3P90 A;  4L5L A;  1W89 A;  4G0L A;  2DMM A;  1EWX A;  5L71 A;  4MZC A;  4DSS B;  2F3M A;  4OFM A;  3WGX A;  1KTE A;  4EE0 A;  1O81 A;  3ZIT A;  3GA4 A;  4L0W A;  3HY2 A;  3WD6 A;  1JFU A;  11GS A;  6GST A;  1K0C A;  4AJ8 A;  1Z9H A;  4GST A;  1TK8 B;  2LS5 A;  3F6D A;  5ECH B;  2GZP A;  2B7J A;  1GSS A;  5H5R A;  1AAZ A;  4ML6 A;  3E3E A;  3D4T A;  1UVZ A;  3GKM A;  4N11 A;  5GST A;  1WMJ A;  1OC8 A;  4O92 A;  1R26 A;  1GTU A;  4OMV A;  5IOX A;  4F9Z A;  3LWA A;  5IIZ A;  3UL3 A;  2PER A;  4TXV A;  3CSJ A;  1XWG A;  3US3 A;  5C04 A;  5G2Z A;  2H1D A;  2H1B A;  4GTU A;  4XHM A;  1C72 A;  1JLW A;  1PA3 A;  3SWL A;  3VUR A;  4IQ1 A;  1DUG A;  3GST A;  3M9J A;  2V6K A;  4N30 A;  2HZE A;  3Q18 A;  2X64 A;  3ZML A;  3CTG A;  1EV9 A;  3DML A;  2FA8 A;  5AIV A;  1BX9 A;  3IBH A;  1OKT A;  2FLS A;  4N10 A;  5B6N A;  4HJM A;  2L57 A;  4E8E A;  2CX4 A;  3DVW A;  1EEM A;  1JZR A;  3F4R A;  2FNO A;  1FAA A;  2CVB A;  3CRU A;  4ECJ A;  4MDC A;  3G7Y A;  6GSV A;  1ZCP A;  4GSS A;  1I9D A;  4K8M A;  3ED3 A;  3MWH A;  3EU3 A;  6GSU A;  1FO5 A;  1SKS B;  3MSZ A;  1B9X C;  4ZBB A;  3W8J A;  1BYE A;  1M2B A;  3KZQ A;  1KBN A;  1U3I A;  1EGR A;  13GS A;  2BTO T;  4EF0 A;  5F06 A;  3LOR A;  3A3T A;  2R3X A;  2F51 A;  4V2L A;  2WGR A;  4MJC A;  4GXZ A;  2IWT A;  4NWY A;  5AN1 A;  2AB6 A;  2YOI A;  1EEJ A;  4TRX A;  2VM2 A;  2L5L A;  3D22 A;  1SK1 A;  2DC5 A;  4EXJ A;  20GS A;  3HCZ A;  2ALB A;  3KMN A;  2YP6 A;  3J7Y b;  4RI6 A;  4JED A;  3IPZ A;  4WBR D;  1PL2 A;  3F63 A;  1GH2 A;  3CMI A;  4HZ4 A;  2C8U A;  5DAK B;  2OAC A;  5CRW A;  3G7J A;  3WGE A;  5ECP B;  1PX7 A;  2H30 A;  2K6V A;  1TXX A;  5LD0 A;  4YAV A;  2LJA A;  4F82 A;  3VWW A;  2B5E A;  2CAI A;  3M1G A;  3HYP A;  5LCZ A;  2AJQ B;  2RUE A;  4FQU A;  5DCH A;  4QL9 A;  3TKR A;  3HZ4 A;  4BWS A;  5D9X A;  1U87 A;  4LL4 B;  5IQY A;  5DQS A;  1AQW A;  3L9U A;  2DLX A;  1QUW A;  4TR3 A;  4H86 A;  1ERT A;  1OE7 A;  1OKD A;  1URM A;  1UC7 A;  2B6M A;  1GNE A;  3EWL A;  1A23 A;  1WE0 A;  3VWV A;  2K9F A;  3F3Q A;  2P31 A;  4KH7 A;  1VF4 A;  3EVI A;  3V1W A;  2MYG A;  4PUA A;  5D96 A;  1XBS A;  2TIR A;  2QSI A;  4OCE A;  4DSR A;  4IGJ A;  3ZLP A;  3HDC A;  3VLN A;  3IAS 2;  1MD3 A;  1XPV A;  1PGT A;  2WUL A;  5ELG A;  4WR5 A;  1HQO A;  4EVM A;  2GGT A;  1DE1 A;  5B8B A;  3FR9 A;  2L5O A;  1EOG A;  2TRX A;  2KP2 A;  4GWR A;  2YPM A;  3NOF A;  1XCC A;  1X9W B;  4PUR A;  1MTC A;  1OAZ A;  2JZR A;  1IYH A;  2H70 A;  2IMI A;  5AIS A;  2EIR A;  5B6M A;  4KND A;  4TR0 A;  2N5A A;  1KNG A;  1TW9 A;  3CYN A;  1Z6M A;  5F07 A;  5JCG A;  4MF6 A;  2H73 A;  5HFI A;  3UJ1 A;  5HFK A;  1IYI A;  1F37 A;  5D9W A;  4ULX A;  3GX8 A;  3FRC A;  2FWH A;  1AQX A;  3GIX A;  5DAK A;  5CRE A;  3OR5 A;  3DGQ A;  1PQN A;  3APO A;  3UMA A;  1F3A A;  4PXO A;  3GMF A;  3HVS A;  4FYC A;  3HJP A;  3QD9 A;  1SD8 A;  3CXG A;  1WOU A;  3NIV A;  5IO2 A;  2AHE A;  1RK4 A;  5GAN D;  3BCK A;  2XPE A;  4K0N A;  4J57 E;  3GRX A;  2DSA A;  1SJ6 A;  1XVW A;  2HRK B;  2X99 A;  5DDL A;  2MMO A;  2KP1 A;  3RPN A;  2LKU A;  4XIH A;  2KOK A;  5IMD A;  4NMU A;  2NVL A;  4MLY A;  2H6Y A;  3FZA A;  4IHU A;  4MPG A;  1TK5 B;  4AF2 A;  2H6Z A;  1YF1 A;  3KP9 A;  1BAY A;  3QR6 A;  2GDR A;  3O3T A;  1GP1 A;  3DIE A;  4Z7X A;  1FVJ A;  2VL2 A;  1TRW A;  3RPP A;  2K8V A;  3UEM A;  2LV3 A;  4NPB A;  2C80 A;  2A2S A;  5AIX A;  2IL3 A;  3P8W A;  3C1S A;  1J0F A;  4BVX B;  3P2A A;  2DML A;  4DEJ A;  4IN0 A;  3GNJ A;  2J9H A;  2QKE A;  3LG6 A;  4KDU A;  2VLT A;  5CAX A;  5KN1 A;  3HZ8 A;  1O8W A;  1TDI A;  2NPB A;  3O6T A;  1GSU A;  1GLQ A;  4K1F A;  3GKX A;  3ZYW A;  1WPI A;  1JHB A;  1GTB A;  4F03 A;  2OKA A;  2WZ9 A;  5A4W A;  1Y6E A;  2A4V A;  3H8Q A;  4X0X A;  6GSX A;  2MMN A;  3LYK A;  1X5D A;  3L4N A;  1WRY A;  4DVC A;  2J23 A;  1SEN A;  4G10 A;  2H8L A;  1A24 A;  3KD0 A;  4OD7 A;  1YQ1 A;  3LEF A;  3KEB A;  5EY6 A;  2B5Y A;  4D73 A;  3IR4 A;  1SK2 A;  4MCU A;  1FVK A;  18GS A;  3UAR A;  4K7N A;  3U6V A;  1M2A A;  2OA7 A;  3TRP A;  2B5X A;  2A2R A;  5HFG A;  4NAX A;  1M99 A;  2LQQ A;  5A5K A;  5D93 A;  2P5R A;  3HXS A;  1U6T A;  4FO5 A;  2PMT A;  4ECI A;  4XS6 A;  5F8B A;  2H75 A;  4HU9 A;  5J41 A;  2FA4 A;  3CSH A;  1ILO A;  3MNG A;  2WCI A;  2C0D A;  4V2M A;  5EVO A;  1QQ2 A;  2AYT A;  2CT6 A;  4NHZ A;  1PSQ A;  4KGI A;  4OO5 A;  4GCI A;  2B1L A;  2V41 A;  1NHO A;  1FHE A;  3FHK A;  1YDK A;  1QXH A;  2VCW A;  2LTK A;  2F8A A;  2D2Z A;  4EO3 A;  5EL8 A;  4MP4 A;  1K0D A;  1F6M C;  3TJK A;  2N5B A;  2YV9 A;  1T00 A;  2DJ0 A;  2IJY A;  3TJF A;  1SYR A;  3MAK A;  4WEY A;  1OE8 A;  2R4V A;  3ZRE A;  4TXO B;  4WBJ A;  4N0Z A;  1YY7 A;  3E0U A;  3QAV A;  5CRH A;  3JCM L;  2RUF A;  4YH2 A;  3E9J B;  3I43 A;  5JWQ B;  4G2E A;  1YJ6 A;  2FWE A;  1USB A;  2WJU A;  4BVY A;  1ON4 A;  2YWO A;  5IOW A;  2XHF A;  4GSN A;  2YAN A;  5DVB A;  2FD3 A;  3R3E A;  1R5A A;  1WP0 A;  3BCI A;  4ZBD A;  5E59 A;  4TN8 A;  2VD1 A;  1K0A A;  1ZZY A;  5H5S A;  4KW6 A;  3VWU A;  4Q5Q A;  2HT9 A;  2ON7 A;  4OO4 A;  5CRD A;  2DJ2 A;  5ENU A;  1F3B A;  1YZX A;  2IIY A;  3PPU A;  5DCG A;  3VI7 A;  5JWR B;  3IC8 A;  3VFI A;  1SL2 B;  1F9M A;  1QMV A;  1ZYE A;  4OFN A;  3F3R A;  4E8H A;  1TKD B;  4NHW A;  2C3N A;  3HHV A;  1T8E B;  4Q5N A;  3QCP A;  1M7T A;  5DQY A;  2M46 A;  2LJK A;  4KSM A;  4NV2 A;  3GFK A;  4KF9 A;  4MPF A;  1T4Z A;  2CZ2 A;  2HSH A;  1A0F A;  1PD2 1;  1ZMA A;  2MBT A;  3FK8 A;  2V1M A;  2PBJ A;  4JRR A;  2H0H A;  3EYT A;  3H4K A;  4IP1 A;  2R2J A;  2XBI A;  3D6I A;  3UAP A;  1TI1 A;  2C0E A;  3Q6O A;  1XZO A;  1XVQ A;  1R4W A;  3TCO A;  1WJK A;  2PN8 A;  3ZIJ A;  1X0R A;  2IMK A;  2GZY A;  4LL1 B;  3FR3 A;  1O85 A;  1ACV A;  3CBU A;  2VCT A;  3DRN A;  1SK0 A;  4IKH A;  1TTZ A;  3EIN A;  3IAM 2;  3U5R E;  2PU9 C;  4ZB8 A;  5C00 A;  1CQG A;  5G5E A;  2CVD A;  2X8H A;  4PQH A;  2YNX A;  1V40 A;  4TXO A;  3A2V A;  2VCV A;  5CYY A;  2N5F A;  1G0T A;  1AQV A;  3UOM A;  2QGV A;  5KN0 A;  2CVK A;  4ZL8 A;  5IM9 A;  2JZT A;  3I9V 2;  2VIM A;  2PGT A;  3TRX A;  2C0F A;  2IMF A;  2L4Q A;  2I81 A;  1I5G A;  2G2Q A;  4MZB A;  1FOV A;  2LRT A;  1Z6N A;  3DEX A;  19GS A;  3EMX A;  1A2L A;  4K0G A;  3ZZX A;  1MEK A;  4POK A;  4DSS A;  1VF3 A;  4NXI A;  3A2X A;  2EC4 A;  3GX0 A;  5FHI A;  2O7K A;  3TUE A;  1K0O A;  4N0V A;  1A2J A;  2C3T A;  2CV4 A;  3C71 A;  3KTL A;  4I97 A;  3TGZ A;  4TR1 B;  4WKW A;  1DBY A;  4MK3 A;  3DYR A;  2LEG A;  2VD0 A;  2PUK C;  2XC2 A;  5G31 A;  5JWO B;  2VM1 A;  2K18 A;  3TJJ A;  4BL7 B;  1T4Y A;  1NM3 A;  5J5N A;  2AV4 A;  1PN9 A;  3FZ4 A;  5IMA A;  1GSE A;  3LYP A;  4F2I A;  3CSI A;  1GTI A;  3N9J A;  4ZIL A;  5GAP D;  3IRA A;  4KCA A;  4JR6 A;  3MDK A;  3F4S A;  2RII A;  2H1G A;  1ERV A;  4FYB A;  1Z3E A;  1G6W A;  1B48 A;  2LUS A;  2VLU A;  1SD9 A;  2O8V B;  4KSO A;  1EP8 A;  4RI7 A;  5ECL B;  3TOU A;  3TKS E;  4J2F A;  2RM6 A;  22GS A;  2HRN A;  1JZO A;  3GL5 A;  4JBB A;  2X8C A;  4FH8 A;  4I2U A;  3IK9 A;  1GUK A;  3EC3 A;  2QC7 A;  1DSB A;  2IN3 A;  1X5E A;  2YJ7 A;  4YAP A;  1X9S B;  4QQ7 A;  4QL7 A;  2YZH A;  5IMC A;  5JCU A;  2I3Y A;  4ZL9 A;  2GT5 A;  1XW5 A;  4L5O A;  4TW5 A;  2LJR A;  3VI5 A;  4HQZ A;  1JLV A;  4KDX A;  2C0G A;  2KHP A;  2YWI A;  2LNS A;  1HNB A;  1X5C A;  4HDE A;  1XW6 A;  4MH2 A;  1AW9 A;  1EV4 A;  3TJG A;  1PL1 A;  10GS A;  3ZVJ D;  3D4M A;  5G5F A;  2GSQ A;  1HNA A;  1YEX A;  3EUR A;  1MD4 A;  5ECI B;  5D8I A;  3M9K A;  3ISO A;  3CRT A;  5DAL B;  1XOB A;  1EP7 A;  4GF0 A;  2R5G A;  4XRA A;  3IC4 A;  5IPH A;  2VO4 A;  3TKS C;  1ZYQ B;  4RUV A;  1M0U A;  4ZB9 A;  2F9S A;  4LMV A;  1V58 A;  4BL7 A;  3GH6 A;  2HYX A;  1XWA A;  3HJO A;  4CHS A;  5J9B A;  4FYU A;  1VGL A;  3VPT A;  3S9F A;  1T7P B;  1T1V A;  3RAZ A;  1U3A A;  3C1R A;  3EE2 A;  2VLV A;  6GSS A;  5BMU A;  1R5P A;  3PGT A;  1XWB A;  3W8S A;  2DBC A;  3GUS A;  1OC9 B;  2OJL A;  1ERU A;  1SU9 A;  1TRU A;  1QGV A;  4Q5R A;  3UBK A;  1Q98 A;  1R7H A;  2OBK A;  2CX3 A;  4L8E A;  3RBT A;  4HS1 A;  1A8Y A;  3GSS A;  1O7U A;  5EPF A;  1OVN A;  4KDY A;  3KM6 A;  1ZOF A;  4YQV A;  5FT3 A;  4K6X A;  4V2N A;  4IVF A;  2OE1 A;  3IA1 A;  3ZIV A;  4PX1 A;  2H74 A;  4IQA A;  4HOJ A;  3GYK A;  2VUP A;  5G1L A;  2E2G A;  1K0B A;  2HZF A;  5B8A A;  3TKQ A;  4EDZ A;  2G0F A;  4HZ2 A;  5ECS A;  1MDJ A;  4MZW A;  3G9B A;  2GVP A;  1G7O A;  1GWC A;  2P0G A;  1N2A A;  3I6A A;  2P5Q A;  2H76 A;  4ECB A;  2C1Y A;  4J56 E;  1BJX A;  3Q19 A;  2FWG A;  2R6K A;  4I6X A;  17GS A;  1A8L A;  1RQM A;  5ECN B;  3QMX A;  2HSN B;  1K0N A;  2GQL A;  5ID2 B;  2YZU A;  1V2A A;  3DXB A;  3PIN A;  4LA1 A;  4CW9 A;  4MF5 A;  4IEL A;  1V98 A;  1A0R P;  5B7C A;  4O7H A;  3LGC A;  1S3C A;  3LJR A;  1SL1 B;  5DAL A;  3HVX A;  3VPQ A;  3KMO A;  1BED A;  5KN2 A;  3FZ9 A;  1YF0 A;  3D0Z A;  4DSQ A;  4WR4 A;  2GLR A;  2GZZ A; 
#chains in the Genus database with same CATH topology
 2LRC A;  5A5H B;  2RM5 A;  1XWK A;  4WF5 A;  1LU4 A;  5IMZ A;  2WB9 A;  2IMD A;  6GSW A;  5GZZ B;  4P3Y B;  3KGK A;  3D5J A;  1OYJ A;  4Z2R A;  2R0P A;  2B3S A;  2C3Q A;  4CY8 A;  1K0M A;  3HD5 A;  2HRK A;  2VL3 A;  5ECK B;  4ISD A;  2WW1 A;  4KA0 A;  1SJZ A;  4CDO A;  1EOH A;  4ZB6 A;  1HYU A;  2HLS A;  3EU4 A;  3QDN A;  2I4A A;  1TI3 A;  1XWC A;  4KCE A;  4JE1 A;  1MDK A;  2OBI A;  3FEU A;  4GRF A;  1OC9 A;  4W66 A;  1ZGN A;  4GLT A;  1Z7R A;  2IPA A;  2A2P A;  2GQK A;  2ZNM A;  5J40 A;  1O6J A;  3DKS A;  4HEA 2;  5A4V A;  1ML6 A;  4PNF A;  1XG8 A;  1NW2 A;  3IV4 A;  5J9C A;  2EIO A;  2DJ1 A;  2VAF A;  3ZMK A;  4BVX A;  4EC0 A;  3KH7 A;  4GDF A;  1N25 A;  1XFL A;  5KEJ A;  2O5V A;  3HKR A;  3CQF A;  4TOP A;  1NSW A;  5ECO B;  1CQH A;  1THX A;  1TP9 A;  3F8U A;  1WIK A;  3TU3 B;  2GSR A;  4I2T A;  2UZ8 A;  4XS1 A;  3FZ5 A;  3HVV A;  2O85 A;  3ME8 A;  2GTU A;  5DJM A;  3ZFL A;  4YKF A;  5G1K A;  3ZTL A;  3APS A;  4ID0 A;  4AKG A;  5ECQ B;  1ABA A;  4K9Z A;  1F2E A;  3Q74 A;  2WFC A;  2DJJ A;  4BA7 A;  4AJ7 A;  2HSN A;  3QFB C;  1UN2 A;  2L4C A;  5ID2 A;  2DIY A;  3VWX A;  2IME A;  2NBS A;  4ECC A;  4XS4 B;  5HR3 A;  5ECR B;  3GTU B;  4MJB A;  3L78 A;  4JZQ A;  1HD2 A;  2F8F A;  1YKC A;  3IXR A;  2O89 A;  3TKP A;  3SBC A;  2DJK A;  4POB A;  5CNW A;  1U88 A;  1N8J A;  5HR2 A;  2V6O A;  3PH9 A;  5DBQ A;  3A5W A;  2VCX A;  2DIZ A;  4TR4 A;  3BJ5 A;  4MMM A;  1SL0 B;  5IMV A;  2JL4 A;  4USS A;  5D73 A;  5ELA A;  5A34 B;  12GS A;  1FW1 A;  4FIW A;  3TRQ A;  1B8X A;  1S3A A;  4I8B A;  5FWG A;  2E0Q A;  2GSS A;  4LMW A;  1AUC A;  1KEB A;  4BWQ A;  2E2M A;  3UVH A;  3LXZ A;  2KUC A;  2MMA A;  3KCM A;  3BOA A;  14GS A;  4MH3 A;  5E4W A;  1Q4J A;  5COH A;  4OFT A;  1XXU A;  4PTS A;  2ES7 A;  3LSZ A;  3FW2 A;  3GHA A;  4QMK A;  2H66 A;  4K7I A;  3F6F A;  1WWJ A;  4RQX A;  4CY6 A;  5D9V A;  2VCQ A;  1XW9 A;  4ZL7 A;  1XOA A;  4TVE A;  1LJR A;  1E2Y A;  2HSM B;  2OE3 A;  4G19 A;  2YV7 A;  3FYG A;  1GSY A;  3ERW A;  3QFA C;  3KTB A;  2BJX A;  1B9Y C;  3L0H A;  4ZB7 A;  3J7Y k;  1E6B A;  3TKS A;  1AC1 A;  4RQR A;  3LQ7 A;  4PNG A;  1J08 A;  1YKA A;  1G7E A;  4L0U A;  2ON5 A;  3KXO A;  1K3Y A;  3A5I A;  5D9T A;  1GUH A;  1H75 A;  4YQM A;  5HR0 A;  2HFD A;  3C8E A;  2KLX A;  1AXD A;  1NHY A;  3R2Q A;  3H1N A;  3F9U A;  4XS4 A;  3GTU A;  4IW9 A;  4HQS A;  1ST9 A;  2YCD A;  5INY A;  1PRX A;  5IPG A;  3F0I A;  2HSY A;  2LQO A;  3QAG A;  2HNL A;  3UVT A;  2X8G A;  1G6Y A;  3LW9 A;  2IFQ B;  2C4J A;  4HI7 A;  2MMZ A;  5HQP A;  5KN3 A;  3GN3 A;  1TRS A;  2PWJ A;  1THO A;  3KH9 A;  4JR4 A;  2OAD A;  4GQC A;  3NZN A;  3GV1 A;  3GKK A;  4ZBA A;  3AY8 A;  7GSS A;  1GTA A;  2HXK A;  5CRG A;  4AGS A;  4O32 A;  2H0I A;  4AKX B;  2GS3 A;  2DJ3 A;  1LBK A;  4HU7 A;  2V2G A;  4OWY A;  4PQI A;  3APQ A;  4IBP A;  4KE3 A;  4EDY A;  4ZXG A;  1VRS D;  4Z2U A;  1ZL9 A;  1T3B A;  3IOS A;  5LNK e;  2FGX A;  2H19 A;  4G0I A;  3GL3 A;  3WT2 A;  1BF5 A;  5ECM B;  2LNT A;  3G7I A;  1VF1 A;  1W4V A;  3IK7 A;  2FY6 A;  1GSF A;  2B1K A;  3UIW A;  4KAE A;  5HR1 A;  5IO0 A;  1RW1 A;  2CAQ A;  2NTO A;  2I1U A;  4PUF C;  2AAW A;  2WRT A;  3KP8 A;  4IJI A;  2O3E A;  2PVQ A;  1O8X A;  3I69 A;  3M3M A;  3C7M A;  2LRN A;  2HSM A;  3RHB A;  1EZK A;  1FB6 A;  3EMP A;  2CA8 A;  1Y25 A;  2YWM A;  3GUR A;  2FCH A;  4POL A;  1UA5 A;  2L59 A;  2Z9S A;  2HE3 A;  4G0K A;  1JZD A;  1BG1 A;  4ICY A;  4XRD A;  4D73 B;  1BG5 A;  5CO3 A;  4HJ2 A;  3FR6 A;  5G30 A;  4TR1 A;  3O76 A;  1XIY A;  2HRF A;  1SJI A;  4OCF A;  4EUY A;  4KUN A;  1SKR B;  3DVX A;  1HNC A;  3RHC A;  5J3R A;  1TJD A;  2JZS A;  1OC3 A;  1GLP A;  2VL9 A;  4WET A;  2VCZ A;  2HQT A;  3RDW A;  2H0G A;  3VK9 A;  1A2M A;  2HI7 A;  1GUM A;  3IE3 A;  3W6G A;  2IFQ A;  5JCW A;  2JSZ A;  2H1A A;  3TJB A;  2PVO C;  3GH9 A;  4BPY A;  1TU8 A;  1PKZ A;  3LFL A;  1EGO A;  3WYW A;  3BD2 A;  3H79 A;  3ERG A;  4KX4 A;  5KOW A;  3ERF A;  1GSQ A;  2VOC A;  3GKN A;  4G9H A;  3LXT A;  4EIQ A;  1M9B A;  2I9H A;  1DE2 A;  4YQU A;  4EKZ A;  2JSY A;  2MBS A;  4MF7 A;  2WS2 A;  5H5Q A;  1TRV A;  3ZVJ A;  4TKY A;  2HRA A;  1B4Q A;  4ML1 A;  3C73 A;  2YWN A;  1YEP A;  4IS0 A;  2CZ3 A;  1GRX A;  3M0F A;  4EL1 A;  3WGD A;  2TRC P;  4PGT A;  3N5O A;  3K8N A;  4XTS A;  2OT3 A;  2EIQ A;  4K7O A;  1SVL A;  4BVY B;  1H4O A;  1GUL A;  3DWV A;  4HSC X;  1O73 A;  3F4T A;  3M8N A;  2K8S A;  3P7X A;  1V57 A;  4PI0 C;  3TB2 A;  1SYX A;  4F0B A;  1TOF A;  3TOT A;  5CP1 A;  4PQ1 A;  1K3O A;  3QOU A;  1X9M B;  4F0C A;  2FWF A;  5ABR A;  1ERW A;  4POM A;  2H72 A;  5GSS A;  2RLI A;  5F05 A;  2B7K A;  2WW2 A;  2GQM A;  9GSS A;  4LLR A;  4V1A p;  1PMT A;  2EFE A;  2E7P A;  4AKH A;  2H01 A;  4HUA A;  1M9A A;  3HA9 A;  4O5R A;  4KB3 A;  2H1L A;  3FY7 A;  4MAB A;  2CQ9 A;  4ACS A;  4JU5 A;  1MDI A;  3ZRD A;  4AJ6 A;  2MZC A;  4MJE A;  2ZUP A;  3CWG A;  3A2W A;  1VF2 A;  4Q5F A;  1BQ7 A;  2AUV A;  2BMX A;  3DD3 A;  5F0G A;  2WDU A;  1ZYN A;  2JAD A;  6GSY A;  2ZCT A;  3KJY A;  3WT1 A;  5IMF A;  1PX6 A;  1JZW A;  2H6X A;  5A4U A;  3CTF A;  1QFN A;  3ME7 A;  4I5Q A;  1FB0 A;  3L9S A;  3KIJ A;  1GL8 A;  1M2D A;  3QAW A;  4YKG A;  3BBY A;  1V9W A;  2HZE B;  2GT6 A;  2R0C A;  3IDV A;  3TDG A;  2LST A;  4IP6 A;  4NV5 A;  4WXT A;  3L9V A;  4K2D A;  2L6D A;  3IHQ A;  2M72 A;  1SKW B;  2PPT A;  3ZL5 A;  2JAC A;  2V32 A;  4WF4 A;  1AIU A;  2XBQ A;  2NDO A;  5DJL A;  3QPM A;  8GSS A;  2XPD A;  4X1U A;  2O87 A;  1QK8 A;  1TK0 B;  2WW3 A;  3FKF A;  1FG4 A;  2OE0 A;  2FUG 2;  3HJM A;  4ILF A;  1ZYP A;  3PR8 A;  1GSD A;  5AGY A;  2H71 A;  2GST A;  4GQF A;  1M3J A;  1PKW A;  3H93 A;  2VKZ G;  1B4P A;  2R37 A;  1S3D A;  3UBL A;  2M80 A;  4X43 A;  2YN1 A;  1TU7 A;  2FHE A;  4ZIJ A;  1Z5Y E;  5J4U A;  1K3L A;  1Z7P A;  2REM A;  4XCS A;  3ZFB A;  4V1A g;  3D21 A;  4IJ3 A;  1SVO A;  4MJA A;  1J9B A;  2L6C A;  16GS A;  2VL2 C;  2YJH A;  2JU5 A;  1GNW A;  4MA9 A;  3P90 A;  4L5L A;  1W89 A;  4G0L A;  2DMM A;  1EWX A;  5L71 A;  4MZC A;  4DSS B;  2F3M A;  4OFM A;  3WGX A;  1KTE A;  4EE0 A;  1O81 A;  3ZIT A;  3GA4 A;  4L0W A;  3HY2 A;  3WD6 A;  1JFU A;  11GS A;  4EIP A;  6GST A;  1K0C A;  4AJ8 A;  1Z9H A;  4GST A;  1TK8 B;  2LS5 A;  3F6D A;  5ECH B;  2GZP A;  2B7J A;  1GSS A;  5H5R A;  1AAZ A;  4ML6 A;  3MYD A;  3E3E A;  3D4T A;  1UVZ A;  3GKM A;  4N11 A;  5GST A;  1WMJ A;  1OC8 A;  4O92 A;  1R26 A;  1GTU A;  4OMV A;  5IOX A;  4F9Z A;  3LWA A;  1FOH A;  5A5H A;  3UL3 A;  5IIZ A;  2PER A;  2A4H A;  4TXV A;  3CSJ A;  1XWG A;  3US3 A;  5C04 A;  5G2Z A;  3HVN A;  2H1D A;  2H1B A;  4GTU A;  4XHM A;  1C72 A;  1JLW A;  1PA3 A;  3SWL A;  3VUR A;  5J47 A;  4IQ1 A;  1DUG A;  3GST A;  1YEW C;  3M9J A;  2V6K A;  4N30 A;  2HZE A;  3Q18 A;  2X64 A;  3ZML A;  3CTG A;  1EV9 A;  3DML A;  2FA8 A;  5AIV A;  1BX9 A;  3IBH A;  1OKT A;  2FLS A;  4N10 A;  5B6N A;  4HJM A;  2L57 A;  4E8E A;  2CX4 A;  3DVW A;  1EEM A;  1JZR A;  3F4R A;  2FNO A;  1FAA A;  2CVB A;  3CRU A;  4ECJ A;  4MDC A;  3G7Y A;  6GSV A;  1ZCP A;  4GSS A;  1I9D A;  4K8M A;  3ED3 A;  3MWH A;  3EU3 A;  6GSU A;  1PFO A;  1FO5 A;  1SKS B;  3MSZ A;  1B9X C;  4ZBB A;  3W8J A;  1BYE A;  1M2B A;  3KZQ A;  1KBN A;  1U3I A;  1EGR A;  13GS A;  2BTO T;  4EF0 A;  5F06 A;  3LOR A;  3A3T A;  2R3X A;  2F51 A;  4V2L A;  2WGR A;  4MJC A;  4GXZ A;  4BIK A;  2IWT A;  4NWY A;  5AN1 A;  2AB6 A;  2YOI A;  1EEJ A;  4TRX A;  2VM2 A;  2L5L A;  3D22 A;  1SK1 A;  2DC5 A;  4EXJ A;  20GS A;  3HCZ A;  2ALB A;  3KMN A;  2YP6 A;  1Y1U A;  3J7Y b;  4RI6 A;  4JED A;  3IPZ A;  4WBR D;  1PL2 A;  1TXU A;  3F63 A;  1GH2 A;  3CMI A;  4HZ4 A;  2C8U A;  5DAK B;  2OAC A;  5CRW A;  3G7J A;  3WGE A;  5KOX A;  5ECP B;  1PX7 A;  2H30 A;  2K6V A;  1TXX A;  5LD0 A;  4YAV A;  2LJA A;  4F82 A;  3VWW A;  2B5E A;  2CAI A;  3M1G A;  3HYP A;  5LCZ A;  2AJQ B;  2UV8 G;  2RUE A;  4FQU A;  5DCH A;  4QL9 A;  3TKR A;  3HZ4 A;  5A34 A;  4BWS A;  5D9X A;  1U87 A;  4LL4 B;  5IQY A;  5DQS A;  1AQW A;  3L9U A;  2DLX A;  1QUW A;  4TR3 A;  4H86 A;  1ERT A;  1OE7 A;  1OKD A;  1URM A;  1UC7 A;  2B6M A;  1GNE A;  4G01 A;  3EWL A;  1A23 A;  1WE0 A;  2X4A A;  3VWV A;  2K9F A;  3F3Q A;  2P31 A;  4KH7 A;  1VF4 A;  3EVI A;  3V1W A;  2MYG A;  4PUA A;  5D96 A;  1XBS A;  2TIR A;  2QSI A;  4OCE A;  4DSR A;  4IGJ A;  3ZLP A;  3HDC A;  3VLN A;  2EFC A;  2R0G A;  1MD3 A;  1XPV A;  3IAS 2;  1PGT A;  2WUL A;  5ELG A;  4WR5 A;  1HQO A;  4EVM A;  2GGT A;  1DE1 A;  5B8B A;  3FR9 A;  2L5O A;  1EOG A;  2TRX A;  2KP2 A;  4GWR A;  2YPM A;  3NOF A;  1XCC A;  1X9W B;  4PUR A;  1MTC A;  1OAZ A;  2JZR A;  1IYH A;  2H70 A;  2IMI A;  5AIS A;  2EIR A;  5B6M A;  4KND A;  4TR0 A;  2N5A A;  4E68 A;  1KNG A;  3CHX C;  1TW9 A;  3CYN A;  1Z6M A;  5F07 A;  5JCG A;  4MF6 A;  2H73 A;  5HFI A;  5J4V A;  2QA2 A;  2X49 A;  3UJ1 A;  5HFK A;  1IYI A;  1F37 A;  5D9W A;  4ULX A;  3GX8 A;  3FRC A;  2FWH A;  1AQX A;  3GIX A;  5DAK A;  5CRE A;  3OR5 A;  3DGQ A;  1PQN A;  3APO A;  3UMA A;  1F3A A;  4PXO A;  3GMF A;  3HVS A;  4FYC A;  3HJP A;  1SD8 A;  3CXG A;  3QD9 A;  1WOU A;  3NIV A;  5IO2 A;  2AHE A;  1RK4 A;  5GAN D;  3BCK A;  2XPE A;  4K0N A;  4J57 E;  3GRX A;  2DSA A;  1SJ6 A;  1XVW A;  2HRK B;  2X99 A;  5DDL A;  2MMO A;  3EPT A;  2KP1 A;  3RPN A;  2LKU A;  4XIH A;  2KOK A;  5IMD A;  4NMU A;  2NVL A;  4MLY A;  2H6Y A;  1SVM A;  3FZA A;  4IHU A;  4MPG A;  1TK5 B;  4AF2 A;  2H6Z A;  5BRT A;  1YF1 A;  3KP9 A;  1BAY A;  1S4B P;  3QR6 A;  2GDR A;  3O3T A;  1GP1 A;  3DIE A;  4Z7X A;  1FVJ A;  2VL2 A;  1TRW A;  3RPP A;  1I1I P;  4AKI A;  2K8V A;  3UEM A;  2LV3 A;  4NPB A;  2C80 A;  2A2S A;  5AIX A;  2IL3 A;  3P8W A;  4K2X A;  4A5P A;  3C1S A;  2WZS A;  1J0F A;  4BVX B;  3P2A A;  2DML A;  4DEJ A;  4IN0 A;  3GNJ A;  2J9H A;  2QKE A;  3LG6 A;  4KDU A;  2VLT A;  4Z2T A;  5CAX A;  5KN1 A;  2O36 A;  3HZ8 A;  1O8W A;  1TDI A;  2NPB A;  3O6T A;  1GSU A;  1GLQ A;  4K1F A;  3GKX A;  3ZYW A;  1WPI A;  1JHB A;  1GTB A;  4F03 A;  2OKA A;  2WZ9 A;  5A4W A;  1Y6E A;  2A4V A;  3H8Q A;  4X0X A;  6GSX A;  2MMN A;  3LYK A;  1X5D A;  3L4N A;  1WRY A;  4DVC A;  2J23 A;  1SEN A;  4G10 A;  2H8L A;  1A24 A;  3KD0 A;  4OD7 A;  1YQ1 A;  3LEF A;  3KEB A;  5EY6 A;  2B5Y A;  4D73 A;  3IR4 A;  1SK2 A;  4MCU A;  1FVK A;  18GS A;  3UAR A;  4K7N A;  3U6V A;  1M2A A;  2OA7 A;  3TRP A;  2B5X A;  2A2R A;  5HFG A;  4NAX A;  1M99 A;  2LQQ A;  5A5K A;  5D93 A;  2P5R A;  3HXS A;  1U6T A;  4FO5 A;  2PMT A;  4ECI A;  4XS6 A;  5F8B A;  2H75 A;  4HU9 A;  5J41 A;  2FA4 A;  3CSH A;  1ILO A;  3MNG A;  2WCI A;  2C0D A;  4V2M A;  5EVO A;  1QQ2 A;  2AYT A;  2CT6 A;  4NHZ A;  1PSQ A;  4KGI A;  4OO5 A;  4GCI A;  2B1L A;  2V41 A;  5A1N B;  1NHO A;  1FHE A;  3FHK A;  1YDK A;  1QXH A;  2VCW A;  2LTK A;  2F8A A;  2D2Z A;  4EO3 A;  5EL8 A;  4MP4 A;  1K0D A;  1F6M C;  3TJK A;  2N5B A;  2YV9 A;  1T00 A;  2DJ0 A;  2IJY A;  3TJF A;  1SYR A;  3MAK A;  4WEY A;  1OE8 A;  2R4V A;  3ZRE A;  4TXO B;  4WBJ A;  4N0Z A;  1YY7 A;  3E0U A;  3QAV A;  5CRH A;  3JCM L;  2RUF A;  4YH2 A;  1S3R A;  3E9J B;  3I43 A;  5JWQ B;  4G2E A;  1YJ6 A;  2FWE A;  1USB A;  2WJU A;  4BVY A;  1ON4 A;  2YWO A;  5IOW A;  4MNN A;  2XHF A;  4GSN A;  2YAN A;  5DVB A;  2FD3 A;  3R3E A;  1R5A A;  1WP0 A;  3BCI A;  4ZBD A;  5E59 A;  4TN8 A;  2VD1 A;  1K0A A;  1ZZY A;  5H5S A;  4KW6 A;  3VWU A;  4Q5Q A;  2HT9 A;  2ON7 A;  4OO4 A;  5CRD A;  2DJ2 A;  5ENU A;  1F3B A;  1YZX A;  2IIY A;  3PPU A;  5DCG A;  3VI7 A;  5JWR B;  3IC8 A;  3VFI A;  1SL2 B;  1F9M A;  2WVX B;  1QMV A;  1ZYE A;  4OFN A;  4X4J A;  3F3R A;  4E8H A;  1TKD B;  4NHW A;  2C3N A;  3HHV A;  1T8E B;  4Q5N A;  3QCP A;  1M7T A;  5DQY A;  2M46 A;  2LJK A;  4KSM A;  4NV2 A;  3GFK A;  4KF9 A;  4MPF A;  1T4Z A;  2CZ2 A;  2HSH A;  1A0F A;  1PD2 1;  1ZMA A;  2MBT A;  3FK8 A;  2V1M A;  2PBJ A;  4JRR A;  2H0H A;  3EYT A;  3H4K A;  4IP1 A;  2R2J A;  2XBI A;  3D6I A;  3UAP A;  1TI1 A;  2C0E A;  3Q6O A;  1XZO A;  1XVQ A;  1R4W A;  3TCO A;  1WJK A;  2PN8 A;  3ZIJ A;  1X0R A;  2IMK A;  2GZY A;  4LL1 B;  5A1N A;  3FR3 A;  1O85 A;  1ACV A;  3CBU A;  2VCT A;  3DRN A;  2EFD A;  1SK0 A;  4IKH A;  1TTZ A;  3EIN A;  3IAM 2;  3U5R E;  2PU9 C;  4ZB8 A;  5C00 A;  1CQG A;  5G5E A;  2QA1 A;  2CVD A;  2X8H A;  4PI2 C;  4PQH A;  2YNX A;  1V40 A;  4TXO A;  3A2V A;  2VCV A;  5CYY A;  2N5F A;  1G0T A;  1AQV A;  3UOM A;  2QGV A;  5KN0 A;  2CVK A;  4ZL8 A;  4PHZ C;  5IM9 A;  2JZT A;  3I9V 2;  2VIM A;  2PGT A;  3TRX A;  2C0F A;  2IMF A;  2L4Q A;  2I81 A;  1I5G A;  2G2Q A;  4MZB A;  2WW0 A;  1FOV A;  2LRT A;  1Z6N A;  4O5Q A;  3DEX A;  19GS A;  3EMX A;  1A2L A;  4K0G A;  3ZZX A;  1MEK A;  4POK A;  3RGB C;  2EFH A;  4DSS A;  1VF3 A;  4NXI A;  3A2X A;  2EC4 A;  1PN0 A;  3GX0 A;  5FHI A;  2O7K A;  3TUE A;  1K0O A;  4N0V A;  1A2J A;  2C3T A;  2CV4 A;  3C71 A;  3KTL A;  4I97 A;  3TGZ A;  4TR1 B;  4WKW A;  2WVX A;  1DBY A;  4MK3 A;  3DYR A;  2LEG A;  2VD0 A;  2PUK C;  2XC2 A;  5G31 A;  5JWO B;  2VM1 A;  2K18 A;  3TJJ A;  4BL7 B;  1T4Y A;  1NM3 A;  5J5N A;  2AV4 A;  1PN9 A;  3FZ4 A;  5IMA A;  1GSE A;  3LYP A;  4F2I A;  3CSI A;  1GTI A;  3N9J A;  4ZIL A;  5GAP D;  3IRA A;  4KCA A;  4JR6 A;  5BMU B;  3MDK A;  3F4S A;  3FMW A;  2RII A;  2H1G A;  1ERV A;  4FYB A;  1Z3E A;  1G6W A;  1B48 A;  2LUS A;  2VLU A;  1SD9 A;  1M3I A;  5J4Y A;  2O8V B;  4KSO A;  1EP8 A;  4RI7 A;  5ECL B;  3TOU A;  3TKS E;  4J2F A;  2RM6 A;  3RFR C;  22GS A;  2HRN A;  1JZO A;  3GL5 A;  4JBB A;  2X8C A;  4FH8 A;  4I2U A;  3IK9 A;  3EC3 A;  1GUK A;  2QC7 A;  1DSB A;  2IN3 A;  1X5E A;  2YJ7 A;  4YAP A;  1X9S B;  4N3Z A;  4QQ7 A;  4QL7 A;  2YZH A;  5IMC A;  5JCU A;  2I3Y A;  4ZL9 A;  2GT5 A;  1XW5 A;  4L5O A;  4TW5 A;  2LJR A;  3VI5 A;  4HQZ A;  1JLV A;  4KDX A;  2C0G A;  2KHP A;  2YWI A;  2LNS A;  1HNB A;  1X5C A;  4HDE A;  1XW6 A;  3IHG A;  4MH2 A;  1AW9 A;  1EV4 A;  3TJG A;  1PL1 A;  10GS A;  3ZVJ D;  3D4M A;  5G5F A;  2GSQ A;  1HNA A;  1YEX A;  3EUR A;  1MD4 A;  5ECI B;  5D8I A;  3M9K A;  3ISO A;  3CRT A;  5DAL B;  1XOB A;  1EP7 A;  4GF0 A;  2R5G A;  4XRA A;  3IC4 A;  5IPH A;  2VO4 A;  3TKS C;  3HMJ G;  1ZYQ B;  4K5R A;  4RUV A;  1M0U A;  3MIX A;  2WVZ A;  4ZB9 A;  2F9S A;  4LMV A;  4AI6 A;  1V58 A;  4BL7 A;  3GH6 A;  2HYX A;  1YVL A;  1XWA A;  3HJO A;  4CHS A;  5J9B A;  4FYU A;  1VGL A;  3VPT A;  3S9F A;  1T7P B;  1T1V A;  3RAZ A;  1U3A A;  3C1R A;  3EE2 A;  2VLV A;  6GSS A;  5BMU A;  4FXY P;  2DKH A;  1R5P A;  3PGT A;  1XWB A;  3W8S A;  2DBC A;  3GUS A;  1OC9 B;  2OJL A;  4K5S A;  1ERU A;  1SU9 A;  1TRU A;  1QGV A;  4Q5R A;  3UBK A;  1Q98 A;  1R7H A;  2OBK A;  2CX3 A;  4L8E A;  3RBT A;  4HS1 A;  1A8Y A;  3GSS A;  1O7U A;  2WVY A;  5EPF A;  1OVN A;  4KDY A;  3KM6 A;  1ZOF A;  4O5U A;  4YQV A;  5FT3 A;  4K6X A;  4V2N A;  4IVF A;  2OE1 A;  3IA1 A;  3ZIV A;  4PX1 A;  2H74 A;  4IQA A;  4HOJ A;  3GYK A;  2VUP A;  5G1L A;  2E2G A;  1K0B A;  2HZF A;  5B8A A;  3TKQ A;  4EDZ A;  2G0F A;  4HZ2 A;  5ECS A;  1MDJ A;  4MZW A;  3G9B A;  2GVP A;  1G7O A;  1GWC A;  2P0G A;  1N2A A;  3I6A A;  2P5Q A;  2H76 A;  4ECB A;  2C1Y A;  4J56 E;  1BJX A;  3Q19 A;  2FWG A;  2R6K A;  4I6X A;  17GS A;  1A8L A;  1RQM A;  5ECN B;  3QMX A;  2DKI A;  2HSN B;  1K0N A;  2GQL A;  5ID2 B;  2YZU A;  1V2A A;  3DXB A;  3PIN A;  4LA1 A;  4CW9 A;  4MF5 A;  4IEL A;  1V98 A;  1A0R P;  5B7C A;  4O7H A;  3LGC A;  1S3C A;  3LJR A;  1SL1 B;  5DAL A;  3HVX A;  3VPQ A;  3KMO A;  1BED A;  5KN2 A;  3FZ9 A;  1YF0 A;  3D0Z A;  4DSQ A;  4WR4 A;  2GLR A;  2GZZ A; 
#chains in the Genus database with same CATH homology
 2LRC A;  5A5H B;  2RM5 A;  1XWK A;  4WF5 A;  1LU4 A;  5IMZ A;  2WB9 A;  2IMD A;  6GSW A;  5GZZ B;  4P3Y B;  3KGK A;  3D5J A;  1OYJ A;  4Z2R A;  2R0P A;  2B3S A;  2C3Q A;  4CY8 A;  1K0M A;  3HD5 A;  2HRK A;  2VL3 A;  5ECK B;  4ISD A;  4KA0 A;  1SJZ A;  4CDO A;  1EOH A;  4ZB6 A;  1HYU A;  2HLS A;  3EU4 A;  3QDN A;  2I4A A;  1TI3 A;  1XWC A;  4KCE A;  4JE1 A;  1MDK A;  2OBI A;  3FEU A;  4GRF A;  1OC9 A;  4W66 A;  1ZGN A;  4GLT A;  1Z7R A;  2IPA A;  2A2P A;  2GQK A;  2ZNM A;  5J40 A;  1O6J A;  3DKS A;  4HEA 2;  5A4V A;  1ML6 A;  4PNF A;  1NW2 A;  3IV4 A;  5J9C A;  2EIO A;  2DJ1 A;  2VAF A;  3ZMK A;  4BVX A;  4EC0 A;  3KH7 A;  4GDF A;  1N25 A;  1XFL A;  5KEJ A;  2O5V A;  3HKR A;  4TOP A;  1NSW A;  5ECO B;  1CQH A;  1THX A;  1TP9 A;  3F8U A;  1WIK A;  3TU3 B;  2GSR A;  4I2T A;  2UZ8 A;  4XS1 A;  3FZ5 A;  3HVV A;  2O85 A;  3ME8 A;  2GTU A;  5DJM A;  3ZFL A;  4YKF A;  5G1K A;  3ZTL A;  3APS A;  4ID0 A;  4AKG A;  5ECQ B;  1ABA A;  4K9Z A;  1F2E A;  3Q74 A;  2WFC A;  2DJJ A;  4BA7 A;  4AJ7 A;  2HSN A;  3QFB C;  1UN2 A;  2L4C A;  5ID2 A;  2DIY A;  3VWX A;  2IME A;  2NBS A;  4ECC A;  4XS4 B;  5HR3 A;  5ECR B;  3GTU B;  4MJB A;  3L78 A;  4JZQ A;  1HD2 A;  2F8F A;  1YKC A;  3IXR A;  2O89 A;  3TKP A;  3SBC A;  2DJK A;  4POB A;  5CNW A;  1U88 A;  1N8J A;  5HR2 A;  2V6O A;  3PH9 A;  5DBQ A;  3A5W A;  2VCX A;  2DIZ A;  4TR4 A;  3BJ5 A;  4MMM A;  1SL0 B;  5IMV A;  2JL4 A;  4USS A;  5D73 A;  5ELA A;  5A34 B;  12GS A;  1FW1 A;  4FIW A;  3TRQ A;  1B8X A;  1S3A A;  4I8B A;  5FWG A;  2E0Q A;  2GSS A;  4LMW A;  1AUC A;  1KEB A;  4BWQ A;  2E2M A;  3UVH A;  3LXZ A;  2KUC A;  2MMA A;  3KCM A;  3BOA A;  14GS A;  4MH3 A;  5E4W A;  1Q4J A;  5COH A;  4OFT A;  1XXU A;  4PTS A;  2ES7 A;  3LSZ A;  3FW2 A;  3GHA A;  4QMK A;  2H66 A;  4K7I A;  3F6F A;  1WWJ A;  4RQX A;  4CY6 A;  5D9V A;  2VCQ A;  1XW9 A;  4ZL7 A;  1XOA A;  4TVE A;  1LJR A;  1E2Y A;  2HSM B;  2OE3 A;  4G19 A;  2YV7 A;  3FYG A;  1GSY A;  3ERW A;  3QFA C;  3KTB A;  2BJX A;  1B9Y C;  3L0H A;  4ZB7 A;  3J7Y k;  1E6B A;  3TKS A;  1AC1 A;  4RQR A;  3LQ7 A;  4PNG A;  1J08 A;  1YKA A;  1G7E A;  4L0U A;  2ON5 A;  3KXO A;  1K3Y A;  3A5I A;  5D9T A;  1GUH A;  1H75 A;  4YQM A;  5HR0 A;  2HFD A;  3C8E A;  2KLX A;  1AXD A;  1NHY A;  3R2Q A;  3H1N A;  3F9U A;  4XS4 A;  3GTU A;  4IW9 A;  4HQS A;  1ST9 A;  2YCD A;  5INY A;  1PRX A;  5IPG A;  3F0I A;  2HSY A;  2LQO A;  3QAG A;  2HNL A;  3UVT A;  2X8G A;  1G6Y A;  3LW9 A;  2IFQ B;  2C4J A;  4HI7 A;  2MMZ A;  5HQP A;  5KN3 A;  3GN3 A;  1TRS A;  2PWJ A;  1THO A;  3KH9 A;  4JR4 A;  2OAD A;  4GQC A;  3NZN A;  3GV1 A;  3GKK A;  4ZBA A;  3AY8 A;  7GSS A;  1GTA A;  2HXK A;  5CRG A;  4AGS A;  4O32 A;  2H0I A;  4AKX B;  2GS3 A;  2DJ3 A;  1LBK A;  4HU7 A;  2V2G A;  4OWY A;  4PQI A;  3APQ A;  4IBP A;  4KE3 A;  4EDY A;  4ZXG A;  1VRS D;  4Z2U A;  1ZL9 A;  1T3B A;  3IOS A;  5LNK e;  2FGX A;  2H19 A;  4G0I A;  3GL3 A;  3WT2 A;  1BF5 A;  5ECM B;  2LNT A;  3G7I A;  1VF1 A;  1W4V A;  3IK7 A;  2FY6 A;  1GSF A;  2B1K A;  3UIW A;  4KAE A;  5HR1 A;  5IO0 A;  1RW1 A;  2CAQ A;  2NTO A;  2I1U A;  4PUF C;  2AAW A;  3KP8 A;  2WRT A;  4IJI A;  2PVQ A;  1O8X A;  3I69 A;  3M3M A;  3C7M A;  2LRN A;  2HSM A;  3RHB A;  1EZK A;  1FB6 A;  3EMP A;  2CA8 A;  1Y25 A;  2YWM A;  3GUR A;  2FCH A;  4POL A;  1UA5 A;  2L59 A;  2Z9S A;  2HE3 A;  4G0K A;  1JZD A;  1BG1 A;  4ICY A;  4XRD A;  4D73 B;  1BG5 A;  5CO3 A;  4HJ2 A;  3FR6 A;  5G30 A;  4TR1 A;  3O76 A;  1XIY A;  2HRF A;  1SJI A;  4OCF A;  4EUY A;  4KUN A;  1SKR B;  3DVX A;  1HNC A;  3RHC A;  5J3R A;  1TJD A;  2JZS A;  1OC3 A;  1GLP A;  2VL9 A;  4WET A;  2VCZ A;  2HQT A;  3RDW A;  2H0G A;  3VK9 A;  1A2M A;  2HI7 A;  1GUM A;  3IE3 A;  3W6G A;  2IFQ A;  5JCW A;  2JSZ A;  2H1A A;  3TJB A;  2PVO C;  3GH9 A;  4BPY A;  1TU8 A;  1PKZ A;  3LFL A;  1EGO A;  3WYW A;  3BD2 A;  3H79 A;  3ERG A;  4KX4 A;  5KOW A;  3ERF A;  1GSQ A;  2VOC A;  3GKN A;  4G9H A;  3LXT A;  4EIQ A;  1M9B A;  2I9H A;  1DE2 A;  4YQU A;  4EKZ A;  2JSY A;  2MBS A;  4MF7 A;  2WS2 A;  5H5Q A;  1TRV A;  3ZVJ A;  4TKY A;  2HRA A;  1B4Q A;  4ML1 A;  3C73 A;  2YWN A;  1YEP A;  4IS0 A;  2CZ3 A;  1GRX A;  3M0F A;  4EL1 A;  3WGD A;  2TRC P;  4PGT A;  3N5O A;  3K8N A;  4XTS A;  2OT3 A;  2EIQ A;  4K7O A;  1SVL A;  4BVY B;  1H4O A;  1GUL A;  3DWV A;  1O73 A;  3F4T A;  3M8N A;  2K8S A;  3P7X A;  1V57 A;  3TB2 A;  1SYX A;  4F0B A;  1TOF A;  3TOT A;  5CP1 A;  4PQ1 A;  1K3O A;  3QOU A;  1X9M B;  4F0C A;  2FWF A;  5ABR A;  1ERW A;  4POM A;  2H72 A;  5GSS A;  2RLI A;  5F05 A;  2B7K A;  2GQM A;  9GSS A;  4LLR A;  4V1A p;  1PMT A;  2EFE A;  2E7P A;  4AKH A;  2H01 A;  4HUA A;  1M9A A;  3HA9 A;  4O5R A;  4KB3 A;  2H1L A;  3FY7 A;  4MAB A;  2CQ9 A;  4ACS A;  4JU5 A;  1MDI A;  3ZRD A;  4AJ6 A;  2MZC A;  4MJE A;  2ZUP A;  3CWG A;  3A2W A;  1VF2 A;  4Q5F A;  1BQ7 A;  2AUV A;  2BMX A;  3DD3 A;  5F0G A;  2WDU A;  1ZYN A;  2JAD A;  6GSY A;  2ZCT A;  3KJY A;  3WT1 A;  5IMF A;  1PX6 A;  1JZW A;  2H6X A;  5A4U A;  3CTF A;  1QFN A;  3ME7 A;  4I5Q A;  1FB0 A;  3L9S A;  3KIJ A;  1GL8 A;  1M2D A;  3QAW A;  4YKG A;  3BBY A;  1V9W A;  2HZE B;  2GT6 A;  2R0C A;  3IDV A;  3TDG A;  2LST A;  4IP6 A;  4NV5 A;  4WXT A;  3L9V A;  4K2D A;  2L6D A;  3IHQ A;  2M72 A;  1SKW B;  2PPT A;  3ZL5 A;  2JAC A;  2V32 A;  4WF4 A;  1AIU A;  2XBQ A;  2NDO A;  5DJL A;  3QPM A;  8GSS A;  2XPD A;  4X1U A;  2O87 A;  1QK8 A;  1TK0 B;  3FKF A;  1FG4 A;  2OE0 A;  2FUG 2;  3HJM A;  4ILF A;  1ZYP A;  3PR8 A;  1GSD A;  5AGY A;  2H71 A;  2GST A;  4GQF A;  1PKW A;  3H93 A;  2VKZ G;  1B4P A;  2R37 A;  1S3D A;  3UBL A;  2M80 A;  4X43 A;  2YN1 A;  1TU7 A;  2FHE A;  4ZIJ A;  1Z5Y E;  5J4U A;  1K3L A;  1Z7P A;  2REM A;  4XCS A;  3ZFB A;  4V1A g;  3D21 A;  4IJ3 A;  1SVO A;  4MJA A;  1J9B A;  2L6C A;  16GS A;  2VL2 C;  2YJH A;  2JU5 A;  1GNW A;  4MA9 A;  3P90 A;  4L5L A;  1W89 A;  4G0L A;  2DMM A;  1EWX A;  5L71 A;  4MZC A;  4DSS B;  2F3M A;  4OFM A;  3WGX A;  1KTE A;  4EE0 A;  1O81 A;  3ZIT A;  3GA4 A;  4L0W A;  3HY2 A;  3WD6 A;  1JFU A;  11GS A;  4EIP A;  6GST A;  1K0C A;  4AJ8 A;  1Z9H A;  4GST A;  1TK8 B;  2LS5 A;  3F6D A;  5ECH B;  2GZP A;  2B7J A;  1GSS A;  5H5R A;  1AAZ A;  4ML6 A;  3MYD A;  3E3E A;  3D4T A;  1UVZ A;  3GKM A;  4N11 A;  5GST A;  1WMJ A;  1OC8 A;  4O92 A;  1R26 A;  1GTU A;  4OMV A;  5IOX A;  4F9Z A;  3LWA A;  1FOH A;  5A5H A;  3UL3 A;  5IIZ A;  2PER A;  2A4H A;  4TXV A;  3CSJ A;  1XWG A;  3US3 A;  5C04 A;  5G2Z A;  2H1D A;  2H1B A;  4GTU A;  4XHM A;  1C72 A;  1JLW A;  1PA3 A;  3SWL A;  3VUR A;  5J47 A;  4IQ1 A;  1DUG A;  3GST A;  3M9J A;  2V6K A;  4N30 A;  2HZE A;  3Q18 A;  2X64 A;  3ZML A;  3CTG A;  1EV9 A;  3DML A;  2FA8 A;  5AIV A;  1BX9 A;  3IBH A;  1OKT A;  2FLS A;  4N10 A;  5B6N A;  4HJM A;  2L57 A;  4E8E A;  2CX4 A;  3DVW A;  1EEM A;  1JZR A;  3F4R A;  2FNO A;  1FAA A;  2CVB A;  3CRU A;  4ECJ A;  4MDC A;  3G7Y A;  6GSV A;  1ZCP A;  4GSS A;  1I9D A;  4K8M A;  3ED3 A;  3MWH A;  3EU3 A;  6GSU A;  1FO5 A;  1SKS B;  3MSZ A;  1B9X C;  4ZBB A;  3W8J A;  1BYE A;  1M2B A;  3KZQ A;  1KBN A;  1U3I A;  1EGR A;  13GS A;  2BTO T;  4EF0 A;  5F06 A;  3LOR A;  3A3T A;  2R3X A;  2F51 A;  4V2L A;  2WGR A;  4MJC A;  4GXZ A;  2IWT A;  4NWY A;  5AN1 A;  2AB6 A;  2YOI A;  1EEJ A;  4TRX A;  2VM2 A;  2L5L A;  3D22 A;  1SK1 A;  2DC5 A;  4EXJ A;  20GS A;  3HCZ A;  2ALB A;  3KMN A;  2YP6 A;  1Y1U A;  3J7Y b;  4RI6 A;  4JED A;  3IPZ A;  4WBR D;  1PL2 A;  1TXU A;  3F63 A;  1GH2 A;  3CMI A;  4HZ4 A;  2C8U A;  5DAK B;  2OAC A;  5CRW A;  3G7J A;  3WGE A;  5KOX A;  5ECP B;  1PX7 A;  2H30 A;  2K6V A;  1TXX A;  5LD0 A;  4YAV A;  2LJA A;  4F82 A;  3VWW A;  2B5E A;  2CAI A;  3M1G A;  3HYP A;  5LCZ A;  2AJQ B;  2UV8 G;  2RUE A;  4FQU A;  5DCH A;  4QL9 A;  3TKR A;  3HZ4 A;  5A34 A;  4BWS A;  5D9X A;  1U87 A;  4LL4 B;  5IQY A;  5DQS A;  1AQW A;  3L9U A;  2DLX A;  1QUW A;  4TR3 A;  4H86 A;  1ERT A;  1OE7 A;  1OKD A;  1URM A;  1UC7 A;  2B6M A;  1GNE A;  4G01 A;  3EWL A;  1A23 A;  1WE0 A;  2X4A A;  3VWV A;  2K9F A;  3F3Q A;  2P31 A;  4KH7 A;  1VF4 A;  3EVI A;  3V1W A;  2MYG A;  4PUA A;  5D96 A;  1XBS A;  2TIR A;  2QSI A;  4OCE A;  4DSR A;  4IGJ A;  3ZLP A;  3HDC A;  3VLN A;  2EFC A;  2R0G A;  1MD3 A;  1XPV A;  3IAS 2;  1PGT A;  2WUL A;  5ELG A;  4WR5 A;  1HQO A;  4EVM A;  2GGT A;  1DE1 A;  5B8B A;  3FR9 A;  2L5O A;  1EOG A;  2TRX A;  2KP2 A;  4GWR A;  2YPM A;  3NOF A;  1XCC A;  1X9W B;  4PUR A;  1MTC A;  1OAZ A;  2JZR A;  1IYH A;  2H70 A;  2IMI A;  5AIS A;  2EIR A;  5B6M A;  4KND A;  4TR0 A;  2N5A A;  4E68 A;  1KNG A;  1TW9 A;  3CYN A;  1Z6M A;  5F07 A;  5JCG A;  4MF6 A;  2H73 A;  5HFI A;  5J4V A;  2QA2 A;  2X49 A;  3UJ1 A;  5HFK A;  1IYI A;  1F37 A;  5D9W A;  4ULX A;  3GX8 A;  3FRC A;  2FWH A;  1AQX A;  3GIX A;  5DAK A;  5CRE A;  3OR5 A;  3DGQ A;  1PQN A;  3APO A;  3UMA A;  1F3A A;  4PXO A;  3GMF A;  3HVS A;  4FYC A;  3HJP A;  1SD8 A;  3CXG A;  3QD9 A;  1WOU A;  3NIV A;  5IO2 A;  2AHE A;  1RK4 A;  5GAN D;  3BCK A;  2XPE A;  4K0N A;  4J57 E;  3GRX A;  2DSA A;  1SJ6 A;  1XVW A;  2HRK B;  2X99 A;  5DDL A;  2MMO A;  3EPT A;  2KP1 A;  3RPN A;  2LKU A;  4XIH A;  2KOK A;  5IMD A;  4NMU A;  2NVL A;  4MLY A;  2H6Y A;  1SVM A;  3FZA A;  4IHU A;  4MPG A;  1TK5 B;  4AF2 A;  2H6Z A;  5BRT A;  1YF1 A;  3KP9 A;  1BAY A;  3QR6 A;  2GDR A;  3O3T A;  1GP1 A;  3DIE A;  4Z7X A;  1FVJ A;  2VL2 A;  1TRW A;  3RPP A;  4AKI A;  2K8V A;  3UEM A;  2LV3 A;  4NPB A;  2C80 A;  2A2S A;  5AIX A;  2IL3 A;  3P8W A;  4K2X A;  4A5P A;  3C1S A;  1J0F A;  4BVX B;  3P2A A;  2DML A;  4DEJ A;  4IN0 A;  3GNJ A;  2J9H A;  2QKE A;  3LG6 A;  4KDU A;  2VLT A;  4Z2T A;  5CAX A;  5KN1 A;  3HZ8 A;  1O8W A;  1TDI A;  2NPB A;  3O6T A;  1GSU A;  1GLQ A;  4K1F A;  3GKX A;  3ZYW A;  1WPI A;  1JHB A;  1GTB A;  4F03 A;  2OKA A;  2WZ9 A;  5A4W A;  1Y6E A;  2A4V A;  3H8Q A;  4X0X A;  6GSX A;  2MMN A;  3LYK A;  1X5D A;  3L4N A;  1WRY A;  4DVC A;  2J23 A;  1SEN A;  4G10 A;  2H8L A;  1A24 A;  3KD0 A;  4OD7 A;  1YQ1 A;  3LEF A;  3KEB A;  5EY6 A;  2B5Y A;  4D73 A;  3IR4 A;  1SK2 A;  4MCU A;  1FVK A;  18GS A;  3UAR A;  4K7N A;  3U6V A;  1M2A A;  2OA7 A;  3TRP A;  2B5X A;  2A2R A;  5HFG A;  4NAX A;  1M99 A;  2LQQ A;  5A5K A;  5D93 A;  2P5R A;  3HXS A;  1U6T A;  4FO5 A;  2PMT A;  4ECI A;  4XS6 A;  5F8B A;  2H75 A;  4HU9 A;  5J41 A;  2FA4 A;  3CSH A;  1ILO A;  3MNG A;  2WCI A;  2C0D A;  4V2M A;  5EVO A;  1QQ2 A;  2AYT A;  2CT6 A;  4NHZ A;  1PSQ A;  4KGI A;  4OO5 A;  4GCI A;  2B1L A;  2V41 A;  5A1N B;  1NHO A;  1FHE A;  3FHK A;  1YDK A;  1QXH A;  2VCW A;  2LTK A;  2F8A A;  2D2Z A;  4EO3 A;  5EL8 A;  4MP4 A;  1K0D A;  1F6M C;  3TJK A;  2N5B A;  2YV9 A;  1T00 A;  2DJ0 A;  2IJY A;  3TJF A;  1SYR A;  3MAK A;  4WEY A;  1OE8 A;  2R4V A;  3ZRE A;  4TXO B;  4WBJ A;  4N0Z A;  1YY7 A;  3E0U A;  3QAV A;  5CRH A;  3JCM L;  2RUF A;  4YH2 A;  3E9J B;  3I43 A;  5JWQ B;  4G2E A;  1YJ6 A;  2FWE A;  1USB A;  2WJU A;  4BVY A;  1ON4 A;  2YWO A;  5IOW A;  4MNN A;  2XHF A;  4GSN A;  2YAN A;  5DVB A;  2FD3 A;  3R3E A;  1R5A A;  1WP0 A;  3BCI A;  4ZBD A;  5E59 A;  4TN8 A;  2VD1 A;  1K0A A;  1ZZY A;  5H5S A;  4KW6 A;  3VWU A;  4Q5Q A;  2HT9 A;  2ON7 A;  4OO4 A;  5CRD A;  2DJ2 A;  5ENU A;  1F3B A;  1YZX A;  2IIY A;  3PPU A;  5DCG A;  3VI7 A;  5JWR B;  3IC8 A;  3VFI A;  1SL2 B;  1F9M A;  1QMV A;  1ZYE A;  4OFN A;  4X4J A;  3F3R A;  4E8H A;  1TKD B;  4NHW A;  2C3N A;  3HHV A;  1T8E B;  4Q5N A;  3QCP A;  1M7T A;  5DQY A;  2M46 A;  2LJK A;  4KSM A;  4NV2 A;  3GFK A;  4KF9 A;  4MPF A;  1T4Z A;  2CZ2 A;  2HSH A;  1A0F A;  1PD2 1;  1ZMA A;  2MBT A;  3FK8 A;  2V1M A;  2PBJ A;  4JRR A;  2H0H A;  3EYT A;  3H4K A;  4IP1 A;  2R2J A;  2XBI A;  3D6I A;  3UAP A;  1TI1 A;  2C0E A;  3Q6O A;  1XZO A;  1XVQ A;  1R4W A;  3TCO A;  1WJK A;  2PN8 A;  3ZIJ A;  1X0R A;  2IMK A;  2GZY A;  4LL1 B;  5A1N A;  3FR3 A;  1O85 A;  1ACV A;  3CBU A;  2VCT A;  3DRN A;  2EFD A;  1SK0 A;  4IKH A;  1TTZ A;  3EIN A;  3IAM 2;  3U5R E;  2PU9 C;  4ZB8 A;  5C00 A;  1CQG A;  5G5E A;  2QA1 A;  2CVD A;  2X8H A;  4PQH A;  2YNX A;  1V40 A;  4TXO A;  3A2V A;  2VCV A;  5CYY A;  2N5F A;  1G0T A;  1AQV A;  3UOM A;  2QGV A;  5KN0 A;  2CVK A;  4ZL8 A;  5IM9 A;  2JZT A;  3I9V 2;  2VIM A;  2PGT A;  3TRX A;  2C0F A;  2IMF A;  2L4Q A;  2I81 A;  1I5G A;  2G2Q A;  4MZB A;  1FOV A;  2LRT A;  1Z6N A;  4O5Q A;  3DEX A;  19GS A;  3EMX A;  1A2L A;  4K0G A;  3ZZX A;  1MEK A;  4POK A;  4DSS A;  2EFH A;  1VF3 A;  4NXI A;  3A2X A;  2EC4 A;  1PN0 A;  3GX0 A;  5FHI A;  2O7K A;  3TUE A;  1K0O A;  4N0V A;  1A2J A;  2C3T A;  2CV4 A;  3C71 A;  3KTL A;  4I97 A;  3TGZ A;  4TR1 B;  4WKW A;  1DBY A;  4MK3 A;  3DYR A;  2LEG A;  2VD0 A;  2PUK C;  2XC2 A;  5G31 A;  5JWO B;  2VM1 A;  2K18 A;  3TJJ A;  4BL7 B;  1T4Y A;  1NM3 A;  5J5N A;  2AV4 A;  1PN9 A;  3FZ4 A;  5IMA A;  1GSE A;  3LYP A;  4F2I A;  3CSI A;  1GTI A;  3N9J A;  4ZIL A;  5GAP D;  3IRA A;  4KCA A;  4JR6 A;  5BMU B;  3MDK A;  3F4S A;  3FMW A;  2RII A;  2H1G A;  1ERV A;  4FYB A;  1Z3E A;  1G6W A;  1B48 A;  2LUS A;  2VLU A;  1SD9 A;  5J4Y A;  2O8V B;  4KSO A;  1EP8 A;  4RI7 A;  5ECL B;  3TOU A;  3TKS E;  4J2F A;  2RM6 A;  22GS A;  2HRN A;  1JZO A;  3GL5 A;  4JBB A;  2X8C A;  4FH8 A;  4I2U A;  3IK9 A;  1GUK A;  3EC3 A;  2QC7 A;  1DSB A;  2IN3 A;  1X5E A;  2YJ7 A;  4YAP A;  1X9S B;  4N3Z A;  4QQ7 A;  4QL7 A;  2YZH A;  5IMC A;  5JCU A;  2I3Y A;  4ZL9 A;  2GT5 A;  1XW5 A;  4L5O A;  4TW5 A;  2LJR A;  3VI5 A;  4HQZ A;  1JLV A;  4KDX A;  2C0G A;  2KHP A;  2YWI A;  2LNS A;  1HNB A;  1X5C A;  4HDE A;  1XW6 A;  3IHG A;  4MH2 A;  1AW9 A;  1EV4 A;  3TJG A;  1PL1 A;  10GS A;  3ZVJ D;  3D4M A;  5G5F A;  2GSQ A;  1HNA A;  1YEX A;  3EUR A;  1MD4 A;  5ECI B;  5D8I A;  3M9K A;  3ISO A;  3CRT A;  5DAL B;  1XOB A;  1EP7 A;  4GF0 A;  2R5G A;  4XRA A;  3IC4 A;  5IPH A;  2VO4 A;  3TKS C;  3HMJ G;  1ZYQ B;  4K5R A;  4RUV A;  1M0U A;  3MIX A;  4ZB9 A;  2F9S A;  4LMV A;  4AI6 A;  1V58 A;  4BL7 A;  3GH6 A;  2HYX A;  1YVL A;  1XWA A;  3HJO A;  4CHS A;  5J9B A;  4FYU A;  1VGL A;  3VPT A;  3S9F A;  1T7P B;  1T1V A;  3RAZ A;  1U3A A;  3C1R A;  3EE2 A;  2VLV A;  6GSS A;  5BMU A;  2DKH A;  1R5P A;  3PGT A;  1XWB A;  3W8S A;  2DBC A;  3GUS A;  1OC9 B;  2OJL A;  4K5S A;  1ERU A;  1SU9 A;  1TRU A;  1QGV A;  4Q5R A;  3UBK A;  1Q98 A;  1R7H A;  2OBK A;  2CX3 A;  4L8E A;  3RBT A;  4HS1 A;  1A8Y A;  3GSS A;  1O7U A;  5EPF A;  1OVN A;  4KDY A;  3KM6 A;  1ZOF A;  4O5U A;  4YQV A;  5FT3 A;  4K6X A;  4V2N A;  4IVF A;  2OE1 A;  3IA1 A;  3ZIV A;  4PX1 A;  2H74 A;  4IQA A;  4HOJ A;  3GYK A;  2VUP A;  5G1L A;  2E2G A;  1K0B A;  2HZF A;  5B8A A;  3TKQ A;  4EDZ A;  2G0F A;  4HZ2 A;  5ECS A;  1MDJ A;  4MZW A;  3G9B A;  2GVP A;  1G7O A;  1GWC A;  2P0G A;  1N2A A;  3I6A A;  2P5Q A;  2H76 A;  4ECB A;  2C1Y A;  4J56 E;  1BJX A;  3Q19 A;  2FWG A;  2R6K A;  4I6X A;  17GS A;  1A8L A;  1RQM A;  5ECN B;  3QMX A;  2DKI A;  2HSN B;  1K0N A;  2GQL A;  5ID2 B;  2YZU A;  1V2A A;  3DXB A;  3PIN A;  4LA1 A;  4CW9 A;  4MF5 A;  4IEL A;  1V98 A;  1A0R P;  5B7C A;  4O7H A;  3LGC A;  1S3C A;  3LJR A;  1SL1 B;  5DAL A;  3HVX A;  3VPQ A;  3KMO A;  1BED A;  5KN2 A;  3FZ9 A;  1YF0 A;  3D0Z A;  4DSQ A;  4WR4 A;  2GLR A;  2GZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...