4GF5A

Crystal structure of calicheamicin methyltransferase, cals11
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
251
structure length
251
Chain Sequence
QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGFPDVNDVDRVGPTAYQGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalS11
source organism Micromonospora echinospora
molecule tags Transferase
total genus 77
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gf5A00
1XCLA 2QYOA 4R8RA 5GOZA 1EG2A 2FK7A 1ZQ9A 3DXXA 2AVDA 3E05A 3OZRA 4OBWA 2ZCJA 1Q0TA 4C03A 3R6TA 4OQEA 1XTPA 2B9EA 5FULA 3GU3A 2PXCA 5DX1A 5GM2A 2PGXA 2PV0A 5DM4A 5K0NA 2BR5A 5DRYA 5DT2A 3VYWA 2UYCA 2GLUA 3FUUA 4RVFA 4RTKA 4M36A 4BP1A 10MHA 4RVHA 1JR4A 5HFJA 2PX2A 3PLAE 3G5LA 2ZULA 3NJRA 5CVVA 2WA2A 5EEHA 4RSRA 5K03A 2Z6AA 1FPQA 4R6WA 1PJZA 2ZFUA 2ZIFA 4L7VA 3R9XB 3LCUA 2NXCA 2YXLA 5CM2Z 2ONZA 3G5TA 1NV8A 5EKUA 1X1AA 5F2OA 3X0DA 5K8VA 2GA9A 1MJFA 3FUVA 3DR5A 3FUXA 5FA5A 3GJYA 1G55A 1RI4A 5E2AA 3GRVA 2IGTA 2GB4A 4PYIA 2ZIGA 1O54A 3I5UA 1PRYA 4PGGA 1D2CA 1QZZA 2PWYA 2DPMA 3GIWA 3KU1A 5EMLA 1N7JA 5EQJB 3DUWA 2JHCA 1BC5A 4OQDA 3LCVB 5FHRA 1KPGA 3L8DA 3KR1A 3HNRA 1TW2A 2EX4A 1H1DA 1QAOA 3R3HA 3GDHA 1EJ0A 3B5IA 3HVIA 3OU2A 5K0CA 3C3PA 4G56A 4RTSA 3O31A 1P1BA 3KQQA 1JG4A 2H00A 3QOXA 2BH2A 3KR0A 4K6MA 1HMYA 2CL5A 3CJRA 3E8SA 3G2OA 3V8VA 5KYGA 4HC4A 5DLYA 2FRXA 1JG2A 4PYQA 2GAFA 2WK1A 3A7DA 4DF3A 3AWIA 3QV2A 3HTXA 3FZGA 4JXJA 3GRYA 4DM3A 4R8SA 3FRIA 3G2QA 4M38A 1TPYA 1Z3CA 1G60A 2HWKA 5E1DA 3SR4A 2HR1A 3G8AA 1ORHA 2ZWVA 2OKCA 1WG8A 2YXEA 3K6RA 3SGLA 4PYOA 3KQVA 5K0BA 2AN4A 1FJXA 1INLA 3HA3A 3ORHA 1XCJA 5E8JA 4ER5A 3M6VA 2ZSUA 2P1DA 2V74B 3P71T 4RV9A 4HSGA 4OBXA 5CVJA 3A25A 5CD1A 4KDCA 4RTLA 3BWMA 2P41A 2ZZNA 3NW9A 4YV0A 3G8BA 1L9KA 2PX5A 4GUAA 3U81A 1I4WA 2NYUA 3EVGA 3LL7A 3OFKA 2Z6QA 5LQRA 4RTMA 4C06A 2AOXA 1SVUA 2P3OA 2I9KA 2EFJA 1AF7A 2HMYB 5EG5A 5FQOA 2YX1A 3LDUA 3B3FA 2AZTA 4PCAA 4CTKA 1SKMA 4QQKA 3TFWA 3Q87B 4HTFB 3BWBA 3EVCA 1EAMA 5EOVA 4YV2A 5FUBA 3FTCA 3OU6A 1R74A 3FPEA 2P3LA 5C0OE 1QANA 2HTEA 3DH0A 4RTJA 1IM8A 4IWNA 3P9NA 1XJ5A 3A7EA 3R24A 2PY6A 5CUQA 5FWAA 5ERGB 5EPEA 3BUSA 3VC2A 1NW7A 1OR8A 1UIRA 3OE4A 5E2BA 4KIFA 3C6MA 1RJDA 5F2NA 5ICCA 1XVAA 4IV8A 5EGSA 3P9IA 4V0RA 2AOWA 2UZ4A 5K09A 3P2EA 1JG1A 2ZIEA 3LCCA 3C0KA 1YB2A 3CC8A 3CKKA 3DOUA 3FPJA 3HCFA 5GP1A 4YUYA 5KS2A 3ANXA 4P7FA 5DTQA 1KPIA 4X60A 3E23A 2IDJA 2ZBPA 5IH3A 3NDIA 5LQKA 5LQJA 1O9HA 4DKJA 2XYVA 3MCZA 4HG2A 1JG3A 3MTEA 3HVHA 1JQ3A 3KPUA 4Y2HA 3FTDA 1X1CA 5H02A 1VPTA 4QVKA 4P58A 4RTPA 3G2MA 3I53A 2C7OA 2OB1A 4MIKA 2OXTA 2G8NA 3UA4A 3LDGA 3M6XA 2YUIA 3BKXA 4FS8A 2AOUA 3CVOA 2P40A 4P7KA 2OYRA 4EMSA 1UFKA 5EHGA 5DTRA 3B3GA 2BM8A 2AS0A 3AXTA 3HCBA 4RTNA 5FCDA 2VP3A 3A26A 3GCZA 3HCAA 4KIGA 3T0IA 5K0GA 1Y8CA 3GRUA 3V97A 1ZG3A 1KXZA 3EVBA 5ICEA 5EIFA 4DA4A 4LG1A 4GOND 3KPJA 4KW7A 5KQRA 3KQWA 3AJDA 5EC8A 1KYWA 3UA3A 5P8WA 4OX9Y 3FYCA 5EHIA 3C3YA 2AR0A 2PX8A 3S68A 1YZ3A 2ZTHA 3P2IA 2ORED 3PFHA 4F84A 3LHDA 3BKWA 3DMGA 4Y30A 3T7TA 2PSSA 2R3SA 3BXOA 4PNEA 5HZMA 3M6WA 1EQAA 4P7GA 5CCBA 2I62A 3GRRA 3DLIA 3KR2A 1NW5A 3ID6C 4FT4A 5D1HA 5K05A 2YQZA 3LKZA 4HH4A 2EJTA 5E9QA 4X63A 4QPNA 4YMGA 3ER9A 3TR6A 1RJGA 2PXXA 4GC9A 2AOUB 3NVKI 1FP1D 3G88A 3EVAA 2NXNA 5GIPE 1YFLA 3VSEA 3JWHA 2OY0A 4E32A 4F86A 1RI5A 2FPOA 2YR0A 2IPXA 4QTUB 3DTNA 4E30A 2XBMA 4KRGA 4E2XA 2VS1A 1ZGAA 3KR9A 5E9JA 5T67A 3NWEA 4QDKA 3FPGA 4P7JA 3SSNA 3HVJA 2VDUE 3LDFA 4RVGA 1RI2A 3UJAA 1SQGA 4PYMA 3PB3A 3PX2A 5D1NA 4NECA 3DLCA 5FADA 3SSOA 3THRA 3ERCA 3IEIA 3PTAA 1JSXA 1KIAA 4BY9E 3IHTA 5DRTA 3TLJA 1JQDA 4HTFA 4QTTB 5F2KA 5DXJA 1YFJA 3B89A 1DUSA 3Q7EA 3P8ZA 3TKAA 1F3LA 1XDUA 4ER0A 3TOSA 2BR3A 3KPVA 1HNNA 2IBTA 1RJEA 3F4KA 4C08A 3ELWA 5HIJA 1BOOA 3TMAA 5GINE 2HNKA 4BP3A 1NE2A 1JTEA 3UJ8A 3SVZA 3HA7A 1N7IA 5EMMA 2BM9A 1D2HA 1NBHA 2ADMA 5DSXA 3KQTA 3MGGA 2XVMA 2O0LA 4ZTBA 2N47A 4C05A 5K0EA 1NW6A 3JWIA 2PKWA 1XXLA 1D2GA 2I7CA 4RTQA 4E2WA 1KHHA 1SUIA 3LX6A 2NNWB 4CTJA 2ZWAA 2O57A 4XUCA 2PLWA 3HA5A 3AXSA 4X41A 5KVAA 1VBFA 2UYOA 3KQOA 5FWDA 3I64A 4MTLA 4YUZA 4KWCA 3MERA 4QVGA 3EVFA 1G6Q1 2IFTA 2NXEA 3P9CA 4AUKA 1WZNA 2JH9A 3GRZA 5EMJA 1YUBA 3OFJA 4KVZA 1WXWA 2DULA 1YF3A 4FT2A 1VIDA 4BLUA 1KR5A 4XUDA 1XDSA 3ME5A 3T7SA 4PYJA 2EJUA 5DM1A 1NW3A 4GOOD 4MHTA 5EIWA 3G2PA 5FA8A 4PCLA 5LQNA 5LQUA 4QQNA 4XUEA 1ZHFA 2A14A 2LD4A 4LECA 1UWVA 2NP7A 5GM1A 4OA8A 2FHPA 4C04A 2GS9A 2ZVJA 2XYRA 3GWZA 3NTVA 2UYHA 5U4XA 4R6XA 3GGDA 3SXJA 2H1RA 2IP2A 2JJQA 2OB2A 3FPHA 4Z2YA 3UWPA 3CBGA 2O07A 3GO4A 4H0NA 3LKDA 4ER3A 5BXYA 4EKIA 2JG3A 3HCDA 3TM4A 3HM2A 3MAGA 2FK8A 2ZBQA 4E70A 2PJDA 1VP3A 3UJ7A 4EVIA 2XYQA 5LQAA 3GNLA 3PX3A 2Q41A 3MCTA 2K4MA 3SM3A 1NW8A 3MB5A 5HEKA 5CVEA 3VC1A 5LR6A 4ISCA 4BLVA 9MHTA 3O7WA 4GF5A 4PONA 1JSZA 5DWQA 3BWCA 3HCCA 3IV6A 1G8AA 1M6YA 2B25A 2IIPA 2ZLBA 5T64A 3T7RA 3TQSA 3M6UA 2CWWA 2C7QA 3JWGA 4UOEA 4E31A 3TPZA 3UFBA 2PBFA 5IKMA 2XVAA 3DULA 1FBNA 1TW3A 4GEKA 4PINA 3KQSA 4GOLD 5LSAA 2ONYA 5E9WA 1FP2A 3EEOA 1R18A 1U2ZA 2C7PA 2QY6A 4PGHA 3RIEA 2BZGA 3G7UA 3FYDA 3UZUA 4C07A 3M4XA 4CKBA 2Z6UA 2YXDA 3DMHA 1ZKDA 3QOWA 2QM3A 5DM2A 5CVDA 3PT9A 3WSTA 3G89A 2F8LA 2VDWA 2NXJA 2Y1WA 1L1EA 5GIOE 4E2YA 2OZVA 2VDVE 3ELDA 4IV0A 2BR4A 3DMFA 3RODA 4FZVA 3OZSA 4CKCA 1WY7A 4KDRA 2E5WA 4X1OA 1R8XA 2FYTA 5ICFA 3EVDA 3KQPA 4FP9A 5DX0A 1N2XA 1P1CA 3EMDA 4MQ4A 3KPWA 1R8YA 1X1DA 3MTIA 5HIKA 5K0FA 4V0QA 4ER7A 5CCXA 4DMGA 3LGAA 3ELUA 5K01A 1SG9A 5E1OA 3CCFA 4A6EA 1SQFA 2ZBRA 3BZBA 3E7PA 3LSTA 1L3BA 2G71A 2O06A 4LWPA 4EK9A 3CJTA 3H2BA 5GWXA 5DM0A 4FSDA 5KQSA 2UYQA 5DTMA 3UJCA 2ESRA 5HOQA 1B42A 2G1PA 3AY0A 1R00A 4LWOA 1I9GA 5EMKA 5FHQA 4B17A 3EVZA 2P7IA 4IKPA 1X19A 4M7RA 5DXAA 5DSTA 2IDKA 3REOA 1VP9A 1QAQA 2Y1XA 4GBED 1V39A 2V7EA 4DCGA 2EG5A 5C1IA 3RW9A 2CKDA 1M6EX 4PYNA 1JTFA 5EZQA 3OPNA 3NDJA 3SX0A 3DXZA 4AZTA 1L3CA 8MHTA 4AZSA 3HCEA 3FTFA 4RWZA 4U7TB 3FTEA 4POOA 1KP9A 2PX4A 2QRVB 2ZZMA 3NWBA 2AOTB 4AZWA 3BGVA 3GXOA 2P35A 2O05A 4DCMA 2IH4A 5EVJA 3EGEA 1ORIA 2G70A 1G38A 3KQMA 2IH5A 3LBFA 3A4TA 1IY9A 2FCAA 1VQ1A 2JHAA 4RYLA 5BW4A 4DZRA 3OCJA 1RI1A 2IH2A 1VE3A 2KW5A 3UJDA 3LBYA 5EZSA 1SUSA 2OO3A 4ER6A 4DQ0A 3EMBA 2JHPA 4O29A 3R0QA 1F38A 2B2CA 3P2KA 4X61A 2ERCA 3HVKA 4M37A 3NMUF 1MHTA 2I6GA 2GH1A 2ZW9A 4MWZA 1VLMA 4RX1A 3B7PA 3MQ2A 4PWYA 2OBFA 3O4FA 4GOMD 4EKGA 2OPBA 3FRHA 2AN5A 5C9ZA 1P39A 5FQNA 2QE6A 5K0LA 1G8SA 1IXKA 3NVMB 3FPFA 3IYLW 4WXHA 3OU7A 4HRAA 5ICGA 7MHTA 5E8RA 3OZTA 3TM5A 1KYZA 2P7HA 3BT7A 1M0EA 2NP6A 2PXAA 3A27A 3SMQA 3EVEA 3THSA 2WA1A 4YUVA 1NBIA 3KPYA 4PYKA 1NV9A 3KHKA 1O9GA 4YUWA 5JUWA 3EPPA 3UJBA 4WVLA 5T6BA 2R6ZA 3UJ6A 4BLWA 1KPHA 2B78A 1Q0SA 4RVDA 3B3JA 4E2ZA 3I58A 3D2LA 5DPMA 5K0JA 2AN3A 3I9FA 2P3QA 4PYLA 2H11A 3EEYA 3UBTA 3M70A 3EGVA 3C6KA 1NT2A 4GC5A 4PIPA 4CWAA 2PVCA 3EGIA 3LPMA 3M33A 3PS9A 2VZ9A 3CJQA 3BWYA 4HGYA 5HIIA 1WXXA 4PIMA 4GQBA 4QPPA 5HIMA 1T43A 3TRKA 4RTRA 2PT6A 3LECA 5BW5A 2B3TA 3KQYA 1BHJA 4OA5A 4YMHA 1DL5A 1AQIA 3KKZA 2AVNA 2P8JA 2C7RA 5MHTA 3HEMA 4C4AA 1R6AA 1I1NA 1EJ6A 2HV9A 3P9KA 4FR0A 3TKYA 4ATNA 4FSXA 4AZVA 2JH8A 1QYRA 2CMHA 1L3IA 3BGDA 1EIZA 2PT9A 5CIYA 3P97A 3DXYA 1JQEA 1XDZA 3ELYA 5B1SA 3UJ9A 4YV1A 5JR3A 1NKVA 1YZHA 3JWJA 2YVLA 4U7PB 5CVUA 1AQJA 5EKXA 1VL5A 2CMGA 2GPYA 4QDJA 5EEGA 1QAMA 1RJFA 3CGGA 4E33A 1RI3A 4FGZA 4AX8A 1DCTA 2IBSA 5E1MA 3HP7A 5LQCA 4A6DA 5M5BA 1WS6A 2AOVA 3PVCA 4R05A 3SSMA 4YUXA 5HILA 2PWPA 3FUWA 4CKEA 2YTZA 1BKYA 3DP7A 4RTOA 3MHTA 1ZGJA 5DX8A 3FUTA 5E1BA 1X1BA 2ZZKA 1P91A 4HGZA 2QRVA 2G72A 5G02A 3ER8A 2AOTA 5FTWA 4CXMA 1AV6A 4EQZA 3BGIA 3OE5A 5BP7A 4F85A 3PFGA 3K0BA 4XCXA
chains in the Genus database with same CATH superfamily
2QYOA 1VL8A 2HWYA 2P5SA 5K8IA 4ZHQB 2CB0A 4O4HF 1ILEA 2CFRA 1A0OA 1TK3A 4NYJR 3L1IA 3DV0B 3TMYA 4OU5A 1RAFA 4HZIA 1CUCA 2WABA 1WW3A 5DNAA 3EA0A 3OFNA 1OF1A 4FFNA 2PGXA 1JZQA 5G1PA 2XF2A 2Q0SA 3AINA 2YDYA 3BOSA 3K0AA 5DRYA 4EUEA 2CK3D 4RTKA 4D98A 3UMJA 2HW8A 2XEDA 5AXAA 5JY6A 1IRXA 4PPGA 5EEHA 1I1OA 2WAOA 2Y0CA 5EIOA 2BMEA 2WJAA 4NYIR 5EUCA 3U7JA 4YFYA 2NTNA 3ZBTA 1I3CA 2UUPA 4MV5A 5DSZA 4Q3EA 3EGXB 4YROA 3JAWB 2ZUUA 4NONA 4ZZ2A 2H52A 3FUVA 1HE1C 3L8ZA 3S7TA 1QWSA 1CC1S 1E6EA 1CR1A 1TQDA 1VSBA 3C8ZA 3I5UA 2IU0A 1WW2A 4IDNA 3ICWA 521PA 3SKVA 2F67A 4M7WA 3G2IA 4MRNA 3Q6MA 2XEXA 4JZKA 2QG6A 3OX3A 5FHRA 2IRWA 3KELA 1BAPA 1HI9A 3L8DA 3PJGA 4AVYA 4E3ZA 1TQHA 5ALXA 3UB2A 1ZCFA 1BEZA 2JFYA 1K6MA 3EXG2 3ODPA 4E7OA 1AXRA 3TVDA 5KTNA 1B6SA 1SHTX 4LHXA 1EDZA 3QPDA 4UUQA 3URMA 4AJEA 4BQOA 4WN9A 3GPCA 2UZ0A 1JKMA 5HFNA 3MJVA 2PYZA 4HDSA 4K9PA 4TMFA 2F6RA 2GERA 5NULA 4K5QA 4N3AA 3SG0A 3A4VA 1BGVA 1SPXA 4ZIRB 2IHYA 2ZWVA 1ZMBA 5K0BA 3I0ZA 2OTCA 3GDFA 1G8YA 3C87A 4R0NA 2ZSUA 5EY5B 1DSSG 2Q3BA 1GGHA 3R6GA 4C0AC 1I33A 5CD1A 3O9VA 1FNNA 4AKGA 1QBGA 4ZKEA 1K7SN 4PF1A 1CHDA 5BQPA 3AUFA 2Q27A 3G23A 2JS7A 4G0XA 3LT0A 4J0HA 2EP8A 4KYUA 2C88A 5LQRA 4QYXA 4RNCA 4BMZA 3FA2A 5EQFA 3I61A 1J1IA 1EGQA 5GGYA 4L72A 4V24A 4B6QA 1U81A 4PXYA 2PN1A 4TMTA 3WMXA 1W85A 3U9SA 4UZFA 3OZWA 4I1UA 1J8FA 3CLKA 4DDMA 4MMZB 1W48A 1Q22A 4M87A 1I3KA 4LZNA 3WNQA 2FJ0A 5AW3A 3JQBC 1T0IA 1P18A 3CUUA 3OUZA 1TAGA 2VXOA 2WD8A 4OOEA 1U31A 2BSXA 4EB6A 4R7GA 4I1OA 2CXRA 2O6LA 2ZIAA 4BB5A 3TAUA 4II2A 4J7CA 2CBZA 3AVWA 5ICCA 2QVXX 3KB6A 3NBMA 2QLLA 3V2HA 3ZDDA 4TM8A 1UUFA 3D7LA 5K09A 5IG2A 2NV6A 1K2VN 2ZRFA 1U8XX 3CC8A 3DL7A 5CYPA 5I9TA 2WTMA 3DOUA 3K05A 5AOAA 3L5KA 3AVOA 1BRTA 4V0NA 5E2IA 1RQGA 5LXTA 2YMQA 4B7XA 4KQ2A 3HGMA 1WUTA 5IJZA 2ID8A 4URXR 4DKJA 3S28A 3GP8A 4BKUA 4O33A 1VMIA 1JQ3A 3GFGA 3HB1A 1XF9A 2ZAYA 5BSRA 3NX4A 1EINA 2H54A 3BXHA 3PENA 5CLHA 2D74A 5LIPA 2DR2A 3WGKA 4D9HA 1O57A 3OTHA 1DOAA 1P80A 4NEQA 4EYSA 5L4SA 4DV4B 4ENVA 4YT5A 3TQRA 4K0KB 4EA9A 5CYGA 4C7KA 3PC6A 3LVFO 2X5NA 1J8VA 3UGKA 3OETA 4BHTA 4F21A 5JJBA 3IE2A 4AKHA 1GITA 5LNK6 2EJWA 3DFKA 3WDLA 3AF0A 4KIGA 1GR0A 4EPVA 5F9MA 5ECDA 1Z6PA 5K0GA 3P9RA 4LCBA 3T0GA 2LKDA 1XZ8A 5AM3A 3K09A 3I9OA 5JS2A 3TSWA 2JVJA 4N82A 1TMGE 2KB0A 4MCIA 2PMEA 1U0JA 3UA3A 3WGYA 2GN4A 4DADA 1FFBA 1M2NA 3BL5A 5JJCA 3NBQA 3EPHA 2WPDA 2GLTA 4MARA 2RHWA 3W8NA 1KI2A 1FRVA 2QLTA 1Z5ZA 1WZ2A 3O9ZA 5EKDA 5TY0A 2RAUA 2D2VA 1B7GO 2GVNA 1TVEA 1GLVA 2BGTA 1D2MA 1P60A 2D2XA 2TS1A 1NQ5A 2Q3DA 4WGFA 2PS0A 5M34A 5IVDA 1R37A 3H9BA 2EYUA 3QYJA 3DLIA 1WDMA 2FPXA 4HVCA 1HT1E 2CCGA 4WINA 4AO8A 5DBHX 5F12A 3W04A 4I5EA 3ZU5A 1JZSA 1XQXA 4EJSA 3NVKI 2H1FA 3RVOA 1TAHA 1HYQA 1F7VA 2XDWA 5E4YA 4RLFA 4JVOA 1Y9JA 2DPXA 4D4KA 1H85A 4NZMA 5AW7A 1EFCA 1JECA 3H3XA 1FFXA 1GP2A 2XITA 3F7NA 5KC9A 3GAFA 4X6XA 1LPNA 3FHOA 4GX1A 2NPOA 3NWEA 1LBSA 3IKLA 3EQ7A 3Q11A 1WB5A 2GEVA 4NIMA 3RFXA 5BSEA 2ZJZA 3CT4A 1OT5A 4MQEA 1RI2A 3CEPB 3NEAA 3FZYA 4NMHA 4NCIA 1JJBA 3GI1A 3K2EA 1F60A 3F5FA 3FYSA 1XT6A 4QUHA 2AW3A 5K3BA 4C6TB 5FWXA 1JSXA 1KIAA 5H82A 1KJJA 1AGPA 2ETXA 1QVVA 2BC9A 4PCVA 2V6MA 5LA6A 5TT0A 3ZDZB 4DLLA 1D1TA 2JLUA 1O0BA 3H9UA 3E58A 2EIXA 3WFZA 1DQZA 4BV2A 3QKSA 3QY0A 2J9FB 3TOSA 1ZC3A 4PG6A 4DCJA 3WIVA 1M7GA 2B1GA 4IVNA 3T9CA 4WK4B 1GYRA 3KL4A 3QF4B 4NFSA 1YZYA 3AF6A 3H5NA 2C77A 2C04A 2ZIWB 2VHWA 4BP3A 5GONA 1Z2CA 2F62A 2HCBA 3OOYA 4ND8A 3DZHA 4Q1EA 5JCZA 4EKGA 2XOEA 3ZHTA 3W77A 1UKBA 2X9GA 3B36A 3AVPA 1DAMA 1GTL1 3QA3E 4NBRA 5IAJA 3QFSA 4HFNA 3RV3A 4HO1X 5EP2A 4QYIA 3KBOA 4J1SA 3RS7A 3F73A 2RHTA 1J33A 1T8UA 3E8MA 2W6ZA 3UXYA 2V4MA 3HA5A 4PPFA 5IVHA 4M8KA 4S12A 3LLSA 2VO1A 4ZOAA 1VBFA 1DZ3A 3VAYA 1XVLA 1IFXA 2DUJA 1GSAA 1QYIA 3DDCA 3IKMB 3DYIA 5JXJA 4G0VA 2YS7A 1R9NA 3P9CA 2WG1A 3K09C 4FHDA 4RH3A 2JH9A 5J4KA 1L4LA 3C74A 3HB4X 3MC1A 3NHAA 3CNOA 5EMJA 5ADWA 2CV0A 1L4GA 2GETA 1DUIA 2PZLA 1KGSA 3U3ZA 5L9AA 2GYVA 3QVJA 4PVCA 2XTMA 1UK7A 1RYMA 1F9AA 1JMYA 3LLUA 1NBME 3CEAA 4XJSA 1U4OA 1EVJA 4BFTA 4NOMA 1P8AA 4JVSB 2GR9A 2VPZA 1JU3A 1OZFA 2JDIA 4L9SA 3OEEA 4Q03A 4JYZA 3CUTA 4NG5A 5EE0A 4R71A 5FBVB 3AH8A 3NTVA 3BE6A 1TZMA 2DH5A 3IPXA 4IAOA 4Q5IA 3WK9A 5AVYA 3JQEA 2NSDA 4OQMA 4EJSC 1X3LA 2CMKA 4D97A 5CT6A 3ADCA 2W0MA 4YONB 1JQJC 3HM2A 1WUJS 2YYYA 3F4LA 2Z3ZA 1N78A 4YMSA 1EE2A 5MDHA 4HL6A 4JLOA 2X9VA 3O8BA 3C1TA 4PZEA 3A6ZA 1NVXQ 1N8KA 5B3JA 4JP2A 1ADFA 1PF7E 1E61A 1IPFA 3C97A 5HEKA 3SPXA 4ASUA 3B70A 2OVBA 5CVEA 1STOA 1UOEA 1L4UA 2ROQA 3FGNA 3HRHA 1H1TA 1X39A 3GQBA 4HV4A 5K0ZA 2H1SA 2VWGA 4B8ZA 4ERXA 5EZYA 4XA8A 1EFRA 2ATEA 4IDGA 2WM2A 1QHSA 3K0CC 1Q7GA 3CH4B 3UW3A 4KR0A 4XM0A 4PC7A 3SAJA 1G8MA 3OEWA 5JXHA 2GHRA 4LYAA 1ND6A 1PL8A 3EGWA 1TW3A 1JQBA 2N46A 4UHJA 2FKAA 3X1XA 2FPKA 3A9TA 3FJOA 1ZOOA 4HXFB 3JZFA 2V6IA 1WETA 4TTIA 3W2EA 3DOIA 3CHYA 5EUBA 4GKJB 4MR8A 4NARA 1NVEA 4H17A 1OOEA 3A1WA 4X44A 5IFKA 4PLTA 3N2KB 6ABPA 3QOWA 3K3PA 1ZUNA 4PLGA 2F00A 3O8RA 3BXFA 3G89A 4Y6GB 2VZ8A 5BPFA 1SKQA 5NLLA 1ECFA 1M2OA 1MV8A 2QXUA 1QSGA 2BGWA 4ZAXA 1RU3A 4BMYA 2E5WA 4KRYA 3E9EA 1UQUA 3J81A 1TZKA 1UBRS 2MINA 1U5CA 1XTZA 1MEEA 1TRKA 1JAXA 1Z4IA 4MP8A 2EIHA 4R2HA 1U80A 2FQWA 3HM9A 3LGAA 1ZH6A 3DOJA 1Z5GA 1AK1A 2AG0A 2PKQP 3K1JA 1YVDA 3K0EA 3OCYA 4I8IA 4TRMA 5CIQA 3T3HA 3NHPA 4JWTA 5AQ1A 3S40A 1VCHA 3LSTA 1ZD4A 2X8WA 3MS2A 3ZWNA 1B00A 3D2CA 2HHLA 5DTMA 1P33A 4BX8A 3VSDA 2W7TA 4IIUA 4BL5A 3VYVA 2V98A 1U2EA 1C1XA 2XMCA 3FKQA 4FHCA 4TYPA 5ALZA 4Q7JB 2B5OA 1EK2A 3ROPA 1E9VA 2P8SA 5C51B 1E4EA 1XRJA 3C43A 3FFAA 3RQIA 5JYBA 3NDJA 4BUJA 3M4JA 1JU9A 2VJLA 4S2EA 5DCLA 1NUHA 3AK4A 3CPSA 5E4JA 1IBSA 4UDNA 1ZCBA 4POOA 4LC9A 1SUFA 3JATB 3IA2A 2Z9DA 3CUSA 3NWBA 2JI8A 2O2ZA 3PTLA 4NPCA 4UZEA 4ECAA 5HJEA 1SIOA 3E9ZA 4B71A 1J99A 2P35A 2IH4A 1SUPA 4TZKA 3BL8A 1L5HA 4WXMA 1MA3A 2G5TA 4X84A 4DC0A 4QM6A 3KOUA 2FEWB 2ZE8A 4M1KA 4J4TA 2HIMA 2XT0A 4DZRA 2ZRPA 4FNAA 1MXHA 1I4EB 3LBYA 3OESA 1IOZA 1GPNA 2EFEB 3STVA 4YPOA 3TEFA 2Y1OA 1XN4A 4FJ0A 2C97A 1X7ZA 4MKHA 5H81A 1MC1A 4EA8A 1SZPA 1VZ3A 1D5WA 1Z15A 5LIRA 3C7DB 4R2KA 3EX7C 1R88A 5I48A 1BWPA 1BN6A 1MZVA 2FSGA 3IUPA 1QG4A 2QTGA 4HDMB 2CY0A 4JOSA 3R7AA 4OMCA 2ZS8A 2WKSA 5ALNA 3IALA 2EHDA 2ZPTX 2YS6A 2WYUA 2HA3A 4I9HA 5CTAA 1Z16A 3K1TA 3AM5A 3VNQA 1NQVA 1M6HA 1SULA 3ZEIA 2W42A 3L43A 3MRVA 2LV8A 3CIOA 2GAOA 4R9VA 1VB5A 4H3KB 5IABA 4FJ2A 2X1MA 1WMDA 2NZ2A 4OP1A 1T6BY 2HJGA 4AJ2A 5JT1A 2NP6A 1NN0A 2WJZB 1EM8B 3AETA 5KOHB 4KEAA 4ZAZA 4TQ9A 3KHKA 2HUPA 1A8UA 4UJ3A 3I6YA 3RWMB 3JQGA 4HGNA 4AUNA 4XPZA 4N48A 2CVFA 4X1IA 2FUG1 2OO5A 3NOOA 5AVSA 4LJ6A 3EEYA 3OX4A 2AZXA 1RHJA 2VK8A 4KN6A 2OOKA 4D96A 4E94A 4DTCA 5B7GA 2GM4A 1E1LA 4IEEA 5CK4A 2XMPA 1IQRA 3TR0A 1TEHA 1E8MA 4P81A 4RDCA 2WR8A 1UKAA 2X77A 3HGQA 4DCOA 1BFDA 2FG5A 4XSHA 1IVSA 1YS2X 3A32A 1T6ZA 4RTRA 2E89A 1O0SA 1BMTA 1QGDA 4BAGA 2FUG6 4JQZA 3AERB 2BZ1A 1WZEA 4KR9A 3SXPA 1GADO 1RMTA 4CN9A 1W36C 3OKPA 1O95D 3WR5A 1EH5A 2H18A 4G9BA 1BXGA 5B2ZA 5KMGB 3DC7A 3N3BC 3SLRA 2HDWA 2HOQA 5BW6B 4HLQB 3I01A 1A72A 4HADA 1T2EA 1C8KA 4B3HA 1JQLB 1EIZA 4RCVA 5CIYA 5KNDD 1DX9A 3DXYA 1K06A 3DWGA 1XA4A 2QTRA 2X0RA 3ELYA 2A0WA 3H3FA 4EB0A 5L3QA 1YQXA 1IEQA 5BR1A 5CLJA 2IZ5A 4E13A 3JWJA 3OF2A 1PWEA 5J9FA 1ETHA 1M2EA 4B4KA 2EJBA 1PQUA 1G9SA 2W98A 3IKVA 2J48A 4FNGA 2GAJA 2ZR0A 4B7AA 2PKRA 1LBHA 3R3VA 3T54A 3ZHYA 3DEZA 4EA7A 4DB2A 3ZPXA 4ZI7F 1D0IA 2YOHA 3DD1A 4ND3A 3FUTA 3WBFA 4MCAA 2IOFA 4KDFA 5JQWA 5F9HA 3N39C 4HGZA 4HMPA 2G72A 3A1TA 3QYFA 3OM1A 3Q0IA 3WB0A 3MEQA 5G4KA 1DTWA 2HH9A 4ZP1A 1WABA 4N3BA 3X2EA 5BNWA 3B9RA 3KSMA 1QHNA 2JJ1D 1PV2A 4MKZA 3A1UA 4UFNA 5IS2A 1W1UA 4CDRA 1XXHE 1DKRA 2AEFA 4FOSA 4KV9A 1ESMA 2FK7A 3M7IA 5CLGA 3DXXA 4IO0A 1S2NA 3NHKA 3QXGA 4KH0A 1YVPA 1PG2A 3E05A 5T5QA 1H2ZA 3K0HA 1J90A 4QG7A 3I2KA 3FAKA 1TM1E 2X19A 3DBIA 3DF7A 1TCAA 2GPJA 2XCUA 1DAKA 1F20A 4MIEA 1U04A 4P93A 4EFDA 1ZK4A 3R4CA 5IT5A 4WZAE 3TNLA 1N5RA 1QIGA 1NNLA 2YINC 2IZ6A 3WDKA 1BFUA 1SKAA 3EASA 3DDWA 4Q7KA 5CVVA 3F78A 1VG1A 1WA5A 3V6MA 4FNOA 2F43A 2WIAA 1CRQA 2QJFA 2ZFUA 4RANA 3LCUA 4YB8A 4LZZA 5ALHA 3ZKAA 4C43A 4ZJZA 4PC2A 1WL8A 4CKEB 3QXSA 3DHWC 3CM0A 1TUBB 4M1WA 2V59A 4QRDA 1U3VA 4N3CA 2ZYGA 1X92A 5JO0A 2ZCUA 1WCV1 4KJZA 2B8EA 4TL7A 4HEQA 4NBUA 4PNZA 4W1QA 1CY6A 2AQ8A 2IUEA 1V26A 2I9PA 1RFLA 4KSYA 4MSUA 3GEBA 4TKLA 5D01A 4EGJA 2CFTA 2RE8A 1OXMA 2C7VA 3FPCA 4E0BA 4X65B 4ZAWA 5IVPA 4AY4A 1VE6A 2IHNA 2CMFA 4QFDA 1XMPA 1T3HA 2AHOA 4XD7D 4LVUA 5J2TF 2ONJA 1JSCA 3QOXA 1UBFA 4PTYA 4CM9A 5B4UA 1RWMA 2BH2A 2MU1A 1BGWA 4ZREA 1MOPA 4GR9A 1JKFA 5SZIA 1UMCA 2Y76A 1EP1B 2VRCD 4DIUA 2QE7D 3OJWA 1GD1O 2O8EA 3CYFA 1B16A 3QEJA 2JIRA 4L78A 4YRTA 5LD2B 5ALFA 4CIYA 3I6MA 1E69A 3LC0A 4U7JA 3SR4A 4CBVA 4LDNA 3BJZA 2ET6A 2V45A 2XB2A 1WG8A 3R5HA 1BCRA 2ABWA 1Q92A 2IYNA 3FFBA 3GFQA 4MV6A 4NMLA 4EI2A 4Q7QA 2F7SA 4RPKA 3SR3A 1RBZA 3P71T 4LY6A 1AE1A 2AI3A 2J33A 4KN9S 3CINA 1XNHA 2C94A 2PPLA 3B1FA 5G40A 4W5QA 3BMNA 3EFEA 2CXNA 3GDOA 3GNQA 4YJKA 4ZRNA 4CT5A 4HUJA 2XB4A 2Z6QA 1XELA 2HSEA 1A8PA 3CCBA 3CUWA 1T5TA 3NHYA 5C7OO 2XY4A 4BZWA 3AJEA 4C4RA 3QENA 4FWBA 5AJHA 2X15A 1GRQA 4UDOA 1ZOSA 1MVNA 2ZANA 3I2HA 4JGIA 1F51E 1BZYA 3NVDA 4CLRB 4EUNA 2IEDA 2FOIA 1B6RA 1Q0UA 4WCFC 4RHTA 2W2QA 3K1AB 2HMVA 1MOZA 1QVAA 5CCEA 1SIBE 4BFSA 1IZ8A 1BIFA 3R24A 1IM5A 3GLVA 4M9ZA 1UBCA 4BNWA 1WQ4A 2AHRA 1IBKB 2QTBA 3JAMA 4LYDA 2BEJA 3W3AH 2QTFA 1QLWA 3VJMA 1WDTA 4FINA 5E38A 1DJNA 3F2VA 5EGSA 2HF9A 1WPQA 1Q74A 1N0UA 3D4IA 1MTZA 3ZYCA 3M1AA 3SHOA 2BFOA 4ZC8A 4C22A 4EKEA 1GRNA 1DCFA 2HDNB 2PSDA 2D2EA 3DBRA 4NE9A 5IBRA 3LVRE 4U39A 4JP5A 4ENUA 4TSKA 1W4LA 3IR7A 3QEOA 4YI5A 4IINA 4Q3DA 5B4TA 1H2XA 4MQUA 3JD1A 4LBYA 3AFMA 3AZQA 2FDXA 2PRIA 1PGPA 1XA0A 5CFMA 1GQQA 1QGED 4I1SA 1YL7A 4WY5A 3HRIA 4CV2A 2V3CC 5FOUA 4QIHA 4PC3A 3AYXB 5H5JA 1RVDA 1SXJE 3LF1A 5ENZA 3V2GA 4H1VA 3SIWA 2DT8A 5KYYB 2XZLA 4REQA 1OYVA 3OQIA 3CZ9A 1XXHB 4MIKA 3WJ1A 5LKAA 1Z7EA 2BELA 5LOVA 1XAGA 1SXJC 2IYFA 3V5NA 3ZU3A 5CB4A 5BSWA 1SIWA 4NBNA 3VPDA 3NT4A 1II8A 1L8LA 1BEUB 1G6KA 1WTCA 1BJRE 1E1CB 2XNDA 4I1YA 2C4MA 2ZCVA 4N6OA 2QX9A 4MI9A 1TQ6A 1XRMA 3TLAA 4DWVA 4JU8A 4WZAB 1AXEA 1J6UA 3AR6A 3RG8A 3UAZA 2HSDA 1LV8A 3KHTA 2XNHA 4UD6A 5EIFA 1I6WA 1AC5A 3G3EA 5EUMA 2OGSA 4Q3KA 1HQCA 1QF9A 2HGSA 4XRRA 4EYKA 4QHTA 4MYTA 1N3YA 5A71A 4QUJA 3BD7A 4Q9LA 1PSWA 2FPUA 8ADHA 5KSOA 2R85A 4OTZA 3ICCA 3TSAA 3ZZ0A 5LMZA 3PRJA 2ZIZA 3LHDA 2KBEA 4KIUA 4P38A 4CLDA 2GDJA 4CM4B 5KYUB 2PSSA 2R3SA 3OIFA 3ZGNA 4ZN6A 1KJQA 3HI6A 2R0QC 2D2FA 2H3HA 2ZJFA 3PSAA 4HXEB 4KE6A 5HF5A 4PRYA 3QVSA 2D8AA 3GRRA 1WTAA 3SHFA 2IEZA 4KG7A 3M89A 3KR2A 4BPRA 1NW5A 2H2IA 2VXBA 4TS3A 3LKZA 5JHGB 2Z83A 5E9QA 4NG4A 2VVTA 1YJQA 3DMRA 3QU9A 2AC7A 4NI5A 4RKYA 2HRQA 4RMJA 1U6KA 2NZXA 5AFSA 2OBLA 3GUYA 3IJRA 2H08A 4YT2A 2PGLA 3IVXA 3FKJA 5I9MA 5I7EA 5KJ6A 1LW7A 2P2DA 1VSQA 1ECPA 4NCXA 1ZQ1A 3SFZA 1HT2E 3EG9A 1L1RA 4TQUS 5GPBA 1BDIA 2Q2WA 1FCJA 3UMGA 4DCNA 3PR2B 1FFAA 2VDUE 4FE4A 1DV1A 4BNTA 2NUAA 4QJBA 1XDBA 4O4LB 3FF1A 1WMAA 5K45A 3OJXA 4NECA 3CZQA 3EN0A 1KSJA 4BTVA 1U7OA 1VCIA 2QRGA 1O8CA 2G08A 2VHJA 3BMQA 2AZ4A 2RHHA 3FF4A 3KZMA 2V7PA 1NI4B 5DRTA 4AJHA 1YFJA 3U49A 1UWLA 3CLVA 3P27A 1A9RA 2AZMA 3H2KA 4MUAA 1KORA 3L41A 1DT5A 5EJ5A 3ZWWA 1J0CA 4RGBA 2Z2IA 1ST3A 3U7GA 5BN5B 1AX9A 4LSZA 2LDBA 3CUKA 1QOQB 5GINE 5A3RA 5CFLA 1Y80A 5KU7A 2E9SA 2F4VB 4AJKA 4AYWA 3Q3GE 4D3DA 3V1LA 3MJ4A 3TFOA 1Y48E 3FBGA 1OFIA 3M1LA 5JSFA 1ZD8A 3U1BA 3GLGE 1ODTC 4IUDS 4C7OA 1IY8A 1CY1A 1JI3A 4HYQA 1N2SA 3LTEA 3PHJA 1TT5B 2A1TR 2SKCA 1KI4A 3OWXA 2XMRA 2DWUA 4ITVA 4NF2A 2JFUA 4Z9AA 1XZFA 3KKNA 2F3QA 2Q3FA 3BQMB 2Q5EA 4ND5A 5CP8A 4ZQGA 4ZEMA 5B1EA 3GAZA 5KU1A 2FSHA 2GD0A 2HWXA 3UNXA 5BSHA 1CF2O 2FFJA 3F46A 1V1RA 1CTQA 3M2PA 1E7YA 1EX1A 1G6Q1 5FEMA 2JI4A 2RGWA 2XAAA 2UV8A 4AUKA 1QFZA 2QXTA 3JYHA 2X2OA 3LHFA 2JGKA 3OFJA 3PUHA 2FR1A 4FI3C 3RG2A 5JMWA 1GARA 2XT6A 2F90A 1XDSA 1P7ZA 3P0HA 5I7VA 1G5HA 1ZVQA 2AN9A 1Z37A 2WD9A 4YRJA 4LRSB 1K8YB 3MWEB 4XYEA 1OAAA 4DDHA 1NRXA 2BHLA 3WYNA 2B1JA 3TK1A 5LQNA 2X42A 3G0DA 2JCSA 2DRIA 2NUBA 2AKAB 3BE4A 4MYUA 2GM5A 4BIIA 1O5OA 4JI4B 2H1RA 3FPHA 3H2YA 1JDNA 4LI3X 2GZMA 3GO4A 1I24A 4HRYA 1QQ6A 4S24A 4QQFA 3KZOA 4AECA 4ER3A 7YASA 3W5AA 2GNAA 3IOBA 4KAFA 1IMJA 2CLFB 3B7WA 3N0TA 1A9OA 2GJ8A 3A1DA 5ICMA 1OJLA 4YEDA 1GGVA 3PX3A 3OZUA 4Y98A 4AT1A 1TQ4A 1YHZA 4PFKA 5ELMA 2A5GA 4MW2A 2DQKA 2NU9B 4DV7B 2W11A 2KMLA 2WNIA 2DUWA 3LOQA 1S7CA 4DCSA 5ALOA 4OMDA 2CLEB 4PZPA 5FTLA 1J21A 3D6MA 4B9EA 3VISA 2AT1A 4PTZA 2XYHA 3AESA 4OP2A 4R8LA 5L3RA 1ADJA 5AP9A 3WAJA 4IDPA 1J70A 1I32A 2J1LA 1A4IA 1Z2OX 2GK7A 3E7DA 3GG2A 3TPZA 4ZDIA 2FPMA 3U6KA 1L1FA 1GR1A 3SU8A 2MMGA 3WB1A 2TRSB 2BF7A 1Q7RA 4JJFA 3UXMA 4KXMA 2HRRA 4X64B 4HEA1 4YAEA 5ALGA 1PL0A 1RWQA 3T8YA 1AQLA 4XR4A 2XXBA 4MWBA 1A7JA 2Z6VA 2ZTSA 3CLHA 1W4ZA 3RVNA 4ALKA 3PUJA 4BNVA 1ZHOA 4MV4A 4X0EA 4M0UA 3PT9A 4KKXB 2HMAA 2D0PB 3B9PA 3II6X 1OA1A 4YLGA 1UKZA 4HEA6 5K8JB 3B85A 1CUXA 2O8DB 3EVDA 1SQ0A 4GVXA 1WP4A 3EMDA 2K5UA 2IY9A 4OM7A 1R8YA 4NBLA 1XNJA 1MNAA 3D9QX 4J3JA 5FI1B 2CNWD 4O8CA 1UF9A 4AKEA 4RJTA 3EXHB 2ZB4A 3GN2A 1W0KD 1HNZB 2I3ZA 3F9IA 3LRXA 3JALA 1L3BA 1NVVQ 5TGZA 3UOGA 1U28A 1GLGA 2W6ID 3D7MA 4XB2A 1HFWA 4HCJA 2DETA 2QRJA 3CSUA 2RHGB 5TRTA 1B8VA 1NN3A 1W8IA 2FN7A 2PMCA 3GGOA 2G1PA 1D1SA 2PTGA 3MGCA 3UC5A 1ONNA 3HB9A 1YB5A 4UJ5A 4K03A 4NH0A 4YRRA 4ZAVA 2Q62A 1YO6A 4OHWA 1TGYA 5SZJA 3HJRA 2PKYX 3N76A 4RJKA 4BO4A 4GXRA 4YAKA 5ENVA 1Y6ZA 1NAIA 1TVKA 1X1RA 1J8YF 1DTEA 3DYBA 1PCXA 3OCUA 5DHFA 4DN6A 3GLGB 4KCGA 4PZAA 1OZAA 1P9WA 3TJRA 4JXXA 2VT6A 2WF5A 3MD9A 2QU8A 1T4MA 3IBSA 4ZPJA 3S99A 5JI2E 4CEJA 1VJRA 5B58T 1JF8A 1OUMA 1MQ9A 2BMVA 2O8NA 2HPVA 4OGKA 4RMGA 2LBPA 1Q7EA 1VL2A 2JRCA 1Q17A 2Z95A 3HCPA 2HK8A 3OEHD 4J03A 3OCJA 4M1ZA 3TFQA 2IH2A 2N42A 3VGPA 4TX1A 4HDKB 1DJPA 2JC3A 5EJAA 5BSTA 3T6KA 3TN7A 4C3VA 3GR6A 1CUEA 1LDEA 3UOAB 1GUFA 2PAFA 5BO5A 2ICAA 1UFRA 1NL3A 4ZA2A 2FPPA 2PBZA 1HLGA 1VSUA 5ETJA 2FJPA 5AVUA 3ZQKA 5C9ZA 4GHWA 3ITNA 5K0SA 3WO1A 5KKCA 2CDNA 1DO0A 2IEBA 2JFNA 3UKOA 1NZFA 1OLXA 5AKKA 1IXKA 4UDYX 3UB3A 5BNZA 4MHSA 3HVRA 3CX3A 3ND6A 4A23A 4PC6A 5JCJA 1L4FA 1WMEA 1U2QA 4G09A 3SJZA 5CG1A 1YQQA 2CHQA 3OMWA 4I1IA 1OMOA 2YWCA 5B1YA 2J0SA 1NBIA 4JLBA 1U5BA 3EK2A 4W5JA 2QL7A 2WHXA 3N8HA 4QUDA 4Z3OA 2P69A 3K0SA 2JGAA 1X7YA 3A1VA 3B48A 1ZM3A 4XZ3A 3GLFA 3LP8A 2X5KO 4FN4A 5J40A 4IRXA 6REQA 5LUAA 1IG3A 3C6KA 2YCBA 4BU1A 1DE0A 2F4NA 2X0NA 3N5CA 4HDRA 3PQFA 5EJ7A 3MWDB 1UDRA 2YASA 3MFYA 4LZWA 4D4LA 8AT1A 1W75A 1R6XA 4CMAA 5HIMA 4QPPA 3TRKA 4ZKDA 5KIAA 5JO9A 2PUAA 1Y63A 1Y89A 5C1BA 2OENG 3FZEA 2QVYX 5FOQA 1QONA 4BLOA 1ZU4A 1BHJA 4TXHA 1GRRA 4W5OA 2CYAA 2IWRA 1F0KA 3TO5A 1GUDA 4UTNA 4ZRMA 1Y3BE 4B5KA 1LA2A 3QJYA 5IZCC 2P8JA 4HKTA 1TECE 3S5JA 2IZOA 3CNQS 1ZJ6A 1EJ6A 4RAQA 4M0CA 4AJJA 3TECE 1JE0A 2J8ZA 4B46A 1QYRA 1Z2NX 3QMPA 4C0LA 1FLVA 2CFOA 1ESNA 3PWKA 3GRPA 3T99A 1SU8A 4JBWA 4I0WB 3H5LA 3NV9A 1C9DB 4G4SP 1G7TA 2GPYA 1QAMA 3KTDA 1OB5A 4XPIB 4FGZA 3B2NA 4DRYA 4X8LA 1DCTA 1J1UA 2PH7A 3EDQA 1GZ4A 2DJ5A 1NMEA 4ENTA 3DKPA 5M5BA 1AK2A 1DC7A 1KO7A 2PJZA 1HDIA 1A2KC 2JFBA 2YMLA 2DTEA 1CJBA 1DKNA 3GX1A 3Q0TA 3SSMA 2ZRMA 2WFZA 1IBRA 2P9QA 2M98A 3NGXA 3ZHOA 3CVXA 1R9MA 4LC0A 1JE1A 4QOJA 2N1BA 2OFWA 4AAYA 2DXIA 1BO6A 3S1AA 4G8BA 3LF2A 3JCZA 3AL2A 3PFGA 1LSUA 1T2DA 2ZT5A 1FX0A 1Y7IA 2QW0X 3FMVA 4KXNA 2RC6A 4ND2A 3FJ1A 4XCXA 4AXBA 5HX7A 4JXZA 3RH0A 4LNHA 2WJGA 3VYUB 1E1YA 1ZQ9A 3MNFA 3PA6A 5FIUA 3NYQA 2FB9A 2I55A 3MZ0A 3SJCA 3WLIA 5EJIA 2IIQA 1E2UA 2B20A 4FIDA 5HXAA 1Q0TA 2R8YA 2Z56A 1XTPA 5F4BA 3GU3A 4ZOBA 2PV0A 5K0NA 4IFBA 3A4NA 1BG6A 1NQAO 3OWHA 5EXEA 5ILOA 2GLUA 1X1TA 4WCDA 5HFAA 4R3UC 3QYAA 4O2BB 1H22A 2BISA 2GNPA 2PNFA 2EWVA 4M6WB 4W9NC 4RLQA 3QA9A 3U7FB 3DOCA 2C2BA 1R15A 1S2DA 1XTRA 3F6SA 4G0NA 4L7VA 1P0PA 1W581 4F3TA 4G26A 1OV6A 3HFJA 1X7HA 2QGZA 3D6VA 3ZJTA 2ONZA 2RGXA 4K86A 1CS0A 1XTKA 1Q1NA 1R0WA 1TT7A 1X1AA 1BS2A 2EZTA 1MJFA 3HI4A 1GTJ1 3PNQA 4FDTA 4MPJA 5E2AA 3RJZA 4XFKA 1MD9A 1USGA 2FP4A 1PJ4A 1Q2UA 2WV7A 1WRBA 2XPCA 3OI7A 2IOHA 3KU1A 1X77A 3AM3A 2UYGA 1U7TA 1VL6A 3NBXX 1D2RA 5KCMA 2VNIA 1E2QA 3CH6A 1DQSA 8OHMA 3HNRA 4M7OA 2VZLA 2PD3A 3B5IA 1SQ5A 1JDBB 2V8OA 1QIKA 1KI3A 3Q8WA 3ROEA 3U09A 2P67A 3KOWA 4D8YA 1RAEA 1UDXA 1XZIA 2HU7A 2R7LA 4WKOA 3X1DA 2G4VA 3VI3B 2IVFA 4GIBA 5KYGA 2R1TB 2XTZA 3GJ3A 1UMBB 4UNSA 1V16B 3KJQA 2DFDA 2VF2A 2XOKD 3FNBA 3GPBA 3O1JC 3NP9A 4FDVA 2ARKA 3S2EA 4WHMA 3WHLA 1G9XA 5KTMA 4FXOA 3KE8A 1L5FA 1K2WA 1Z3CA 3CMCO 3GJXC 4L3WA 5DMHA 1MUUA 3WYDA 4P3OA 2Q1XA 2GTIA 2IP4A 1KJ9A 1CQZA 4MDHA 1W0JD 4ITUA 2ZYSA 2J32A 4S1TA 4QAJA 3DZ8A 2DEUA 5DYNA 1WKBA 1YB4A 2IUFA 2LIPA 3CPEA 4RKWA 4IOJA 1N2CE 1H0KA 2VTVA 2ZQZA 4Z8XA 1P6XA 2I34A 1ECJA 4UOZA 5AJXA 2BH9A 2Q3EA 4H3SA 5AKZA 5HK8A 2OGTA 3IE0A 4U2BA 3R7WB 4M9SA 1J7KA 3U26A 4M0KA 4EATA 2ZTLA 4KR2A 1T0JB 3RR2A 2Q6LA 2W2OA 3BA1A 3LDUA 5AM1A 3RK1A 3UAGA 3V4RA 2B4KA 2V7QA 1TU3A 2IE8A 3NBAA 2I1LA 1RW4A 1TYBE 2JFZA 3FYUC 3G6KA 2NUPB 4L73A 4TKMA 1UEIA 2EZ8A 3NS7A 2XTJA 3DH0A 1I9CA 1NWHA 2CF5A 5HJ5A 2VDLB 2YV5A 1M8JA 3VC2A 3LHSA 1NW7A 2FPRA 3D02A 2Y1KA 2IVZA 3C6MA 5FBKA 7GPBA 2G5CA 3KTAB 3LQQA 4KUHA 3H9CA 3D7KA 4YS6A 3H0KA 2MDTA 2XUAA 5E6UB 2L42A 2ZWOA 2XLCA 3FFTA 1SEVA 3T9DA 3VDRA 1JG1A 1DO2A 2P2GA 3GT7A 3QLVC 4B6EA 1YB2A 4L5AA 3A6LA 4L5CA 4QYSA 4J0KA 4O08A 4P7FA 2PH5A 3BSYA 4K9OA 3LX8A 4R98A 2IXDA 1X87A 1POXA 3E7WA 1T29A 4UU0A 1QHHB 1XN1A 2INGX 4IGIA 3WV5A 2B69A 2FSVC 5C53B 4KFSA 2NU6B 1B6TA 2D7CA 4OLFA 3A6GA 2EJCA 1GZ7A 3OUTA 4WBNA 2YJ5A 1EJ2A 1XX6A 4I4LA 2XHZA 4Y3UA 4C0WA 3Q2IA 4P58A 1JIKA 3AEKA 4EFKA 4RTPA 1HQKA 2VZEA 4IJUA 9LDTA 2Y1GA 1A1VA 4IG4A 1XWIA 2OYRA 2YUIA 1KAEA 3LKBA 5FL7D 4EMSA 2P40A 2QRUA 2QRLA 3I2FA 3QEKA 1G21B 3H83A 2FEMA 3EYAA 4TT8A 1G2IA 3F74A 4TN5A 1RWNA 1A9TA 1R8QA 4FMDB 5CLLA 5DHPA 4RTNA 2TMDA 3O83A 3ESBA 2C9MA 2D5CA 3VPHA 3WIOA 4D6YA 3OT1A 3TZ6A 3EQZA 2W6JD 1DEXA 3V97A 5ILQA 3RJMA 1C7RA 1UR5A 5AXBA 3PNBA 2EJVA 1PDWA 2ODTX 3G9UA 2DMRA 1EU1A 3RFUA 3Q5EA 2V9ZA 3QIVA 5FH9A 5KI6A 2VK1A 5JW6A 2QX7A 3QVXA 2XCSB 1LFDB 3AT1A 4GWKA 2RJOA 5KS2A 4UTRA 1ATIA 1E5VA 2JAPA 3NUGA 4LNUB 4AK9A 4ZK6A 1M1NA 3ZIDA 2RC5A 3T4PA 5JEDA 1M7HA 2FHSA 2FKNA 5JDCC 2OCLA 1RNLA 1S3IA 4I6GA 2PU7A 5JS8A 3QUTA 4HNRA 1DV2A 1OW3B 4JR0A 5AKYA 3SQOA 2WD7A 3WYCA 2Y93A 2BI4A 5D1HA 2XKJE 2BMWA 3KT3A 1PKXA 1Y3DE 4GEGA 5BRNA 3S2GA 1QGAA 4TSFD 1T5BA 3BD9A 4D3ZA 3GBSA 1HR0B 1VSTA 2OV8A 3GJZA 3QPWA 3T1HB 2DLDA 3HACA 4P8RA 4HPXB 1H6BA 3AHHA 2VWPA 3GMSA 2WG0A 3JWHA 1COZA 2AJBA 1EBBA 1RI5A 1OHHA 3KVRA 1EAYA 3ZNOA 5KOYA 1XYGA 1S2LA 1C2YA 1KI9A 3IAHA 1RFGE 4FCCA 1Q2XA 1I30A 3LCRA 4CUKA 2OMEA 1PO7A 3NYWA 3F6RA 2OZLA 3RIHA 1WP9A 4QUEA 4B3RB 4WKCA 4JHXA 2RAVA 4A0GA 2ZDGA 3D3NA 4MB0A 1Z25A 1VIMA 2FMIA 3R5TA 3PQ7A 5DGIA 5I9BA 1YA8A 1QO7A 2B4QA 4RWEA 1BDHA 1Z7BA 1HT0A 3MGKA 4QTTB 2WTAA 5KWEA 3QUAA 4IJVA 5FL3A 5EHQA 2ZTUA 3OSUA 5KYWB 2HO5A 4GM4A 3UQYS 1FY2A 2Z5FA 3ZHZA 4GDFA 3H2SA 3ZK7A 3KWJA 3V2UA 2NVWA 3P0FA 5GTDA 3D0OA 1Y9AA 4RM2A 4UREA 3KJGA 2AV6A 4DFDA 2DHEA 1YIAA 3GZ4A 1QHGA 3ZJUA 1QHXA 2HYDA 3S27A 3ZDRA 2O50A 3KQTA 3FMGA 2O0LA 5EJ2A 4CEIB 2PGOA 2ILTA 2E1RA 2OLEA 4JGGA 1I7SB 2JIMA 3OA2A 5F98A 3RUAA 1KE2A 4NU5A 2JLXA 4ABTA 1GUYA 1JT2A 1KDTA 2V9CA 3QSGA 5EVCA 2YZGA 5FNVB 1I7LA 1NJGA 5L3SA 4INAA 3HR8A 3M4NA 1EGMB 1UM9A 1ZFNA 1L6IA 2J3JA 3WLMA 2CK3A 2I65A 3I64A 5IWCA 3W3AD 4O2AA 5EZ5A 2PSJA 2JEZA 5FWNA 3L7CA 3D59A 3IXQA 2JPDA 3AR9A 1P3JA 2ES4A 1C0LA 2W6MA 4N12A 5FFFA 2C5FA 1X13A 1P2VA 3CTPA 5ALKA 2PWAA 2GO1A 1NW3A 3KL2A 3P1JA 5B3AA 2QM7A 1YTLA 4PTLA 3G2PA 1QX3A 4YJDA 1YS1X 1PJBA 3PTZA 1I6LA 1XAJA 5A6SA 1LF5A 3TWOA 1MFZA 4AS3A 4DYHA 1CF4A 1NYRA 2I6XA 2QYSA 3SXJA 3TTVA 3IXLA 2J3IA 3I01M 4Q9JA 4I7EA 2O07A 3HDYA 1YVEI 4GX0A 4MW6A 5JSKA 2WB2A 4DSTA 1I5OA 5ICSA 4CI0B 2NQ2C 2PYIA 2ZBQA 3CUVA 5BWBA 3QITA 1QKKA 2PR7A 3P9QA 4BO9A 5ITZB 4EJFA 4POAA 1W44A 3KAPA 3MLAA 4IL5A 4R01A 1A1SA 1JFRA 5LN1A 2AC4A 2JIPA 2Q1TA 3AHDA 1JSZA 3X1MA 5HDBB 3AKDA 4JLUA 5IT0A 3HKBB 1ZLYA 3N70A 1N9GA 4NZNA 1ZN2A 1ZKMA 3FOCA 4OJYA 4TMXA 5T64A 5CRIA 1M76A 2CWWA 3BD6A 3U0VA 4GFDA 3UTDA 4QOIA 1NLFA 2Q3MA 1UL1X 2RHOA 4GOJA 1OQAA 1ORVA 2YY7A 3A6HA 3LE8A 4OKIA 2O23A 4PINA 5TC4A 4DRXB 4GOLD 2XUDA 4I5FA 4GX5A 3N75A 4KQ6A 4PR3A 4RSGA 3VKGA 3IIJA 1TYAE 2EU8A 1QH0A 2J85A 3MJDA 4CKBA 3ENZA 5AVKA 1R27A 2HN9A 1GPYA 2QM3A 3DBLA 4P4LA 3RRYA 3TCNA 2F8LA 4UTPA 1W88A 4URYR 2O6HA 2PCLA 4GI1A 2QR5A 5K6TA 1HH4A 2QRMA 4MDYA 4GI5A 1E20A 2HMSA 4WOBA 3VZPA 2JJ2D 3N8NA 4MIYA 3ZLBA 2WF8A 2QVBA 2E0IA 2DUUA 3OQHA 3CXUA 3W2TA 4WGGA 3KZXA 4BASA 1JALA 2RJNA 1POWA 1PJAA 2IZZA 2RHLA 4PE5B 2C07A 2VJQA 4X8HA 3Q3EA 1K4MA 2J0QA 1BWQA 2QRNA 4F1JA 1NHGA 5DULA 5KQSA 1RC8A 4MUBA 1FP4B 2YIDA 2I2CA 1EFVA 3JYQA 3ZZNA 5I7AA 2W83A 5JAOA 2OMKA 4B17A 4EHIA 1C81A 2GK4A 5DSTA 3IVRA 1IEWA 3AY3A 3ED5A 3KIPA 3L6DA 3NJ8A 4FYHA 4L4UA 4GPEA 2JLBA 2YWJA 3WC4A 4TV8B 5DF1A 2A92A 4JP3A 3U48A 4F7DA 5J23A 2ZIXB 3IOYA 3OPNA 4NZZA 1N2JA 2BFFB 3WHIA 3GL9A 1QVZA 1OBCA 4DL9A 1S4MA 1HURA 2P4SA 4BVEA 3FTFA 1H8HD 2UUOA 4JQSA 3SC2A 4CQMB 1GILA 3ISTA 3LD9A 2Q21A 3MVEA 3BRQA 1Q6ZA 1YAJA 3AF2A 3C1OA 3EPJA 3KV3O 4EO4A 5LZ2A 2XB8A 2ZRBA 1CIJA 3IQIX 3NDRA 2JAHA 2C00A 2MYNA 4NLLA 5JVDA 2YZ2A 3NPAA 5IK2A 2NVUB 3VTFA 1ELOA 1EVEA 1R4MA 4JBGA 1RQ7A 2FFHA 1R3DA 3JZIA 2UZIR 2WPNA 4D26A 4N03A 2ERCA 4L85A 3T95A 4BVAA 2XZOA 1OZ0A 4Q93A 1DRKA 3TRJA 3PK0A 4FSHA 4BX9A 3BTVA 2PUCA 3TNDA 4U2KA 5TEWA 1IY0A 4G1VA 4LYFA 2LZ0A 4ENRA 4ZYVA 2AG8A 2WOOA 2QD3A 4F4FA 5K6RA 4DV2B 1BW9B 3VX3A 2IYZA 3BJRA 3UAYA 3KVYA 1ULUA 4EJ6A 3EAQA 1WLSA 2O8FB 4LRWA 2BCGY 2NTEA 2QTZA 1WQ3A 3GLKA 3HLYA 3LPNA 4FZJA 4J1TA 2YXBA 1W73A 4HATA 4XTCS 3TM5A 3VC7A 1QRTA 1KVQA 2FPGB 1M0EA 5LKRA 3EVEA 4NNOA 4KE8A 1G5TA 1XG5A 4YUVA 4R81A 3OIYA 3U7QA 2BF4A 4MRRA 3O8OB 2YXNA 2B4YA 1Q0SA 3TKLA 5DHAA 1EUZA 4DA7A 2XDAA 1RZ3A 3KKPA 3QPVA 4CCYA 3FNGA 3O84A 1QB7A 5I9NA 4ZQBA 3RSHA 4BAUA 4QUIA 4YWJA 5JJ5A 5HIIA 1XP5A 3WQRA 4L51A 2GXQA 4XGNA 1UJ5A 3A9RA 3WIDA 4TKUB 3MQ4A 2PQ0A 3H4MA 3L04A 4MZDA 4R7ZA 4PV7A 2UVDA 5THQA 2RGNA 5JANA 3FDZB 2V5VA 2JGMA 3WNDA 1Z33A 2Q2NA 2Y6VA 3ZV4A 3BMCB 2FF5A 2R6GA 3KKZA 2CSUA 1R7RA 2AVNA 2BLNA 1IN4A 3DEHA 3OWOA 3HEMA 4JBYA 3IEUA 2NO0A 3UH0A 4PS1A 3UM9A 3HJNA 2CMHA 3T3GA 1O97C 4KOEC 2EFGA 2PT9A 5A4JA 1T5LA 2Q5QA 4WY2A 1U9CA 4BIMA 3PUIA 4MV9A 1NKVA 3EUWA 3T7DA 1H65A 4KACA 3EMVA 3KSAC 1UJNA 4OK5A 1LVUA 2EWMA 3BHIA 2LGJA 3JAKA 4FC6A 1AQJA 3LM8A 2RCNA 1MH9A 1Y4SA 4U3JA 4E33A 5JAIA 1N0HA 1LFAA 2WTUA 2PVPA 3G8CA 1V8PA 4OI2A 5LQCA 3BJIC 4AO6A 3WQQA 1MB2A 4A6DA 2BHNA 4PZ9A 3PZRA 1JBKA 2PLRA 3JVEA 4MV1A 3EXIB 3ZXSA 1WAMA 2YTZA 3DP7A 3LWBA 4KQGA 4ZI5A 1RRFA 1BX0A 4RXMA 1J39A 2RBKA 4M99A 2KQUA 1IL0A 1AS2A 1P91A 2IYWA 4D7AA 2QRQA 1EE1A 1IHPA 5FTKA 3RT7A 3H2IA 4EMTA 3E3NA 2DFPA 3VR0A 2DQSA 3R3HA 4OSEA 3U3JA 2OXFA 4LV5B 1RYHA 3HKEA 1EXWA 1VBKA 4Y2VA 1VCMA 4XX0A 2C5BA 1CRZA 1T9KA 2H51A 4FQ5A 4OBWA 1NR7A 2ZIVB 2GWRA 4LCEA 4Q6WA 4K87A 1CT9A 4RSMA 4WX2B 1E0KA 3SHTA 2PXCA 1FZTA 2BM1A 2W9XA 1N36B 2BR5A 2BTEA 1XQVA 3D4PA 5E7QA 4ZYUA 3MS7A 1Y1PA 1PV4A 4J1TC 1OGIA 3FCEA 5AI5A 3NGMA 1MQAA 1LBQA 4LQCA 3GVXA 4NYJQ 4Q3NA 4P0PB 3EXAA 3A9VA 5CJJA 1M75A 1NXVA 1Z75A 2ZKLA 3AU9A 3EZNA 2H8KA 4Y9SA 4PEVA 3KYCA 1X1SA 4OCZA 5A9TA 4DJ5X 1FYWA 3DR5A 4FUQA 1QDUA 3MIZA 3OZXA 3REFA 1NQTA 1ODSA 1NI3A 4PGGA 1TC1A 1YR8A 3W4JA 3WV4A 3GIWA 4BV3A 1GTSA 1B8OA 1GTG1 4NYIQ 3L5OA 4I8DA 2BDTA 3K8OE 2YHAA 4JNKA 4O4JA 4QOHA 1S1CA 3IBYA 2OV2A 3MT9A 1PR2A 1OWMA 3JSXA 3L7IA 3S2FA 4DE5A 3SIXA 5K0CA 1ZJZA 2YQ4A 4K81B 3I4CA 3KQQA 1L7PA 4NY1A 3VUEA 4YQZA 3SEQA 1Y8RA 4R8KA 3GEEA 1K7YA 3HUDA 4Q16A 4EVSA 4QQRA 3K0AB 2AFRA 1JG2A 1PR9A 4NU8X 4H60A 3WLQA 2Z43A 3QVLA 1KZ7B 3GJTA 5H9WA 4TGLA 1ZX1A 4WE3A 5JV5A 1SH7A 1DC3A 1EFLA 4I4IA 4J49A 4U9UA 5CJ2A 3GLIE 3BFJA 3QG1A 4RABA 4UMEA 4KI7A 2X3FA 5EJ9A 2VI5A 3EA4A 1HORA 4HSGA 4MHOA 4RV9A 4A9AA 1G291 2DOKA 1N5IA 2Y6UA 1CG6A 3BWMA 3FCUB 3GA7A 2RIRA 4LMAA 5JSYA 4RTLA 3L0YA 4PLVA 4DY6A 1T35A 4MRMA 4NYMR 2RGEA 5E4FA 2NO6A 1SCJA 2IT1A 1L9KA 1I6KA 1W29A 2FJUA 3C3EA 3CRMA 2O1SA 1RXCA 2Z58A 3O8DA 1WU7A 1KZ4A 2P3OA 4LRUA 3C7KA 2ZJ6A 1T4CA 2HMYB 4EUKA 4IKEA 4IIJA 3Q8MA 4CTKA 3DMPA 1PL7A 4M2LA 2B7LA 2HLDA 4WN9B 4F2WA 3EVCA 1FNCA 4HDSB 1SB9A 3UYLA 4XKJA 2C03A 4MLCA 3DQQA 1G3UA 2QOEA 4K3VA 1C4KA 2VR1A 2C5GA 2ZRQA 5KOJB 1VDZA 4V0SA 5GMOA 5E2BA 2YFHA 3ADDA 5F2NA 5HTKA 4UHEA 1TD1A 4W1SA 4MMYB 1ZGZA 1LBIA 1P1IA 1XRNA 4COOA 2AWNA 1GKIA 1Z73A 4H9GA 2X6TA 5ESRA 1FOEB 3GEPA 1GAQA 1TK2A 2BMJA 2AEMA 4KXWA 2G9QA 5GP1A 4WXRA 4PQRA 4TRJA 4JC8A 1F1BA 4YASA 3HJTA 3TYXA 4R9NA 3DKVA 3HYNA 3TQCA 1H6CA 2IHKA 5FBZA 3NC4A 1TCBA 1RR6A 1I2CA 4UNQA 1KZ1A 4TWRA 1PVOA 1WVGA 2P90A 3GVIA 1W85B 1ECCA 1YL5A 2I6SA 1VJDA 2VH1A 3KKQA 4Q9DA 4G4JA 1YUMA 2C0PA 1EDBA 1QDLB 2GZHA 2XCIA 4PIVA 3V4ZA 1IXRC 1FQWA 4HUQA 4HVTA 1OIVA 2FI1A 1WPRA 2YN0A 2A9FA 2HNAA 3C4QA 3N6XA 3ND8A 3AVXA 1ISPA 1O6CA 4CMKA 1U9IC 4COKA 4EB6B 4ZMBA 5EHGA 1CUFA 1PNOA 3P9ZA 2GD6A 3OLXA 3P20A 1MAHA 4MEJA 5BWNA 1RYNA 4FCVA 4HZGA 3PEYA 1W5EA 4JKYA 4J4BA 4Q9NA 3K9CA 4UC0A 4ARBA 4Q24A 5JC8A 2GPWA 5L3ZA 1RZRD 3G5MA 4GOND 1AUQA 4LV8B 4CTNA 1ZJYA 4MRVA 4NFLA 3GBPA 1J5PA 4B81A 1JHOA 1UK6A 3N6VA 4JA2A 3WGOA 1JMVA 3H5AA 3K1ZA 1WUYA 4YVFA 3PNLA 4DQVA 5J1TB 4F5YA 1C8VB 1FRZA 1Y3CE 3I32A 5LXTB 2PUTA 2CYCA 3VAAA 4IGEA 2YRFA 3P2IA 3SM9A 3PR3A 3DMGA 2V1UA 1IE3A 4MZXA 4AB1A 1NJSA 2XODA 3FHTA 4IPTA 2R8ZA 3L0OA 4MS3B 4YAWA 3F47A 4MLDA 2NIPA 5TSDA 4XWGA 4ZOEA 8LDHA 4FT4A 5H83A 1FMTA 1PWYE 4QO8A 1SB8A 1G7RA 3C41J 3CRQA 3H9GA 3W5JA 4XH9B 3V9PA 1A97A 1ULAA 3RNLA 4GVLA 4HJXA 3AIMA 2C7GA 4CZ2A 1LX7A 1HFJA 5F76A 5B1DA 5CA0A 2GEJA 1NPYA 1E2KA 1WF3A 4C7JA 1O95A 3P9PA 2OHXA 3D6NB 1MV5A 2XBMA 4E2XA 2OXIA 4Q15A 3OQMA 4QDKA 5I3ZA 1ZSYA 3COWA 2BMAA 1HSZA 1QCZA 4RVGA 4Y1EA 1TZ2A 2VHZA 2L17A 5D1NA 4B8WA 3ENWA 3GLIB 2J3KA 3ZCSA 1VIYA 2GEBA 2YOFA 3KJNA 3T1YB 1HWYA 3NI2A 4KTTE 4ID9A 1XQ6A 3UT0A 4E03A 3KKLA 1Z17A 3OX2A 3TLGA 3HY6A 3G9XA 4B33A 3Q7RA 1XDUA 3KUCA 2K2QB 1AO3A 3WGQA 1U3DA 2BR3A 2HPAA 1K3TA 5C35A 2OG1A 2PIAA 4JI6B 4C08A 5JNVA 3QWHA 2Q8PA 3ZZ1A 4ZPXA 2QL6A 3WG9A 1LD3A 1RPAA 1BDMA 4MAFA 4GGPA 2FDCA 3KJHA 4MUKA 2DCUA 1C0IA 1D2HA 1RHQA 5TLSA 2ADMA 3S8MA 3R7SA 3KE9A 5LLSA 1W87A 1HXHA 6ADHA 3LY5A 1U9YA 1FFXB 1VJTA 4WFJA 4O1HA 2VSYA 4ZEWA 1NSYA 3STYA 4C7MA 1MAVA 3UG7A 5EXTA 2PZMA 1Y82A 1NVUQ 2POCA 2W2XA 4IMPA 1JXAA 4CTJA 4MQEB 1JG6A 2ZWAA 3BBLA 4PFJA 2ZB8A 2O3JA 3EFBA 4H7HA 5L51A 3KXDA 4OL9A 3RS4A 3HP1A 1ZMTA 2NAPA 3PXXA 2OAEA 3COYA 4KR3A 3MERA 4DMKA 4UUBA 1MX3A 4G0UA 2YBEA 3IO3A 2AFHE 1RM4A 4DLKA 4Q1BA 3V6LA 4Q4LA 3N6RA 5EXSA 4XUDA 1JIXA 5DNVA 1PVVA 3I4LA 3V8BA 3L1HA 5IVKA 1VZ2A 4XJTA 1ARZA 3EIXA 1EBUA 2GUWA 4ND8B 1QQTA 4O0LA 1EWQA 2BFCB 4K88A 4Q9KA 2JD0A 2RI0A 2X3YA 4EARA 1UWVA 1VA5A 1P1FA 1V5FA 2Y92A 1Y8QA 1OH7A 3IQXA 4FFBA 1FQJA 1JVNA 1I7NA 1Z0UA 1BHQ1 4XD7A 4JLSA 1UJCA 1WXQA 2QGFA 3GAAA 3KFXA 5HCNA 5DBEX 4F97A 1N92A 3KDPA 2Y05A 4NE2A 3WRYA 2GF0A 1KA9H 3SE7A 2WVAA 1Q57A 2VTBA 1KVSA 1VG9B 3A10A 4MKIA 1CDDA 2VRCA 4EVIA 1DAIA 1DG3A 2QE7A 1O95C 2ZBEA 4LIPD 4DA6A 2Q41A 4TMZA 3MCTA 3SM3A 2ZKIA 1TCCA 1BWSA 1J2UA 2PWBA 2WF7A 4GOXA 2Y1FA 4IHJB 3WQSB 4PHFA 5DBOA 3VTZA 4DLBA 4BLVA 3HDTA 2I1QA 1OVMA 3WL5A 4BJ5A 1Q16A 1KJIA 1PGJA 1MO4A 3WWCA 3WSWA 2FEKA 2QA5A 1XWFA 3D7NA 9ATCA 1ZW1A 5EGNA 3E3MA 4LTMA 3WQBA 4PYRA 1Z6XA 3QELB 1AJEA 2GZRA 4ZQHA 3C5WP 3EDYA 1JU4A 4XCQA 2A1TS 3RTCA 4JOBA 4QLAA 3RYHA 1EUDB 1KFKB 2FX5A 2BTQB 3LX4A 1R6VA 4V1CB 4OD0A 2EOAA 1WCIA 2A59A 2R6HA 4UFOA 1BU8A 2B36A 3IPCA 2X9LA 3SF8A 1IH8A 1MO3A 1UXGA 4Y6OA 3FYDA 1MR3F 1UP4A 1GA6A 1SD2A 3QFHA 4RF5A 4C07A 3JQ8A 1CB7A 1M2GA 1I5RA 3ISJA 4BO7A 5A06A 5KYXA 4OXQA 4P82A 4N0EA 5HF8A 4CU5A 3OTWA 1EWVA 1X7XA 4MAAA 3O3CA 4KAJA 1NBOA 3BJMA 4L0DA 3VMMA 1UT6A 2PHZA 2PX3A 4ZVMA 2FYTA 1E3SA 3KSBC 1SK8A 1GG9A 4NQRA 2OECA 3G0BA 1PJSA 3FRJA 3N0XA 2DF8A 4GPAA 3ROGA 4ER7A 1DIAA 3OPXA 3JD0A 3ELUA 4HLNA 3H1AA 1F8FA 3GQBB 1UZNA 2RGCA 4Q66C 3GMTA 5P21A 5AHXA 3CCFA 3QU7A 4OHKA 3E7PA 4CLXA 2UZ1A 1I6MA 3ZI4A 4E12A 1A88A 3OMLA 1DJOA 1GPMA 1JHMA 3D4NA 2HA7A 3UGQA 5JXWA 1V2HE 1E0DA 4YRPA 2ZRHA 1GO2A 4RFVA 2NYAA 4NFHA 3NIFB 5PNTA 5FHQA 2D62A 3WZ2A 4Z4HA 4G0OA 4FOOA 2VP9A 1FDWA 2FR8A 4MR8B 4RVOA 4JROA 4CMBA 1W49A 2V7EA 3F3YA 4ZVKA 5A4MS 2CXXA 3VR5H 1ZUNB 2BGGA 2J4DA 1W34A 2WYVA 4PYNA 3WJAA 4FFLA 2P9YA 3THWA 3HKDA 4GICA 4FC7A 3EWIA 4BNGA 5JJIA 4AZSA 5F52A 3X44A 4RWZA 4U7TB 1Z06A 2PUVA 4JVNA 2MINB 2K7ZA 4OQ4A 3TIGA 4ZANA 3Q1KA 4Y2QA 2CHVA 4I4NA 4YJ2B 1XPJA 4KN5A 4PRKA 2OD9A 4K1LA 3WRYC 4AP6A 3LO8A 1CDEA 4DDWA 4IP0A 3T1QA 4KXUA 4CIVA 5EERA 2QF7A 2VWQA 2DHRA 3GHHA 1U5AA 2AFHB 3ITEA 2CXHA 1VE3A 3ADKA 3M9WA 1DKLA 3R0JA 1XC7A 5A9SB 1Q0LA 1VIAA 4LSGA 1HM5A 4YCBA 1PWXA 3U60B 4PO3X 4ANFA 3W6PA 1T2CA 1QU2A 4IH4A 4KYIB 2ZW9A 1AKRA 1VLMA 4F4DA 1UXJA 1H2YA 4BVLA 3O4FA 4G89A 3VKFA 4MVXA 1KY5A 3FROA 3ET5A 1BKDR 2QW1A 4E5SA 5FQNA 3TSZA 1JNYA 4RIGA 1KOJA 3GCGA 4I9UA 2FH5B 2V0CA 4N54A 2WVJA 3O4JA 2O7SA 3EWNA 3I4FA 3GVCA 1JV2B 2YXPX 3PNSA 3ZX4A 5IPFA 4BGVA 4DILA 3A9UA 1GZVA 5J5AA 2JBAB 5CFOA 5JAHA 2IU6A 1C0PA 2CUKA 1F17A 2PXAA 2PZEA 3F8TA 2AK3A 2VBGA 4A5OA 1L5HB 2REQA 2D0IA 3ZDFA 5J4LA 2HT1A 1THMA 2I3BA 3UK6A 3WKBA 1JIUA 1X42A 1NF3A 1DBRA 1V5GA 3AHFA 1YNSA 1ZZGA 2B78A 5ESXA 5JLAA 5C7LO 4YRFA 3OOEA 2AN3A 1W52X 4AW9A 3IIKA 3R6WA 3QUBA 2YZKA 1X7ZB 1U4SA 2GPAA 1UXHA 4GC5A 4CWAA 1HE4A 4TLMB 1EPUA 4BFUA 3CJQA 3AEYA 5FBHA 3ZWCA 4GZ3A 4B32A 1T43A 3TLKA 2IEIA 1F2VA 1PT6A 1UXKA 3DDOA 2GZ3A 3L84A 3Q6NA 4I2NA 4FFWA 2HIGA 1J9EA 3RASA 3GJQA 1HSOA 3INNA 4W5TA 1DB3A 2XQIA 1E9CA 4YP0A 1BYIA 4GMDA 4W6QA 4B3BA 4K6HA 4KAXA 1CERA 3JS5A 5KYKA 4M8NE 3B1WA 1I1NA 5CGQB 2RB4A 4MQLA 2OORA 4DZTA 3SQXA 3BGDA 3G8DA 3OZ7A 1X94A 4IMJB 1KP3A 4EF6A 3KQKA 2X2FA 3AETB 3FWPA 2RK6A 3VTKA 2TSYB 5TB5A 5KINB 2Y68A 3CH5A 4JJZA 4P33A 1RLIA 2W71A 1XPRA 3MLEA 2OESA 5AJYA 3MRXA 3DEFA 1UBMS 1I2BA 2FLWA 4X1IB 4JD5A 5AYVA 3NFYA 3PGMA 4RZSA 3WLOA 4R1UA 3L77A 1RJ9B 1NQOA 1YJ5A 3GDWA 2OHVA 4GPBA 4LZPA 1Z4KA 3LT1A 2CL7X 4ES6A 3GPLA 4G5GA 4G1EB 4E1AA 1RZUA 1SUAA 5LP6C 4BJ1A 3WGHA 3QI2A 3PSHA 1QQ7A 2C5AA 4M0DA 1TM7E 2DBRA 3RU9A 3ADBA 4O4IB 3RARA 4AURA 4I81A 4PWZA 4E46A 3SD7A 5C81A 2R1ZA 2MWMA 3C3JA 1RHMA 2FQYA 4QPDA 3BGIA 5D3MB 3U9LA 1NOKA 4N47A 4ZZ1A 5DISB 4MKRA 2RHCA 4WPGA 3E9DA 4FEEA 3KVNA 1W5SA 4ZYWA 1MIOB 3MPUA 1B8UA 5DV9A 3ZTTA 4DCUA 4R7TA 1TEXA 3PXDA 1FF9A 1TADA 1N8NA 1GCUA 1MO6A 4ZT4A 3V9AA 3ZDQA 1K0UA 1B73A 2D1FA 1GUBA 3GP3A 5L3QB 2ZYIA 4AS1A 2YICA 2MSNA 4R4JA 5DT2A 5BWOA 1ZJJA 2CXQA 3STWA 4R8VA 3TRIA 1L7EA 3CW2A 3KKEA 2H0QA 2PMKA 3HO8A 3ZR4B 4U7DA 4G85A 2QNIA 5DE3A 1Z18A 4JU9A 3BREA 4W63A 5FT9A 2C4TA 5HKKD 1BXRB 1MX5A 1Z9BA 5K8VA 2O4UX 3SJBA 4O4HA 4HYYA 1G55A 1YBMA 4CF7A 4WESA 2PR2A 1PRYA 4P36A 2PWYA 3B53X 5F3WB 1E7WA 2YRXA 2VSFA 1GZ3A 5DNEA 1Z0AA 2Z8YA 5G4KB 4Q19A 4OQDA 3C70A 3MG9A 1VG8A 2WM8A 5BN1A 5HWSA 1JEYA 3WP0A 2HTFA 3PUKA 4GKAA 1SZDA 1EEXB 2IYAA 3CWZA 3IEVA 4MJXA 2ECKA 4F1WA 1Y6RA 4Z1OA 5T3UA 2RAPA 4CF3A 4U02A 1OX4A 2M1ZA 4ZO9A 1HMYA 2B0JA 4B44A 1PJ8A 5CXSA 2I78A 2A1IA 4NESA 4D3XA 2CNBA 2BGIA 1N7HA 1Y1RA 3CUEF 1R66A 1V0JA 2FRXA 3PCXA 4UU8A 4BRZA 5EHXA 3HTXA 3R5FA 4DM3A 2OORC 2EF1A 2R86A 2BKXA 4BBAA 2FGJA 2E18A 4LJ4A 4OAQA 4OSOA 4RIIA 3PYMA 4QKQA 3Q8KA 1UBUS 1CLEA 4GE0A 3QMMA 2QY9A 4ITRC 4ILEA 1KERA 4DNFA 4FCWA 3R3ZA 3OJLA 2CNWA 2FZVA 4LC1A 3NW9A 4RV5A 5A0FA 5C8VA 3HWX1 3Q40A 1VKRA 3EFHA 3IXMA 1XK7A 4HDNA 1W0KA 1U7ZA 1OH8A 3NQ41 2IUYA 2FUNB 2VFAA 1ZD2P 2WJPA 2GJKA 2QT0A 1KO1A 2W6IA 3HJCA 4A0SA 3K9FC 4KUEA 5EQDA 1L4NA 2QQ5A 1SCUA 1TQ2A 3GPDG 2AH5A 3S2IA 4L50A 4JI8B 1HZZA 3GFBA 1P2TA 4MS1A 5LZ4A 1W2GA 5I6DA 5DYWA 4WNAA 5LUBA 3RC7A 4OATA 4EDFA 4YV2A 4NZOA 1O6GA 2P3LA 4AJ4A 3G9QA 2Q6TA 3P9NA 4P54A 3BK7A 1N5DA 5D87A 3EZGA 1IBMB 1LSSA 3ZE8A 1VHTA 3D3QA 2VPYA 3LX5A 3QTTA 4DARA 1BCRB 2WUDA 4IV8A 4JLJA 1D2NA 4LGCA 1U7DA 1VHQA 3OE1A 2JFQA 1XEWY 2HD4A 4YMTA 3UMVA 2SNIE 3C0KA 3QPBA 5LBUA 4WZBA 3LWNA 2BGMA 3IULA 5BOSA 4IM7A 1EWYA 1Q7TA 2A0UA 3EBOA 3EHEA 4R3WA 3L7KA 1YUNA 3OEHA 2OP0A 4J9UE 3OVMA 4G01B 3ZOKA 2DFLA 4AO7A 4CUJA 4OLBA 1U1DA 3E03A 2NZVG 4LXUA 2ATCA 3CE9A 3HZOA 4Q3BA 3TW8B 5AK4A 1R4NA 1ORRA 4FDAA 4I2VA 1XMOB 1JXOA 3FTDA 4RJIA 4G0MA 1KDRA 2GBGA 3USZA 5JH7F 1N4DA 2JZNA 2DWPA 3DE7X 2W6PA 1U3TA 3JQ7A 1H2WA 4I5GA 3NPMA 4MGYR 5CH8A 5LYYA 3ORYA 4TWZA 4GSLA 5KCZA 1V3VA 1M5TA 3IP5A 1F2TB 3KJEA 3J7AC 1XV5A 4G0WA 5LYJB 1R0XA 1UFKA 3UMRA 5DTRA 721PA 5IM4F 3D31A 1V1MB 1FLAA 1FUIA 1X6VA 2DBYA 4V0KA 3RVSA 2X14A 3RNOA 5FX2A 3AV3A 3IEPA 3HWWA 3MBOA 1CUJA 1SXIA 5DIZA 4FFSA 1R6TA 3HFRA 4WMLA 3GGSA 4EZIA 4HEJA 4DT1A 4IOMA 1AMUA 2AFVA 5BSUA 1BQ3A 3C3YA 5EHIA 2GN1A 4LJYA 5LCXA 4II3A 5FWYA 4L1KA 2NU8B 5KJ1A 3MB8A 1XRRA 1UFQA 1I4LD 1DQPA 2B4AA 4B2PA 1J00A 1FVFA 3WWYA 1IPHA 2F3TA 3ZE7A 5IJ9A 1P2DA 5ILGA 1U7UA 5GY7A 2A30A 3AVQA 2X8JA 3ESQA 1K66A 3QNWA 3WL8A 3IBFA 3ID6C 3KHUA 4REQB 3IHLA 3OQIB 4PZZA 2EJTA 3RBXA 3DWEX 1PZXA 3ZQJA 5LOVB 1AHNA 4HNAA 4I8XA 3LQYA 5H3HA 5CB4B 3NTXA 4U7HA 3DLPX 1LTQA 1OLUA 3FHJA 2F59A 4CM3A 1FU4A 3G5AA 4QAQA 4Q47A 5BT9A 5GIPE 16PKA 3G17A 3MIIA 2OY0A 4TTPA 4J90A 3VOTA 4ZEOA 5ELXA 3LQFA 4H7DA 5E7JA 1C2TA 1CCWA 2C2GA 2GX6A 3CX7A 3DO6A 3K92A 4OU4A 4QTUB 5LZ8A 4ESHA 2AG5A 3QHQA 1L7NA 3D8NA 1PR0A 5J47A