The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
155
|
structure length |
155
|
Chain Sequence |
SKIALFDQTLIASLLQPLSLNQPDFKAYKTKVKLKISEQRNETSGEKELKFEISRSDDFEFLFSETLNNEKYQILARDHDLTVDFDAFPKVIIQHLLCKNTEINIILDAEKNFCSFELFSGKIFSIKLHAVRGDHLISHLLKICSSQAVKLSTFY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Structural protein
|
| molecule keywords |
Spindle assembly abnormal protein 6
|
| publication title |
Caenorhabditis elegans centriolar protein SAS-6 forms a spiral that is consistent with imparting a ninefold symmetry.
pubmed doi rcsb |
| source organism |
Caenorhabditis elegans
|
| total genus |
35
|
| structure length |
155
|
| sequence length |
155
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2012-08-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF16531 | SAS-6_N | Centriolar protein SAS N-terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Dna Repair Protein Xrcc4; Chain: A, domain 1 | Dna Repair Protein Xrcc4; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 4GEU A; 4GFC A; 3PYI A; 3Q0X A; 3Q0Y A; 4CKN A; 4CKM A; 4GFA A; 4CKP A; 2Y3V A; 4GEX A; 4G79 A; 2Y3W A; #chains in the Genus database with same CATH topology 3SR2 C; 4GFC A; 3PYI A; 4GFA A; 4CKP A; 3RWR D; 1FU1 A; 4XA4 A; 3RWR A; 2R9A A; 2Y3W A; 2Y3V A; 5CJ4 A; 1IK9 A; 3MUD A; 4GEU A; 3II6 A; 3Q0X A; 3Q0Y A; 4CKN A; 3SR2 A; 4GEX A; 4G79 A; 4CKM A; 5CJ0 A; 5CHX A; 2QM4 A; #chains in the Genus database with same CATH homology 4GEU A; 4GFC A; 3PYI A; 3Q0X A; 3Q0Y A; 4CKN A; 4CKM A; 4GFA A; 4CKP A; 2Y3V A; 4GEX A; 4G79 A; 2Y3W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
