4GFKA

Structures of no factors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
184
Chain Sequence
b'NRREEILQALAEMLESNITTAKLAKQVGVSEAALYRHFPSKTRMFEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAERNPGLTRILSGHALMFENERLRDRINQLFERIETSLRQILRERKLREGKSFPVDENILAAQLLGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoid occlusion factor SlmA
molecule tags Dna binding protein
source organism Vibrio cholerae o1 biovar el tor
publication title SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
pubmed doi rcsb
total genus 75
structure length 184
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4gfkA00
5J1YA 5HAWA 2XB5A 4M3GA 3SDGA 3NI7A 1SGMA 5HSZA 5J1UA 5F27A 2QIBA 5GPCA 3COLA 5GPAA 3PM1A 3KKCA 2V57A 2OPTA 2NX4A 5FKNA 3VVZA 2G7SA 2GFNA 3QPSA 3T6NA 3BQZA 3G1MA 3LOCA 2ZCMA 5K58A 3BRUA 3BHQA 2G7GA 2X6OA 3NXCA 3PPBA 4V2FA 3QBMA 3V78A 3IH4A 4JKZA 2IEKA 5EFYA 2XPVA 3PASA 4CGRA 2IBDA 3HGYA 3RH2A 3VVXA 4M3DA 2F07A 2ZB9A 1JUSA 4V2GA 3BJBA 4M3EA 4JYKA 5EZHA 2O7TA 1RPWA 3KZ9A 2DG8A 2TCTA 3SFIA 5DAJA 4GFKA 4NN1A 3LHQA 3HTJA 2Q24A 2XGEA 5C4YA 5CW8A 2NS8A 2O7OA 3EUPA 2FJ1A 2UXHA 3BCGA 4I76A 5F0FA 1JTXA 5HBUA 3HGGA 3KKDA 5CXGA 3TP3A 3GEUA 3QPLA 3FIWA 4KWAA 2IU5A 2WV1A 4YZEA 5CXIA 3CWRA 5FKOA 3VOXA 5FKLA 5EYRA 3O8HA 3BR6A 5F0CA 3DPJA 3LJLA 2QOPA 3B81A 2YVHA 4X1EA 3HTHA 3ZQLA 3F1BA 3KNWA 3Q0VA 2RASA 2UXUA 1BJZA 2RAEA 4D7MA 5IOZA 4HKUA 4D5FA 3B6CA 3CDLA 3CJDA 3VPRA 3ANGA 2GUHA 4ACIA 3G1OA 4JNNA 2NP3A 2HYJA 2ZOYA 3BR1A 4GCLA 5F08A 3VP5A 4G12A 2ZOZA 4ME9A 3BNIA 2FX0A 5J1RA 3NRGA 4DW6A 3B6AA 3JSJA 1ORKA 2GENA 5FMPA 2X9DA 5IPAA 3ZQFA 3RD3A 2Y2ZA 2UXOA 1QVTA 3BR3A 1Z77A 3Q3SA 2REKA 2VKEA 4AC0A 1RKWA 3Q0WA 4GCTA 2DG7A 3WHBA 1JT0A 2EH3A 3BT9A 2JK3A 2GBYA 2D6YA 5FGLA 4AF5A 4B1RA 3BR2A 4ABZA 3HTIA 4PXIA 1VI0A 3IH3A 3CRJA 2PZ9A 4MXMA 2QKOA 3BTCA 4W1UA 5D1RA 2QTQA 2Y31A 3TP0A 3BTJA 2FQ4A 3ON2A 3FK7A 4GFLA 1JT6A 1U9OA 3O60A 3VW2A 2G7LA 2ZCXA 3C07A 3FK6A 2UXIA 2XPWA 5D18A 1T56A 3EGQA 3P9TA 4B3AA 1RKTA 2PBXA 2XPUA 3NPIA 3WHCA 1ZK8A 2WGBA 2YVEA 4M3BA 5FKMA 2G0EA 3ANPA 3VIBA 4JL3A 2FD5A 4GCKA 2HXIA 2OI8A 4D7NA 1UI6A 5K7ZA 5F04A 2ID3A 3E7QA 3VW1A 3MNLA 3CCYA 3ZQIA 3HIMA 3ZQHA 3Q0UA 2RHAA 4UDSA 1ZKGA 3O8GA 2ID6A 3BR0A 3FRQA 3HTAA 1Z0XA 1JTYA 3V6GA 4I6ZA 2JJ7A 3F0CA 3QKXA 3BTIA 2FBQA 1QVUA 5IP6A 2G3BA 2OF7A 5K7HA 1U9NA 2TRTA 4XK4A 3BTLA 3VW0A 2DTZA 5AQCA 3G7RA 5GP9A 3LWJA 4ICHA 5H9TA 2QCOA 3G1LA 3VUQA 3LSPA 1JUPA 3AQTA 2XRLA 1QPIA 4AUXA 3IH2A 4M3FA 3DCFA 4AC6A 5EZGA 5FHPA 3QQAA 4L62A 2HQ5A 2XGDA 3IUVA 3HE0A 3MVPA 2HKUA 1T33A 2QWTA 2XDNA 3G56A 3AQSA 3ON4A 3VOKA 2IAIA 5FKKA 3BR5A 2HYTA 2Y30A 2NP5A 2I10A 4W97A 2ZCNA 2XGCA 5F1JA 2HXOA 3NNRA 2WUIA 3VVYA 3LSRA 2NS7A 2W53A 2VPRA 5J3LA 3DEWA 3ZQGA 2UXPA 3GZIA 5IOYA 3LSJA 2VKVA 4MK6A 3S5RA 4D5CA 5K7FA 1JUMA 3C2BA 4NELA 4MO7A 1A6IA 3BQYA 2OERA 1UI5A 5D19A 5F0HA
chains in the Genus database with same CATH superfamily
5J1YA 5HAWA 2XB5A 4M3GA 3SDGA 3NI7A 5CQGA 1SGMA 5HSZA 3DU5A 5J1UA 2R7VA 5F27A 2QIBA 5GPCA 3COLA 5GPAA 3PM1A 3KKCA 2V57A 2OPTA 2NX4A 2R7RA 5FKNA 3K8PC 3VVZA 2G7SA 2GFNA 3QPSA 3T6NA 3BQZA 3G1MA 3LOCA 2ZCMA 5K58A 2R7XA 3BRUA 3BHQA 2B3WA 2G7GA 2X6OA 3NXCA 3PPBA 4V2FA 3QBMA 3V78A 3IH4A 4JKZA 2IEKA 5EFYA 2XPVA 3PASA 4CGRA 2IBDA 3HGYA 3RH2A 3VVXA 2B1EA 4M3DA 2F07A 2ZB9A 1JUSA 4V2GA 3BJBA 4M3EA 4JYKA 5EZHA 2O7TA 1RPWA 3KZ9A 2DG8A 2TCTA 3SFIA 5DAJA 3KYLA 4GFKA 4NN1A 4U9NA 3LHQA 3HTJA 2Q24A 2XGEA 4U9LA 5C4YA 5CW8A 2NS8A 2O7OA 3EUPA 2FJ1A 2UXHA 3BCGA 4I76A 5F0FA 1JTXA 5HBUA 3HGGA 3KKDA 5CXGA 3TP3A 3GEUA 3QPLA 3FIWA 4KWAA 2IU5A 2WV1A 2R7QA 4YZEA 5CXIA 3CWRA 5FKOA 3VOXA 5FKLA 5EYRA 3O8HA 3BR6A 5F0CA 3DPJA 3LJLA 2QOPA 3B81A 2YVHA 3FHNA 4X1EA 3HTHA 2R7OA 3ZQLA 3F1BA 3KNWA 3Q0VA 2RASA 2UXUA 1BJZA 2RAEA 4D7MA 5IOZA 4HKUA 4D5FA 3B6CA 3CDLA 3CJDA 3VPRA 3ANGA 2GUHA 4ACIA 3G1OA 4IRVA 4JNNA 2NP3A 2HYJA 2ZOYA 3BR1A 4GCLA 5F08A 3VP5A 4G12A 2ZOZA 4ME9A 3BNIA 2FX0A 5J1RA 3NRGA 4DW6A 3B6AA 3JSJA 1ORKA 2GENA 2FJI1 5FMPA 2X9DA 5IPAA 3ZQFA 3RD3A 2Y2ZA 2UXOA 4WIBA 1QVTA 3BR3A 1Z77A 3Q3SA 2R7WA 3SWHA 2REKA 2VKEA 4AC0A 1RKWA 3Q0WA 4GCTA 2DG7A 3WHBA 1JT0A 2EH3A 3BT9A 2JK3A 2GBYA 2D6YA 5FGLA 4AF5A 4OD5A 4B1RA 3BR2A 2R7SA 4ABZA 3HTIA 4PXIA 1VI0A 3IH3A 3CRJA 2PZ9A 4MXMA 2QKOA 3BTCA 4W1UA 5D1RA 2QTQA 2Y31A 3TP0A 3BTJA 2FQ4A 3ON2A 3FK7A 4GFLA 1JT6A 1U9OA 3O60A 3VW2A 2G7LA 2ZCXA 3C07A 3FK6A 2UXIA 2XPWA 3NS4A 5D18A 1T56A 3EGQA 3P9TA 4B3AA 1RKTA 2PBXA 2XPUA 3NPIA 3WHCA 1ZK8A 2WGBA 2YVEA 4M3BA 5FKMA 2G0EA 3ANPA 3VIBA 4JL3A 2FD5A 4GCKA 2HXIA 3VTIA 2OI8A 4D7NA 1UI6A 5K7ZA 5F04A 2ID3A 3E7QA 4C2MA 3VW1A 3MNLA 4DVYP 3CCYA 3ZQIA 2R7UA 3HIMA 3ZQHA 3Q0UA 2RHAA 4UDSA 1ZKGA 3O8GA 2ID6A 3BR0A 3FRQA 3HTAA 1Z0XA 1JTYA 3V6GA 4I6ZA 2JJ7A 3F0CA 3QKXA 3BTIA 2FBQA 2YVXA 1QVUA 5IP6A 2G3BA 2OF7A 5K7HA 1U9NA 2TRTA 4XK4A 3BTLA 3VW0A 2DTZA 5AQCA 3G7RA 5GP9A 3LWJA 4ICHA 5H9TA 2QCOA 3G1LA 3VUQA 3LSPA 1JUPA 3AQTA 2XRLA 1QPIA 4AUXA 3IH2A 4M3FA 3DCFA 4AC6A 5EZGA 5FHPA 3QQAA 4L62A 2HQ5A 2XGDA 3IUVA 3HE0A 3MVPA 2HKUA 1T33A 2QWTA 2XDNA 3G56A 3AQSA 3ON4A 3DU6A 3VOKA 2IAIA 5FKKA 3BR5A 2HYTA 2Y30A 2NP5A 2I10A 4W97A 2ZCNA 2XGCA 5F1JA 2HXOA 3NNRA 2WUIA 3VVYA 3LSRA 2NS7A 2W53A 4OD4A 2VPRA 5J3LA 3DEWA 2R7TA 3ZQGA 2UXPA 3GZIA 5IOYA 3LSJA 2VKVA 2ZY9A 4MK6A 2A2FX 3S5RA 4D5CA 5K7FA 2PFVA 1JUMA 3C2BA 4NELA 4MO7A 1A6IA 3BQYA 2OERA 1UI5A 5D19A 5F0HA
chains in the Genus database with same CATH topology
5J1YA 5HAWA 2XB5A 4M3GA 3SDGA 3NI7A 1SGMA 5HSZA 5J1UA 5F27A 2QIBA 5GPCA 3COLA 5GPAA 3PM1A 3KKCA 2V57A 2OPTA 2NX4A 5FKNA 3VVZA 2G7SA 2GFNA 3QPSA 3T6NA 3BQZA 3G1MA 3LOCA 2ZCMA 5K58A 3BRUA 3BHQA 2G7GA 2X6OA 3NXCA 3PPBA 4V2FA 3QBMA 3V78A 3IH4A 4JKZA 2IEKA 5EFYA 2XPVA 3PASA 4CGRA 2IBDA 3HGYA 3RH2A 3VVXA 4M3DA 2F07A 2ZB9A 1JUSA 4V2GA 3BJBA 4M3EA 4JYKA 5EZHA 2O7TA 1RPWA 3KZ9A 2DG8A 2TCTA 3SFIA 5DAJA 4GFKA 4NN1A 3LHQA 3HTJA 2Q24A 2XGEA 5C4YA 5CW8A 2NS8A 2O7OA 3EUPA 2FJ1A 2UXHA 3BCGA 4I76A 5F0FA 1JTXA 5HBUA 3HGGA 3KKDA 5CXGA 3TP3A 3GEUA 3QPLA 3FIWA 4KWAA 2IU5A 2WV1A 4YZEA 5CXIA 3CWRA 5FKOA 3VOXA 5FKLA 5EYRA 3O8HA 3BR6A 5F0CA 3DPJA 3LJLA 2QOPA 3B81A 2YVHA 4X1EA 3HTHA 3ZQLA 3F1BA 3KNWA 3Q0VA 2RASA 2UXUA 1BJZA 2RAEA 4D7MA 5IOZA 4HKUA 4D5FA 3B6CA 3CDLA 3CJDA 3VPRA 3ANGA 2GUHA 4ACIA 3G1OA 4JNNA 2NP3A 2HYJA 2ZOYA 3BR1A 4GCLA 5F08A 3VP5A 4G12A 2ZOZA 4ME9A 3BNIA 2FX0A 5J1RA 3NRGA 4DW6A 3B6AA 3JSJA 1ORKA 2GENA 5FMPA 2X9DA 5IPAA 3ZQFA 3RD3A 2Y2ZA 2UXOA 1QVTA 3BR3A 1Z77A 3Q3SA 2REKA 2VKEA 4AC0A 1RKWA 3Q0WA 4GCTA 2DG7A 3WHBA 1JT0A 2EH3A 3BT9A 2JK3A 2GBYA 2D6YA 5FGLA 4AF5A 4B1RA 3BR2A 4ABZA 3HTIA 4PXIA 1VI0A 3IH3A 3CRJA 2PZ9A 4MXMA 2QKOA 3BTCA 4W1UA 5D1RA 2QTQA 2Y31A 3TP0A 3BTJA 2FQ4A 3ON2A 3FK7A 4GFLA 1JT6A 1U9OA 3O60A 3VW2A 2G7LA 2ZCXA 3C07A 3FK6A 2UXIA 2XPWA 5D18A 1T56A 3EGQA 3P9TA 4B3AA 1RKTA 2PBXA 2XPUA 3NPIA 3WHCA 1ZK8A 2WGBA 2YVEA 4M3BA 5FKMA 2G0EA 3ANPA 3VIBA 4JL3A 2FD5A 4GCKA 2HXIA 2OI8A 4D7NA 1UI6A 5K7ZA 5F04A 2ID3A 3E7QA 3VW1A 3MNLA 3CCYA 3ZQIA 3HIMA 3ZQHA 3Q0UA 2RHAA 4UDSA 1ZKGA 3O8GA 2ID6A 3BR0A 3FRQA 3HTAA 1Z0XA 1JTYA 3V6GA 4I6ZA 2JJ7A 3F0CA 3QKXA 3BTIA 2FBQA 1QVUA 5IP6A 2G3BA 2OF7A 5K7HA 1U9NA 2TRTA 4XK4A 3BTLA 3VW0A 2DTZA 5AQCA 3G7RA 5GP9A 3LWJA 4ICHA 5H9TA 2QCOA 3G1LA 3VUQA 3LSPA 1JUPA 3AQTA 2XRLA 1QPIA 4AUXA 3IH2A 4M3FA 3DCFA 4AC6A 5EZGA 5FHPA 3QQAA 4L62A 2HQ5A 2XGDA 3IUVA 3HE0A 3MVPA 2HKUA 1T33A 2QWTA 2XDNA 3G56A 3AQSA 3ON4A 3VOKA 2IAIA 5FKKA 3BR5A 2HYTA 2Y30A 2NP5A 2I10A 4W97A 2ZCNA 2XGCA 5F1JA 2HXOA 3NNRA 2WUIA 3VVYA 3LSRA 2NS7A 2W53A 2VPRA 5J3LA 3DEWA 3ZQGA 2UXPA 3GZIA 5IOYA 3LSJA 2VKVA 4MK6A 3S5RA 4D5CA 5K7FA 1JUMA 3C2BA 4NELA 4MO7A 1A6IA 3BQYA 2OERA 1UI5A 5D19A 5F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1Y A;  5HAW A;  2XB5 A;  4M3G A;  3SDG A;  3NI7 A;  1SGM A;  5HSZ A;  5J1U A;  5F27 A;  2QIB A;  5GPC A;  3COL A;  5GPA A;  3PM1 A;  3KKC A;  2V57 A;  2OPT A;  2NX4 A;  5FKN A;  3VVZ A;  2G7S A;  2GFN A;  3QPS A;  3T6N A;  3BQZ A;  3G1M A;  3LOC A;  2ZCM A;  5K58 A;  3BRU A;  3BHQ A;  2G7G A;  2X6O A;  3NXC A;  3PPB A;  4V2F A;  3QBM A;  3V78 A;  3IH4 A;  4JKZ A;  2IEK A;  5EFY A;  2XPV A;  3PAS A;  4CGR A;  2IBD A;  3HGY A;  3RH2 A;  3VVX A;  4M3D A;  2F07 A;  2ZB9 A;  1JUS A;  4V2G A;  3BJB A;  4M3E A;  4JYK A;  5EZH A;  2O7T A;  1RPW A;  3KZ9 A;  2DG8 A;  2TCT A;  3SFI A;  5DAJ A;  4GFK A;  4NN1 A;  3LHQ A;  3HTJ A;  2Q24 A;  2XGE A;  5C4Y A;  5CW8 A;  2NS8 A;  2O7O A;  3EUP A;  2FJ1 A;  2UXH A;  3BCG A;  4I76 A;  5F0F A;  1JTX A;  5HBU A;  3HGG A;  3KKD A;  5CXG A;  3TP3 A;  3GEU A;  3QPL A;  3FIW A;  4KWA A;  2IU5 A;  2WV1 A;  4YZE A;  5CXI A;  3CWR A;  5FKO A;  3VOX A;  5FKL A;  5EYR A;  3O8H A;  3BR6 A;  5F0C A;  3DPJ A;  3LJL A;  2QOP A;  3B81 A;  2YVH A;  4X1E A;  3HTH A;  3ZQL A;  3F1B A;  3KNW A;  3Q0V A;  2RAS A;  2UXU A;  1BJZ A;  2RAE A;  4D7M A;  5IOZ A;  4HKU A;  4D5F A;  3B6C A;  3CDL A;  3CJD A;  3VPR A;  3ANG A;  2GUH A;  4ACI A;  3G1O A;  4JNN A;  2NP3 A;  2HYJ A;  2ZOY A;  3BR1 A;  4GCL A;  5F08 A;  3VP5 A;  4G12 A;  2ZOZ A;  4ME9 A;  3BNI A;  2FX0 A;  5J1R A;  3NRG A;  4DW6 A;  3B6A A;  3JSJ A;  1ORK A;  2GEN A;  5FMP A;  2X9D A;  5IPA A;  3ZQF A;  3RD3 A;  2Y2Z A;  2UXO A;  1QVT A;  3BR3 A;  1Z77 A;  3Q3S A;  2REK A;  2VKE A;  4AC0 A;  1RKW A;  3Q0W A;  4GCT A;  2DG7 A;  3WHB A;  1JT0 A;  2EH3 A;  3BT9 A;  2JK3 A;  2GBY A;  2D6Y A;  5FGL A;  4AF5 A;  4B1R A;  3BR2 A;  4ABZ A;  3HTI A;  4PXI A;  1VI0 A;  3IH3 A;  3CRJ A;  2PZ9 A;  4MXM A;  2QKO A;  3BTC A;  4W1U A;  5D1R A;  2QTQ A;  2Y31 A;  3TP0 A;  3BTJ A;  2FQ4 A;  3ON2 A;  3FK7 A;  4GFL A;  1JT6 A;  1U9O A;  3O60 A;  3VW2 A;  2G7L A;  2ZCX A;  3C07 A;  3FK6 A;  2UXI A;  2XPW A;  5D18 A;  1T56 A;  3EGQ A;  3P9T A;  4B3A A;  1RKT A;  2PBX A;  2XPU A;  3NPI A;  3WHC A;  1ZK8 A;  2WGB A;  2YVE A;  4M3B A;  5FKM A;  2G0E A;  3ANP A;  3VIB A;  4JL3 A;  2FD5 A;  4GCK A;  2HXI A;  2OI8 A;  4D7N A;  1UI6 A;  5K7Z A;  5F04 A;  2ID3 A;  3E7Q A;  3VW1 A;  3MNL A;  3CCY A;  3ZQI A;  3HIM A;  3ZQH A;  3Q0U A;  2RHA A;  4UDS A;  1ZKG A;  3O8G A;  2ID6 A;  3BR0 A;  3FRQ A;  3HTA A;  1Z0X A;  1JTY A;  3V6G A;  4I6Z A;  2JJ7 A;  3F0C A;  3QKX A;  3BTI A;  2FBQ A;  1QVU A;  5IP6 A;  2G3B A;  2OF7 A;  5K7H A;  1U9N A;  2TRT A;  4XK4 A;  3BTL A;  3VW0 A;  2DTZ A;  5AQC A;  3G7R A;  5GP9 A;  3LWJ A;  4ICH A;  5H9T A;  2QCO A;  3G1L A;  3VUQ A;  3LSP A;  1JUP A;  3AQT A;  2XRL A;  1QPI A;  4AUX A;  3IH2 A;  4M3F A;  3DCF A;  4AC6 A;  5EZG A;  5FHP A;  3QQA A;  4L62 A;  2HQ5 A;  2XGD A;  3IUV A;  3HE0 A;  3MVP A;  2HKU A;  1T33 A;  2QWT A;  2XDN A;  3G56 A;  3AQS A;  3ON4 A;  3VOK A;  2IAI A;  5FKK A;  3BR5 A;  2HYT A;  2Y30 A;  2NP5 A;  2I10 A;  4W97 A;  2ZCN A;  2XGC A;  5F1J A;  2HXO A;  3NNR A;  2WUI A;  3VVY A;  3LSR A;  2NS7 A;  2W53 A;  2VPR A;  5J3L A;  3DEW A;  3ZQG A;  2UXP A;  3GZI A;  5IOY A;  3LSJ A;  2VKV A;  4MK6 A;  3S5R A;  4D5C A;  5K7F A;  1JUM A;  3C2B A;  4NEL A;  4MO7 A;  1A6I A;  3BQY A;  2OER A;  1UI5 A;  5D19 A;  5F0H A; 
#chains in the Genus database with same CATH topology
 5J1Y A;  5HAW A;  2XB5 A;  4M3G A;  3SDG A;  3NI7 A;  5CQG A;  1SGM A;  5HSZ A;  3DU5 A;  5J1U A;  2R7V A;  5F27 A;  2QIB A;  5GPC A;  3COL A;  5GPA A;  3PM1 A;  3KKC A;  2V57 A;  2OPT A;  2NX4 A;  2R7R A;  5FKN A;  3K8P C;  3VVZ A;  2G7S A;  2GFN A;  3QPS A;  3T6N A;  3BQZ A;  3G1M A;  3LOC A;  2ZCM A;  5K58 A;  2R7X A;  3BRU A;  3BHQ A;  2B3W A;  2G7G A;  2X6O A;  3NXC A;  3PPB A;  4V2F A;  3QBM A;  3V78 A;  3IH4 A;  4JKZ A;  2IEK A;  5EFY A;  2XPV A;  3PAS A;  4CGR A;  2IBD A;  3HGY A;  3RH2 A;  3VVX A;  2B1E A;  4M3D A;  2F07 A;  2ZB9 A;  1JUS A;  4V2G A;  3BJB A;  4M3E A;  4JYK A;  5EZH A;  2O7T A;  1RPW A;  3KZ9 A;  2DG8 A;  2TCT A;  3SFI A;  5DAJ A;  3KYL A;  4GFK A;  4NN1 A;  4U9N A;  3LHQ A;  3HTJ A;  2Q24 A;  2XGE A;  4U9L A;  5C4Y A;  5CW8 A;  2NS8 A;  2O7O A;  3EUP A;  2FJ1 A;  2UXH A;  3BCG A;  4I76 A;  5F0F A;  1JTX A;  5HBU A;  3HGG A;  3KKD A;  5CXG A;  3TP3 A;  3GEU A;  3QPL A;  3FIW A;  4KWA A;  2IU5 A;  2WV1 A;  2R7Q A;  4YZE A;  5CXI A;  3CWR A;  5FKO A;  3VOX A;  5FKL A;  5EYR A;  3O8H A;  3BR6 A;  5F0C A;  3DPJ A;  3LJL A;  2QOP A;  3B81 A;  2YVH A;  3FHN A;  4X1E A;  3HTH A;  2R7O A;  3ZQL A;  3F1B A;  3KNW A;  3Q0V A;  2RAS A;  2UXU A;  1BJZ A;  2RAE A;  4D7M A;  5IOZ A;  4HKU A;  4D5F A;  3B6C A;  3CDL A;  3CJD A;  3VPR A;  3ANG A;  2GUH A;  4ACI A;  3G1O A;  4IRV A;  4JNN A;  2NP3 A;  2HYJ A;  2ZOY A;  3BR1 A;  4GCL A;  5F08 A;  3VP5 A;  4G12 A;  2ZOZ A;  4ME9 A;  3BNI A;  2FX0 A;  5J1R A;  3NRG A;  4DW6 A;  3B6A A;  3JSJ A;  1ORK A;  2GEN A;  2FJI 1;  5FMP A;  2X9D A;  5IPA A;  3ZQF A;  3RD3 A;  2Y2Z A;  2UXO A;  4WIB A;  1QVT A;  3BR3 A;  1Z77 A;  3Q3S A;  2R7W A;  3SWH A;  2REK A;  2VKE A;  4AC0 A;  1RKW A;  3Q0W A;  4GCT A;  2DG7 A;  3WHB A;  1JT0 A;  2EH3 A;  3BT9 A;  2JK3 A;  2GBY A;  2D6Y A;  5FGL A;  4AF5 A;  4OD5 A;  4B1R A;  3BR2 A;  2R7S A;  4ABZ A;  3HTI A;  4PXI A;  1VI0 A;  3IH3 A;  3CRJ A;  2PZ9 A;  4MXM A;  2QKO A;  3BTC A;  4W1U A;  5D1R A;  2QTQ A;  2Y31 A;  3TP0 A;  3BTJ A;  2FQ4 A;  3ON2 A;  3FK7 A;  4GFL A;  1JT6 A;  1U9O A;  3O60 A;  3VW2 A;  2G7L A;  2ZCX A;  3C07 A;  3FK6 A;  2UXI A;  2XPW A;  3NS4 A;  5D18 A;  1T56 A;  3EGQ A;  3P9T A;  4B3A A;  1RKT A;  2PBX A;  2XPU A;  3NPI A;  3WHC A;  1ZK8 A;  2WGB A;  2YVE A;  4M3B A;  5FKM A;  2G0E A;  3ANP A;  3VIB A;  4JL3 A;  2FD5 A;  4GCK A;  2HXI A;  3VTI A;  2OI8 A;  4D7N A;  1UI6 A;  5K7Z A;  5F04 A;  2ID3 A;  3E7Q A;  4C2M A;  3VW1 A;  3MNL A;  4DVY P;  3CCY A;  3ZQI A;  2R7U A;  3HIM A;  3ZQH A;  3Q0U A;  2RHA A;  4UDS A;  1ZKG A;  3O8G A;  2ID6 A;  3BR0 A;  3FRQ A;  3HTA A;  1Z0X A;  1JTY A;  3V6G A;  4I6Z A;  2JJ7 A;  3F0C A;  3QKX A;  3BTI A;  2FBQ A;  2YVX A;  1QVU A;  5IP6 A;  2G3B A;  2OF7 A;  5K7H A;  1U9N A;  2TRT A;  4XK4 A;  3BTL A;  3VW0 A;  2DTZ A;  5AQC A;  3G7R A;  5GP9 A;  3LWJ A;  4ICH A;  5H9T A;  2QCO A;  3G1L A;  3VUQ A;  3LSP A;  1JUP A;  3AQT A;  2XRL A;  1QPI A;  4AUX A;  3IH2 A;  4M3F A;  3DCF A;  4AC6 A;  5EZG A;  5FHP A;  3QQA A;  4L62 A;  2HQ5 A;  2XGD A;  3IUV A;  3HE0 A;  3MVP A;  2HKU A;  1T33 A;  2QWT A;  2XDN A;  3G56 A;  3AQS A;  3ON4 A;  3DU6 A;  3VOK A;  2IAI A;  5FKK A;  3BR5 A;  2HYT A;  2Y30 A;  2NP5 A;  2I10 A;  4W97 A;  2ZCN A;  2XGC A;  5F1J A;  2HXO A;  3NNR A;  2WUI A;  3VVY A;  3LSR A;  2NS7 A;  2W53 A;  4OD4 A;  2VPR A;  5J3L A;  3DEW A;  2R7T A;  3ZQG A;  2UXP A;  3GZI A;  5IOY A;  3LSJ A;  2VKV A;  2ZY9 A;  4MK6 A;  2A2F X;  3S5R A;  4D5C A;  5K7F A;  2PFV A;  1JUM A;  3C2B A;  4NEL A;  4MO7 A;  1A6I A;  3BQY A;  2OER A;  1UI5 A;  5D19 A;  5F0H A; 
#chains in the Genus database with same CATH homology
 5J1Y A;  5HAW A;  2XB5 A;  4M3G A;  3SDG A;  3NI7 A;  1SGM A;  5HSZ A;  5J1U A;  5F27 A;  2QIB A;  5GPC A;  3COL A;  5GPA A;  3PM1 A;  3KKC A;  2V57 A;  2OPT A;  2NX4 A;  5FKN A;  3VVZ A;  2G7S A;  2GFN A;  3QPS A;  3T6N A;  3BQZ A;  3G1M A;  3LOC A;  2ZCM A;  5K58 A;  3BRU A;  3BHQ A;  2G7G A;  2X6O A;  3NXC A;  3PPB A;  4V2F A;  3QBM A;  3V78 A;  3IH4 A;  4JKZ A;  2IEK A;  5EFY A;  2XPV A;  3PAS A;  4CGR A;  2IBD A;  3HGY A;  3RH2 A;  3VVX A;  4M3D A;  2F07 A;  2ZB9 A;  1JUS A;  4V2G A;  3BJB A;  4M3E A;  4JYK A;  5EZH A;  2O7T A;  1RPW A;  3KZ9 A;  2DG8 A;  2TCT A;  3SFI A;  5DAJ A;  4GFK A;  4NN1 A;  3LHQ A;  3HTJ A;  2Q24 A;  2XGE A;  5C4Y A;  5CW8 A;  2NS8 A;  2O7O A;  3EUP A;  2FJ1 A;  2UXH A;  3BCG A;  4I76 A;  5F0F A;  1JTX A;  5HBU A;  3HGG A;  3KKD A;  5CXG A;  3TP3 A;  3GEU A;  3QPL A;  3FIW A;  4KWA A;  2IU5 A;  2WV1 A;  4YZE A;  5CXI A;  3CWR A;  5FKO A;  3VOX A;  5FKL A;  5EYR A;  3O8H A;  3BR6 A;  5F0C A;  3DPJ A;  3LJL A;  2QOP A;  3B81 A;  2YVH A;  4X1E A;  3HTH A;  3ZQL A;  3F1B A;  3KNW A;  3Q0V A;  2RAS A;  2UXU A;  1BJZ A;  2RAE A;  4D7M A;  5IOZ A;  4HKU A;  4D5F A;  3B6C A;  3CDL A;  3CJD A;  3VPR A;  3ANG A;  2GUH A;  4ACI A;  3G1O A;  4JNN A;  2NP3 A;  2HYJ A;  2ZOY A;  3BR1 A;  4GCL A;  5F08 A;  3VP5 A;  4G12 A;  2ZOZ A;  4ME9 A;  3BNI A;  2FX0 A;  5J1R A;  3NRG A;  4DW6 A;  3B6A A;  3JSJ A;  1ORK A;  2GEN A;  5FMP A;  2X9D A;  5IPA A;  3ZQF A;  3RD3 A;  2Y2Z A;  2UXO A;  1QVT A;  3BR3 A;  1Z77 A;  3Q3S A;  2REK A;  2VKE A;  4AC0 A;  1RKW A;  3Q0W A;  4GCT A;  2DG7 A;  3WHB A;  1JT0 A;  2EH3 A;  3BT9 A;  2JK3 A;  2GBY A;  2D6Y A;  5FGL A;  4AF5 A;  4B1R A;  3BR2 A;  4ABZ A;  3HTI A;  4PXI A;  1VI0 A;  3IH3 A;  3CRJ A;  2PZ9 A;  4MXM A;  2QKO A;  3BTC A;  4W1U A;  5D1R A;  2QTQ A;  2Y31 A;  3TP0 A;  3BTJ A;  2FQ4 A;  3ON2 A;  3FK7 A;  4GFL A;  1JT6 A;  1U9O A;  3O60 A;  3VW2 A;  2G7L A;  2ZCX A;  3C07 A;  3FK6 A;  2UXI A;  2XPW A;  5D18 A;  1T56 A;  3EGQ A;  3P9T A;  4B3A A;  1RKT A;  2PBX A;  2XPU A;  3NPI A;  3WHC A;  1ZK8 A;  2WGB A;  2YVE A;  4M3B A;  5FKM A;  2G0E A;  3ANP A;  3VIB A;  4JL3 A;  2FD5 A;  4GCK A;  2HXI A;  2OI8 A;  4D7N A;  1UI6 A;  5K7Z A;  5F04 A;  2ID3 A;  3E7Q A;  3VW1 A;  3MNL A;  3CCY A;  3ZQI A;  3HIM A;  3ZQH A;  3Q0U A;  2RHA A;  4UDS A;  1ZKG A;  3O8G A;  2ID6 A;  3BR0 A;  3FRQ A;  3HTA A;  1Z0X A;  1JTY A;  3V6G A;  4I6Z A;  2JJ7 A;  3F0C A;  3QKX A;  3BTI A;  2FBQ A;  1QVU A;  5IP6 A;  2G3B A;  2OF7 A;  5K7H A;  1U9N A;  2TRT A;  4XK4 A;  3BTL A;  3VW0 A;  2DTZ A;  5AQC A;  3G7R A;  5GP9 A;  3LWJ A;  4ICH A;  5H9T A;  2QCO A;  3G1L A;  3VUQ A;  3LSP A;  1JUP A;  3AQT A;  2XRL A;  1QPI A;  4AUX A;  3IH2 A;  4M3F A;  3DCF A;  4AC6 A;  5EZG A;  5FHP A;  3QQA A;  4L62 A;  2HQ5 A;  2XGD A;  3IUV A;  3HE0 A;  3MVP A;  2HKU A;  1T33 A;  2QWT A;  2XDN A;  3G56 A;  3AQS A;  3ON4 A;  3VOK A;  2IAI A;  5FKK A;  3BR5 A;  2HYT A;  2Y30 A;  2NP5 A;  2I10 A;  4W97 A;  2ZCN A;  2XGC A;  5F1J A;  2HXO A;  3NNR A;  2WUI A;  3VVY A;  3LSR A;  2NS7 A;  2W53 A;  2VPR A;  5J3L A;  3DEW A;  3ZQG A;  2UXP A;  3GZI A;  5IOY A;  3LSJ A;  2VKV A;  4MK6 A;  3S5R A;  4D5C A;  5K7F A;  1JUM A;  3C2B A;  4NEL A;  4MO7 A;  1A6I A;  3BQY A;  2OER A;  1UI5 A;  5D19 A;  5F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...