4GFKA

Structures of no factors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
184
Chain Sequence
NRREEILQALAEMLESNITTAKLAKQVGVSEAALYRHFPSKTRMFEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAERNPGLTRILSGHALMFENERLRDRINQLFERIETSLRQILRERKLREGKSFPVDENILAAQLLGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Dna binding protein
molecule keywords Nucleoid occlusion factor SlmA
total genus 75
structure length 184
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4gfkA00
3O8GA 3RH2A 3VOXA 4HKUA 3BTJA 3B6AA 2ZCMA 1ZKGA 2XB5A 3BTIA 3PASA 1T56A 2UXOA 3ANGA 5F0FA 5J3LA 3GEUA 3VUQA 4ICHA 2FX0A 2D6YA 3HTHA 3BT9A 1JUPA 2WUIA 1ZK8A 3VW1A 3VVZA 5J1RA 2XPUA 3SFIA 4D5FA 2XGDA 2DG7A 2YVHA 2NP3A 3AQTA 3QQAA 3ZQLA 4JL3A 1SGMA 2ID6A 3P9TA 3HTJA 3BHQA 4D7MA 2PZ9A 2XDNA 3ANPA 3BCGA 2GFNA 5F0HA 3ZQGA 3O8HA 2XPVA 3SDGA 2NS7A 3CDLA 3LWJA 1VI0A 3CWRA 3CJDA 3G1MA 3C2BA 4M3EA 5AQCA 5IOZA 3DCFA 3T6NA 3ON4A 5CXIA 3KNWA 3NPIA 2NP5A 2G3BA 2REKA 2Y2ZA 3BJBA 4V2FA 4ABZA 4JKZA 5FGLA 3FK7A 3G56A 1QPIA 2HKUA 1BJZA 2ZOZA 3Q0VA 5IP6A 2ZCNA 3BR1A 3MVPA 5F04A 2VPRA 3G1OA 3CRJA 5EYRA 2O7TA 4MXMA 3BR2A 3B81A 3BR5A 2IEKA 3E7QA 2WV1A 3V78A 3VPRA 2XPWA 5H9TA 2OPTA 2X6OA 3WHBA 5J1UA 1RKWA 4NELA 1RKTA 5FKLA 3G1LA 4KWAA 3LSPA 1JTYA 1Z0XA 2IBDA 4GFLA 3ZQHA 4D5CA 5HBUA 3COLA 5CXGA 3NI7A 5CW8A 1JUMA 2QCOA 2G7LA 5F0CA 1Z77A 4GFKA 5IPAA 5HAWA 1JTXA 3F0CA 4ACIA 3LSJA 5DAJA 2OF7A 1UI6A 3BR6A 3BR0A 2UXHA 5FKOA 3VVXA 3HE0A 4ME9A 1T33A 5F1JA 2YVEA 3FIWA 3Q0WA 3HGYA 4YZEA 1UI5A 4D7NA 2TCTA 2HYJA 2FQ4A 1ORKA 5F27A 1JT0A 4W1UA 3V6GA 5K58A 2XGCA 3LSRA 2UXIA 1QVUA 3VIBA 4MO7A 5FHPA 1U9OA 2VKVA 3HIMA 3IH2A 2RAEA 4AC6A 5GP9A 4AF5A 4G12A 2RHAA 2DTZA 2UXPA 3Q0UA 2Y30A 5K7ZA 2TRTA 2NS8A 3QPSA 3VVYA 4GCKA 4XK4A 5GPCA 5D1RA 2FBQA 1A6IA 3AQSA 3G7RA 3FRQA 5EZGA 5K7HA 2QIBA 2UXUA 2QTQA 3PPBA 2DG8A 4CGRA 4I76A 2WGBA 2IU5A 3HTIA 3BRUA 1RPWA 3RD3A 2FD5A 2IAIA 2HXOA 3EUPA 1QVTA 2ID3A 4GCLA 3IH4A 3MNLA 3VW0A 4V2GA 2OI8A 2ZOYA 4I6ZA 4MK6A 5FMPA 4X1EA 2QKOA 3Q3SA 5FKKA 1JUSA 3NNRA 3KZ9A 2ZCXA 3O60A 4GCTA 4M3BA 4PXIA 5F08A 2ZB9A 2G7GA 3PM1A 3ZQFA 2HXIA 3ZQIA 2XRLA 2I10A 3GZIA 2JK3A 5IOYA 3QBMA 4M3GA 3VP5A 4NN1A 3LJLA 4UDSA 3C07A 3BQZA 3ON2A 4B1RA 5D18A 2NX4A 5K7FA 2O7OA 2GBYA 3JSJA 3VOKA 2F07A 3BTLA 3S5RA 3NXCA 3EGQA 4L62A 3CCYA 2QOPA 3BTCA 3IH3A 2RASA 2GENA 3BQYA 1JT6A 3IUVA 4JNNA 3HTAA 2OERA 3NRGA 3BNIA 2FJ1A 2V57A 3KKCA 3LHQA 3LOCA 2XGEA 2VKEA 5EFYA 3QKXA 3KKDA 2Q24A 3B6CA 4DW6A 5C4YA 5FKMA 2G7SA 2HYTA 4AUXA 3WHCA 4B3AA 5D19A 3TP0A 4M3FA 5GPAA 2X9DA 3DEWA 2EH3A 4JYKA 3TP3A 4M3DA 5J1YA 3BR3A 3FK6A 4W97A 2HQ5A 2JJ7A 3VW2A 2PBXA 5EZHA 5HSZA 5FKNA 2GUHA 3DPJA 3F1BA 2Y31A 4AC0A 2QWTA 2W53A 3HGGA 3QPLA 2G0EA 1U9NA
chains in the Genus database with same CATH superfamily
3O8GA 3RH2A 3VOXA 4HKUA 3BTJA 3B6AA 2ZCMA 1ZKGA 2XB5A 3BTIA 3PASA 2R7WA 1T56A 2UXOA 3ANGA 5F0FA 5J3LA 3GEUA 3VUQA 2R7TA 4ICHA 2FX0A 2D6YA 3HTHA 3BT9A 1JUPA 2WUIA 1ZK8A 3VW1A 3VVZA 5J1RA 2XPUA 3SFIA 4D5FA 2XGDA 3SWHA 2DG7A 2YVHA 2NP3A 3AQTA 3QQAA 3ZQLA 4JL3A 1SGMA 2ID6A 3P9TA 2B3WA 3HTJA 3BHQA 4D7MA 2PZ9A 2XDNA 3ANPA 3BCGA 2GFNA 5F0HA 3ZQGA 3O8HA 2XPVA 3SDGA 2NS7A 3CDLA 3LWJA 1VI0A 3CWRA 3CJDA 3G1MA 3C2BA 4M3EA 5AQCA 3K8PC 5IOZA 4U9NA 3DCFA 3T6NA 3ON4A 5CXIA 3KNWA 3NPIA 2NP5A 2G3BA 2REKA 2Y2ZA 3BJBA 4V2FA 3FHNA 4ABZA 4JKZA 5FGLA 3FK7A 4OD4A 3G56A 2R7QA 2HKUA 1QPIA 1BJZA 2ZOZA 3Q0VA 5IP6A 2ZCNA 3BR1A 3MVPA 5F04A 2VPRA 3G1OA 4U9LA 3CRJA 5EYRA 2O7TA 4MXMA 3BR2A 3B81A 3BR5A 4IRVA 2IEKA 3VTIA 4C2MA 3E7QA 2WV1A 3V78A 3VPRA 2XPWA 5H9TA 2OPTA 2X6OA 3WHBA 2R7VA 5J1UA 1RKWA 4NELA 1RKTA 5FKLA 2PFVA 2YVXA 3G1LA 4KWAA 3LSPA 1JTYA 1Z0XA 2IBDA 4GFLA 3ZQHA 4D5CA 5HBUA 3COLA 5CXGA 3NI7A 5CW8A 1JUMA 4WIBA 2QCOA 2G7LA 5F0CA 1Z77A 4GFKA 5IPAA 5HAWA 1JTXA 3F0CA 4ACIA 3LSJA 5DAJA 2OF7A 1UI6A 3BR6A 2R7SA 3BR0A 2UXHA 5FKOA 3VVXA 3HE0A 4ME9A 1T33A 5F1JA 2YVEA 3FIWA 3Q0WA 3HGYA 4YZEA 1UI5A 4D7NA 2TCTA 2HYJA 2FQ4A 1ORKA 5F27A 1JT0A 4W1UA 3V6GA 2B1EA 5CQGA 5K58A 2XGCA 3LSRA 2UXIA 1QVUA 3VIBA 4MO7A 5FHPA 1U9OA 2VKVA 3HIMA 3IH2A 2RAEA 4AC6A 5GP9A 4AF5A 4G12A 2RHAA 2DTZA 2UXPA 3Q0UA 2Y30A 5K7ZA 2TRTA 2NS8A 3QPSA 3VVYA 2FJI1 4GCKA 4XK4A 5GPCA 5D1RA 2FBQA 4OD5A 1A6IA 3AQSA 3G7RA 3FRQA 5EZGA 2R7UA 5K7HA 2QIBA 2UXUA 2QTQA 3PPBA 2DG8A 4CGRA 3DU6A 4I76A 2WGBA 2IU5A 3HTIA 3BRUA 1RPWA 3RD3A 2FD5A 2IAIA 2HXOA 3EUPA 1QVTA 2ID3A 4GCLA 3IH4A 3MNLA 3VW0A 4V2GA 2OI8A 2ZOYA 4I6ZA 4MK6A 4DVYP 5FMPA 3KYLA 4X1EA 2QKOA 3Q3SA 5FKKA 1JUSA 3NNRA 3KZ9A 2ZCXA 3O60A 4GCTA 4M3BA 4PXIA 5F08A 2ZB9A 2G7GA 3PM1A 3ZQFA 2HXIA 3ZQIA 2XRLA 2I10A 3GZIA 2JK3A 5IOYA 3QBMA 4M3GA 3VP5A 4NN1A 3LJLA 4UDSA 3C07A 2R7RA 3BQZA 3ON2A 4B1RA 5D18A 2NX4A 5K7FA 2O7OA 2GBYA 3DU5A 3JSJA 3VOKA 2F07A 3BTLA 3S5RA 3NXCA 3NS4A 3EGQA 2R7OA 4L62A 3CCYA 2QOPA 3BTCA 3IH3A 2RASA 2GENA 3BQYA 2R7XA 1JT6A 3IUVA 4JNNA 3HTAA 2OERA 3NRGA 3BNIA 2FJ1A 2V57A 3KKCA 3LHQA 3LOCA 2XGEA 2VKEA 5EFYA 3QKXA 3KKDA 2Q24A 3B6CA 4DW6A 5C4YA 5FKMA 2G7SA 2HYTA 4AUXA 3WHCA 4B3AA 5D19A 3TP0A 4M3FA 5GPAA 2A2FX 2X9DA 3DEWA 2EH3A 4JYKA 3TP3A 4M3DA 2ZY9A 5J1YA 3BR3A 3FK6A 4W97A 2HQ5A 2JJ7A 3VW2A 2PBXA 5EZHA 5HSZA 5FKNA 2GUHA 3DPJA 3F1BA 2Y31A 4AC0A 2QWTA 2W53A 3HGGA 3QPLA 2G0EA 1U9NA
chains in the Genus database with same CATH topology
3O8GA 3RH2A 3VOXA 4HKUA 3BTJA 3B6AA 2ZCMA 1ZKGA 2XB5A 3BTIA 3PASA 1T56A 2UXOA 3ANGA 5F0FA 5J3LA 3GEUA 3VUQA 4ICHA 2FX0A 2D6YA 3HTHA 3BT9A 1JUPA 2WUIA 1ZK8A 3VW1A 3VVZA 5J1RA 2XPUA 3SFIA 4D5FA 2XGDA 2DG7A 2YVHA 2NP3A 3AQTA 3QQAA 3ZQLA 4JL3A 1SGMA 2ID6A 3P9TA 3HTJA 3BHQA 4D7MA 2PZ9A 2XDNA 3ANPA 3BCGA 2GFNA 5F0HA 3ZQGA 3O8HA 2XPVA 3SDGA 2NS7A 3CDLA 3LWJA 1VI0A 3CWRA 3CJDA 3G1MA 3C2BA 4M3EA 5AQCA 5IOZA 3DCFA 3T6NA 3ON4A 5CXIA 3KNWA 3NPIA 2NP5A 2G3BA 2REKA 2Y2ZA 3BJBA 4V2FA 4ABZA 4JKZA 5FGLA 3FK7A 3G56A 1QPIA 2HKUA 1BJZA 2ZOZA 3Q0VA 5IP6A 2ZCNA 3BR1A 3MVPA 5F04A 2VPRA 3G1OA 3CRJA 5EYRA 2O7TA 4MXMA 3BR2A 3B81A 3BR5A 2IEKA 3E7QA 2WV1A 3V78A 3VPRA 2XPWA 5H9TA 2OPTA 2X6OA 3WHBA 5J1UA 1RKWA 4NELA 1RKTA 5FKLA 3G1LA 4KWAA 3LSPA 1JTYA 1Z0XA 2IBDA 4GFLA 3ZQHA 4D5CA 5HBUA 3COLA 5CXGA 3NI7A 5CW8A 1JUMA 2QCOA 2G7LA 5F0CA 1Z77A 4GFKA 5IPAA 5HAWA 1JTXA 3F0CA 4ACIA 3LSJA 5DAJA 2OF7A 1UI6A 3BR6A 3BR0A 2UXHA 5FKOA 3VVXA 3HE0A 4ME9A 1T33A 5F1JA 2YVEA 3FIWA 3Q0WA 3HGYA 4YZEA 1UI5A 4D7NA 2TCTA 2HYJA 2FQ4A 1ORKA 5F27A 1JT0A 4W1UA 3V6GA 5K58A 2XGCA 3LSRA 2UXIA 1QVUA 3VIBA 4MO7A 5FHPA 1U9OA 2VKVA 3HIMA 3IH2A 2RAEA 4AC6A 5GP9A 4AF5A 4G12A 2RHAA 2DTZA 2UXPA 3Q0UA 2Y30A 5K7ZA 2TRTA 2NS8A 3QPSA 3VVYA 4GCKA 4XK4A 5GPCA 5D1RA 2FBQA 1A6IA 3AQSA 3G7RA 3FRQA 5EZGA 5K7HA 2QIBA 2UXUA 2QTQA 3PPBA 2DG8A 4CGRA 4I76A 2WGBA 2IU5A 3HTIA 3BRUA 1RPWA 3RD3A 2FD5A 2IAIA 2HXOA 3EUPA 1QVTA 2ID3A 4GCLA 3IH4A 3MNLA 3VW0A 4V2GA 2OI8A 2ZOYA 4I6ZA 4MK6A 5FMPA 4X1EA 2QKOA 3Q3SA 5FKKA 1JUSA 3NNRA 3KZ9A 2ZCXA 3O60A 4GCTA 4M3BA 4PXIA 5F08A 2ZB9A 2G7GA 3PM1A 3ZQFA 2HXIA 3ZQIA 2XRLA 2I10A 3GZIA 2JK3A 5IOYA 3QBMA 4M3GA 3VP5A 4NN1A 3LJLA 4UDSA 3C07A 3BQZA 3ON2A 4B1RA 5D18A 2NX4A 5K7FA 2O7OA 2GBYA 3JSJA 3VOKA 2F07A 3BTLA 3S5RA 3NXCA 3EGQA 4L62A 3CCYA 2QOPA 3BTCA 3IH3A 2RASA 2GENA 3BQYA 1JT6A 3IUVA 4JNNA 3HTAA 2OERA 3NRGA 3BNIA 2FJ1A 2V57A 3KKCA 3LHQA 3LOCA 2XGEA 2VKEA 5EFYA 3QKXA 3KKDA 2Q24A 3B6CA 4DW6A 5C4YA 5FKMA 2G7SA 2HYTA 4AUXA 3WHCA 4B3AA 5D19A 3TP0A 4M3FA 5GPAA 2X9DA 3DEWA 2EH3A 4JYKA 3TP3A 4M3DA 5J1YA 3BR3A 3FK6A 4W97A 2HQ5A 2JJ7A 3VW2A 2PBXA 5EZHA 5HSZA 5FKNA 2GUHA 3DPJA 3F1BA 2Y31A 4AC0A 2QWTA 2W53A 3HGGA 3QPLA 2G0EA 1U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8G A;  3RH2 A;  3VOX A;  4HKU A;  3BTJ A;  3B6A A;  2ZCM A;  1ZKG A;  2XB5 A;  3BTI A;  3PAS A;  1T56 A;  2UXO A;  3ANG A;  5F0F A;  5J3L A;  3GEU A;  3VUQ A;  4ICH A;  2FX0 A;  2D6Y A;  3HTH A;  3BT9 A;  1JUP A;  2WUI A;  1ZK8 A;  3VW1 A;  3VVZ A;  5J1R A;  2XPU A;  3SFI A;  4D5F A;  2XGD A;  2DG7 A;  2YVH A;  2NP3 A;  3AQT A;  3QQA A;  3ZQL A;  4JL3 A;  1SGM A;  2ID6 A;  3P9T A;  3HTJ A;  3BHQ A;  4D7M A;  2PZ9 A;  2XDN A;  3ANP A;  3BCG A;  2GFN A;  5F0H A;  3ZQG A;  3O8H A;  2XPV A;  3SDG A;  2NS7 A;  3CDL A;  3LWJ A;  1VI0 A;  3CWR A;  3CJD A;  3G1M A;  3C2B A;  4M3E A;  5AQC A;  5IOZ A;  3DCF A;  3T6N A;  3ON4 A;  5CXI A;  3KNW A;  3NPI A;  2NP5 A;  2G3B A;  2REK A;  2Y2Z A;  3BJB A;  4V2F A;  4ABZ A;  4JKZ A;  5FGL A;  3FK7 A;  3G56 A;  1QPI A;  2HKU A;  1BJZ A;  2ZOZ A;  3Q0V A;  5IP6 A;  2ZCN A;  3BR1 A;  3MVP A;  5F04 A;  2VPR A;  3G1O A;  3CRJ A;  5EYR A;  2O7T A;  4MXM A;  3BR2 A;  3B81 A;  3BR5 A;  2IEK A;  3E7Q A;  2WV1 A;  3V78 A;  3VPR A;  2XPW A;  5H9T A;  2OPT A;  2X6O A;  3WHB A;  5J1U A;  1RKW A;  4NEL A;  1RKT A;  5FKL A;  3G1L A;  4KWA A;  3LSP A;  1JTY A;  1Z0X A;  2IBD A;  4GFL A;  3ZQH A;  4D5C A;  5HBU A;  3COL A;  5CXG A;  3NI7 A;  5CW8 A;  1JUM A;  2QCO A;  2G7L A;  5F0C A;  1Z77 A;  4GFK A;  5IPA A;  5HAW A;  1JTX A;  3F0C A;  4ACI A;  3LSJ A;  5DAJ A;  2OF7 A;  1UI6 A;  3BR6 A;  3BR0 A;  2UXH A;  5FKO A;  3VVX A;  3HE0 A;  4ME9 A;  1T33 A;  5F1J A;  2YVE A;  3FIW A;  3Q0W A;  3HGY A;  4YZE A;  1UI5 A;  4D7N A;  2TCT A;  2HYJ A;  2FQ4 A;  1ORK A;  5F27 A;  1JT0 A;  4W1U A;  3V6G A;  5K58 A;  2XGC A;  3LSR A;  2UXI A;  1QVU A;  3VIB A;  4MO7 A;  5FHP A;  1U9O A;  2VKV A;  3HIM A;  3IH2 A;  2RAE A;  4AC6 A;  5GP9 A;  4AF5 A;  4G12 A;  2RHA A;  2DTZ A;  2UXP A;  3Q0U A;  2Y30 A;  5K7Z A;  2TRT A;  2NS8 A;  3QPS A;  3VVY A;  4GCK A;  4XK4 A;  5GPC A;  5D1R A;  2FBQ A;  1A6I A;  3AQS A;  3G7R A;  3FRQ A;  5EZG A;  5K7H A;  2QIB A;  2UXU A;  2QTQ A;  3PPB A;  2DG8 A;  4CGR A;  4I76 A;  2WGB A;  2IU5 A;  3HTI A;  3BRU A;  1RPW A;  3RD3 A;  2FD5 A;  2IAI A;  2HXO A;  3EUP A;  1QVT A;  2ID3 A;  4GCL A;  3IH4 A;  3MNL A;  3VW0 A;  4V2G A;  2OI8 A;  2ZOY A;  4I6Z A;  4MK6 A;  5FMP A;  4X1E A;  2QKO A;  3Q3S A;  5FKK A;  1JUS A;  3NNR A;  3KZ9 A;  2ZCX A;  3O60 A;  4GCT A;  4M3B A;  4PXI A;  5F08 A;  2ZB9 A;  2G7G A;  3PM1 A;  3ZQF A;  2HXI A;  3ZQI A;  2XRL A;  2I10 A;  3GZI A;  2JK3 A;  5IOY A;  3QBM A;  4M3G A;  3VP5 A;  4NN1 A;  3LJL A;  4UDS A;  3C07 A;  3BQZ A;  3ON2 A;  4B1R A;  5D18 A;  2NX4 A;  5K7F A;  2O7O A;  2GBY A;  3JSJ A;  3VOK A;  2F07 A;  3BTL A;  3S5R A;  3NXC A;  3EGQ A;  4L62 A;  3CCY A;  2QOP A;  3BTC A;  3IH3 A;  2RAS A;  2GEN A;  3BQY A;  1JT6 A;  3IUV A;  4JNN A;  3HTA A;  2OER A;  3NRG A;  3BNI A;  2FJ1 A;  2V57 A;  3KKC A;  3LHQ A;  3LOC A;  2XGE A;  2VKE A;  5EFY A;  3QKX A;  3KKD A;  2Q24 A;  3B6C A;  4DW6 A;  5C4Y A;  5FKM A;  2G7S A;  2HYT A;  4AUX A;  3WHC A;  4B3A A;  5D19 A;  3TP0 A;  4M3F A;  5GPA A;  2X9D A;  3DEW A;  2EH3 A;  4JYK A;  3TP3 A;  4M3D A;  5J1Y A;  3BR3 A;  3FK6 A;  4W97 A;  2HQ5 A;  2JJ7 A;  3VW2 A;  2PBX A;  5EZH A;  5HSZ A;  5FKN A;  2GUH A;  3DPJ A;  3F1B A;  2Y31 A;  4AC0 A;  2QWT A;  2W53 A;  3HGG A;  3QPL A;  2G0E A;  1U9N A; 
#chains in the Genus database with same CATH topology
 3O8G A;  3RH2 A;  3VOX A;  4HKU A;  3BTJ A;  3B6A A;  2ZCM A;  1ZKG A;  2XB5 A;  3BTI A;  3PAS A;  2R7W A;  1T56 A;  2UXO A;  3ANG A;  5F0F A;  5J3L A;  3GEU A;  3VUQ A;  2R7T A;  4ICH A;  2FX0 A;  2D6Y A;  3HTH A;  3BT9 A;  1JUP A;  2WUI A;  1ZK8 A;  3VW1 A;  3VVZ A;  5J1R A;  2XPU A;  3SFI A;  4D5F A;  2XGD A;  3SWH A;  2DG7 A;  2YVH A;  2NP3 A;  3AQT A;  3QQA A;  3ZQL A;  4JL3 A;  1SGM A;  2ID6 A;  3P9T A;  2B3W A;  3HTJ A;  3BHQ A;  4D7M A;  2PZ9 A;  2XDN A;  3ANP A;  3BCG A;  2GFN A;  5F0H A;  3ZQG A;  3O8H A;  2XPV A;  3SDG A;  2NS7 A;  3CDL A;  3LWJ A;  1VI0 A;  3CWR A;  3CJD A;  3G1M A;  3C2B A;  4M3E A;  5AQC A;  3K8P C;  5IOZ A;  4U9N A;  3DCF A;  3T6N A;  3ON4 A;  5CXI A;  3KNW A;  3NPI A;  2NP5 A;  2G3B A;  2REK A;  2Y2Z A;  3BJB A;  4V2F A;  3FHN A;  4ABZ A;  4JKZ A;  5FGL A;  3FK7 A;  4OD4 A;  3G56 A;  2R7Q A;  2HKU A;  1QPI A;  1BJZ A;  2ZOZ A;  3Q0V A;  5IP6 A;  2ZCN A;  3BR1 A;  3MVP A;  5F04 A;  2VPR A;  3G1O A;  4U9L A;  3CRJ A;  5EYR A;  2O7T A;  4MXM A;  3BR2 A;  3B81 A;  3BR5 A;  4IRV A;  2IEK A;  3VTI A;  4C2M A;  3E7Q A;  2WV1 A;  3V78 A;  3VPR A;  2XPW A;  5H9T A;  2OPT A;  2X6O A;  3WHB A;  2R7V A;  5J1U A;  1RKW A;  4NEL A;  1RKT A;  5FKL A;  2PFV A;  2YVX A;  3G1L A;  4KWA A;  3LSP A;  1JTY A;  1Z0X A;  2IBD A;  4GFL A;  3ZQH A;  4D5C A;  5HBU A;  3COL A;  5CXG A;  3NI7 A;  5CW8 A;  1JUM A;  4WIB A;  2QCO A;  2G7L A;  5F0C A;  1Z77 A;  4GFK A;  5IPA A;  5HAW A;  1JTX A;  3F0C A;  4ACI A;  3LSJ A;  5DAJ A;  2OF7 A;  1UI6 A;  3BR6 A;  2R7S A;  3BR0 A;  2UXH A;  5FKO A;  3VVX A;  3HE0 A;  4ME9 A;  1T33 A;  5F1J A;  2YVE A;  3FIW A;  3Q0W A;  3HGY A;  4YZE A;  1UI5 A;  4D7N A;  2TCT A;  2HYJ A;  2FQ4 A;  1ORK A;  5F27 A;  1JT0 A;  4W1U A;  3V6G A;  2B1E A;  5CQG A;  5K58 A;  2XGC A;  3LSR A;  2UXI A;  1QVU A;  3VIB A;  4MO7 A;  5FHP A;  1U9O A;  2VKV A;  3HIM A;  3IH2 A;  2RAE A;  4AC6 A;  5GP9 A;  4AF5 A;  4G12 A;  2RHA A;  2DTZ A;  2UXP A;  3Q0U A;  2Y30 A;  5K7Z A;  2TRT A;  2NS8 A;  3QPS A;  3VVY A;  2FJI 1;  4GCK A;  4XK4 A;  5GPC A;  5D1R A;  2FBQ A;  4OD5 A;  1A6I A;  3AQS A;  3G7R A;  3FRQ A;  5EZG A;  2R7U A;  5K7H A;  2QIB A;  2UXU A;  2QTQ A;  3PPB A;  2DG8 A;  4CGR A;  3DU6 A;  4I76 A;  2WGB A;  2IU5 A;  3HTI A;  3BRU A;  1RPW A;  3RD3 A;  2FD5 A;  2IAI A;  2HXO A;  3EUP A;  1QVT A;  2ID3 A;  4GCL A;  3IH4 A;  3MNL A;  3VW0 A;  4V2G A;  2OI8 A;  2ZOY A;  4I6Z A;  4MK6 A;  4DVY P;  5FMP A;  3KYL A;  4X1E A;  2QKO A;  3Q3S A;  5FKK A;  1JUS A;  3NNR A;  3KZ9 A;  2ZCX A;  3O60 A;  4GCT A;  4M3B A;  4PXI A;  5F08 A;  2ZB9 A;  2G7G A;  3PM1 A;  3ZQF A;  2HXI A;  3ZQI A;  2XRL A;  2I10 A;  3GZI A;  2JK3 A;  5IOY A;  3QBM A;  4M3G A;  3VP5 A;  4NN1 A;  3LJL A;  4UDS A;  3C07 A;  2R7R A;  3BQZ A;  3ON2 A;  4B1R A;  5D18 A;  2NX4 A;  5K7F A;  2O7O A;  2GBY A;  3DU5 A;  3JSJ A;  3VOK A;  2F07 A;  3BTL A;  3S5R A;  3NXC A;  3NS4 A;  3EGQ A;  2R7O A;  4L62 A;  3CCY A;  2QOP A;  3BTC A;  3IH3 A;  2RAS A;  2GEN A;  3BQY A;  2R7X A;  1JT6 A;  3IUV A;  4JNN A;  3HTA A;  2OER A;  3NRG A;  3BNI A;  2FJ1 A;  2V57 A;  3KKC A;  3LHQ A;  3LOC A;  2XGE A;  2VKE A;  5EFY A;  3QKX A;  3KKD A;  2Q24 A;  3B6C A;  4DW6 A;  5C4Y A;  5FKM A;  2G7S A;  2HYT A;  4AUX A;  3WHC A;  4B3A A;  5D19 A;  3TP0 A;  4M3F A;  5GPA A;  2A2F X;  2X9D A;  3DEW A;  2EH3 A;  4JYK A;  3TP3 A;  4M3D A;  2ZY9 A;  5J1Y A;  3BR3 A;  3FK6 A;  4W97 A;  2HQ5 A;  2JJ7 A;  3VW2 A;  2PBX A;  5EZH A;  5HSZ A;  5FKN A;  2GUH A;  3DPJ A;  3F1B A;  2Y31 A;  4AC0 A;  2QWT A;  2W53 A;  3HGG A;  3QPL A;  2G0E A;  1U9N A; 
#chains in the Genus database with same CATH homology
 3O8G A;  3RH2 A;  3VOX A;  4HKU A;  3BTJ A;  3B6A A;  2ZCM A;  1ZKG A;  2XB5 A;  3BTI A;  3PAS A;  1T56 A;  2UXO A;  3ANG A;  5F0F A;  5J3L A;  3GEU A;  3VUQ A;  4ICH A;  2FX0 A;  2D6Y A;  3HTH A;  3BT9 A;  1JUP A;  2WUI A;  1ZK8 A;  3VW1 A;  3VVZ A;  5J1R A;  2XPU A;  3SFI A;  4D5F A;  2XGD A;  2DG7 A;  2YVH A;  2NP3 A;  3AQT A;  3QQA A;  3ZQL A;  4JL3 A;  1SGM A;  2ID6 A;  3P9T A;  3HTJ A;  3BHQ A;  4D7M A;  2PZ9 A;  2XDN A;  3ANP A;  3BCG A;  2GFN A;  5F0H A;  3ZQG A;  3O8H A;  2XPV A;  3SDG A;  2NS7 A;  3CDL A;  3LWJ A;  1VI0 A;  3CWR A;  3CJD A;  3G1M A;  3C2B A;  4M3E A;  5AQC A;  5IOZ A;  3DCF A;  3T6N A;  3ON4 A;  5CXI A;  3KNW A;  3NPI A;  2NP5 A;  2G3B A;  2REK A;  2Y2Z A;  3BJB A;  4V2F A;  4ABZ A;  4JKZ A;  5FGL A;  3FK7 A;  3G56 A;  1QPI A;  2HKU A;  1BJZ A;  2ZOZ A;  3Q0V A;  5IP6 A;  2ZCN A;  3BR1 A;  3MVP A;  5F04 A;  2VPR A;  3G1O A;  3CRJ A;  5EYR A;  2O7T A;  4MXM A;  3BR2 A;  3B81 A;  3BR5 A;  2IEK A;  3E7Q A;  2WV1 A;  3V78 A;  3VPR A;  2XPW A;  5H9T A;  2OPT A;  2X6O A;  3WHB A;  5J1U A;  1RKW A;  4NEL A;  1RKT A;  5FKL A;  3G1L A;  4KWA A;  3LSP A;  1JTY A;  1Z0X A;  2IBD A;  4GFL A;  3ZQH A;  4D5C A;  5HBU A;  3COL A;  5CXG A;  3NI7 A;  5CW8 A;  1JUM A;  2QCO A;  2G7L A;  5F0C A;  1Z77 A;  4GFK A;  5IPA A;  5HAW A;  1JTX A;  3F0C A;  4ACI A;  3LSJ A;  5DAJ A;  2OF7 A;  1UI6 A;  3BR6 A;  3BR0 A;  2UXH A;  5FKO A;  3VVX A;  3HE0 A;  4ME9 A;  1T33 A;  5F1J A;  2YVE A;  3FIW A;  3Q0W A;  3HGY A;  4YZE A;  1UI5 A;  4D7N A;  2TCT A;  2HYJ A;  2FQ4 A;  1ORK A;  5F27 A;  1JT0 A;  4W1U A;  3V6G A;  5K58 A;  2XGC A;  3LSR A;  2UXI A;  1QVU A;  3VIB A;  4MO7 A;  5FHP A;  1U9O A;  2VKV A;  3HIM A;  3IH2 A;  2RAE A;  4AC6 A;  5GP9 A;  4AF5 A;  4G12 A;  2RHA A;  2DTZ A;  2UXP A;  3Q0U A;  2Y30 A;  5K7Z A;  2TRT A;  2NS8 A;  3QPS A;  3VVY A;  4GCK A;  4XK4 A;  5GPC A;  5D1R A;  2FBQ A;  1A6I A;  3AQS A;  3G7R A;  3FRQ A;  5EZG A;  5K7H A;  2QIB A;  2UXU A;  2QTQ A;  3PPB A;  2DG8 A;  4CGR A;  4I76 A;  2WGB A;  2IU5 A;  3HTI A;  3BRU A;  1RPW A;  3RD3 A;  2FD5 A;  2IAI A;  2HXO A;  3EUP A;  1QVT A;  2ID3 A;  4GCL A;  3IH4 A;  3MNL A;  3VW0 A;  4V2G A;  2OI8 A;  2ZOY A;  4I6Z A;  4MK6 A;  5FMP A;  4X1E A;  2QKO A;  3Q3S A;  5FKK A;  1JUS A;  3NNR A;  3KZ9 A;  2ZCX A;  3O60 A;  4GCT A;  4M3B A;  4PXI A;  5F08 A;  2ZB9 A;  2G7G A;  3PM1 A;  3ZQF A;  2HXI A;  3ZQI A;  2XRL A;  2I10 A;  3GZI A;  2JK3 A;  5IOY A;  3QBM A;  4M3G A;  3VP5 A;  4NN1 A;  3LJL A;  4UDS A;  3C07 A;  3BQZ A;  3ON2 A;  4B1R A;  5D18 A;  2NX4 A;  5K7F A;  2O7O A;  2GBY A;  3JSJ A;  3VOK A;  2F07 A;  3BTL A;  3S5R A;  3NXC A;  3EGQ A;  4L62 A;  3CCY A;  2QOP A;  3BTC A;  3IH3 A;  2RAS A;  2GEN A;  3BQY A;  1JT6 A;  3IUV A;  4JNN A;  3HTA A;  2OER A;  3NRG A;  3BNI A;  2FJ1 A;  2V57 A;  3KKC A;  3LHQ A;  3LOC A;  2XGE A;  2VKE A;  5EFY A;  3QKX A;  3KKD A;  2Q24 A;  3B6C A;  4DW6 A;  5C4Y A;  5FKM A;  2G7S A;  2HYT A;  4AUX A;  3WHC A;  4B3A A;  5D19 A;  3TP0 A;  4M3F A;  5GPA A;  2X9D A;  3DEW A;  2EH3 A;  4JYK A;  3TP3 A;  4M3D A;  5J1Y A;  3BR3 A;  3FK6 A;  4W97 A;  2HQ5 A;  2JJ7 A;  3VW2 A;  2PBX A;  5EZH A;  5HSZ A;  5FKN A;  2GUH A;  3DPJ A;  3F1B A;  2Y31 A;  4AC0 A;  2QWT A;  2W53 A;  3HGG A;  3QPL A;  2G0E A;  1U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...