4GFKA

Structures of no factors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
184
Chain Sequence
NRREEILQALAEMLESNITTAKLAKQVGVSEAALYRHFPSKTRMFEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAERNPGLTRILSGHALMFENERLRDRINQLFERIETSLRQILRERKLREGKSFPVDENILAAQLLGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoid occlusion factor SlmA
publication title SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Dna binding protein
total genus 75
structure length 184
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4gfkA00
3BTCA 2G3BA 5FKMA 5FGLA 4AC6A 2GBYA 4UDSA 3ANGA 3LOCA 2UXIA 3NI7A 3PPBA 1Z77A 3DPJA 3VVYA 2FD5A 4NN1A 2OF7A 2XGDA 5K7ZA 3PM1A 3BR6A 3ZQLA 2ZCNA 5J3LA 3BHQA 1Z0XA 2UXPA 3EGQA 3P9TA 2ZB9A 3ON2A 3BTJA 3LWJA 5CXIA 5IPAA 2OI8A 2XPUA 2QKOA 5F27A 3SFIA 5D19A 2V57A 3VVXA 2D6YA 5EZHA 2NP3A 3HE0A 3WHCA 3QPLA 5DAJA 2ZCXA 4GFKA 4ACIA 3KKDA 4GCLA 3QBMA 2O7OA 5F0CA 2Y2ZA 3LSJA 3LSPA 3BQYA 3TP0A 4MO7A 1QVUA 3ZQGA 4M3FA 3BNIA 3ZQFA 2QCOA 2I10A 2IU5A 2VKEA 3QKXA 5J1UA 3CDLA 1RKTA 4D7NA 2REKA 2UXOA 3G1MA 3G1OA 1T56A 3Q0VA 3HTJA 3DCFA 3FIWA 4M3GA 3DEWA 5CW8A 3HTIA 3GZIA 3F0CA 4JYKA 4AC0A 5C4YA 4ICHA 3F1BA 2HKUA 3C07A 3BR3A 4X1EA 4D7MA 2NP5A 3CRJA 3VPRA 1BJZA 3VW0A 2IAIA 3ANPA 2RASA 3S5RA 5FHPA 3RH2A 1RKWA 3NRGA 3RD3A 5H9TA 5EYRA 3VOXA 3AQSA 4DW6A 3BR2A 2XB5A 4YZEA 3C2BA 3FRQA 3BTLA 4NELA 4GFLA 2GENA 4GCTA 2XGEA 3Q3SA 3SDGA 3FK7A 1UI5A 3G56A 2HYJA 3BR1A 5EFYA 2GFNA 5HSZA 3G1LA 2JJ7A 3B81A 2QOPA 3HTHA 3O60A 3PASA 3CJDA 3VVZA 4W1UA 2Y30A 2JK3A 2O7TA 2EH3A 3BR5A 1UI6A 3LJLA 5FKLA 2DG8A 2G7GA 3ZQIA 2HXIA 2HYTA 1T33A 5K58A 2G7LA 2PZ9A 2ID6A 2W53A 4B1RA 3LSRA 2X9DA 3MNLA 3Q0WA 3COLA 5F04A 5D1RA 3VIBA 1VI0A 3QQAA 5AQCA 5FKOA 4ME9A 4B3AA 5HAWA 5F1JA 5GP9A 3G7RA 5HBUA 3IH3A 1RPWA 1JUMA 4D5FA 3NXCA 1ZK8A 3B6AA 1JT6A 2QWTA 2WV1A 3VP5A 2PBXA 3IH2A 4G12A 3IUVA 2TCTA 5F08A 3V78A 3EUPA 3CWRA 2XRLA 4JKZA 4M3BA 4M3EA 4CGRA 1U9NA 2DG7A 4MK6A 3BTIA 1U9OA 2IEKA 2HXOA 2VKVA 1JUPA 3GEUA 2GUHA 4MXMA 3QPSA 1JTXA 3O8HA 2UXHA 2NS7A 2Q24A 2YVEA 4D5CA 5J1RA 3BJBA 2XPWA 2F07A 2FJ1A 3MVPA 3O8GA 3T6NA 5GPAA 2QIBA 2FX0A 2FBQA 3HGYA 3BRUA 4JNNA 3V6GA 2X6OA 2FQ4A 3KZ9A 2ID3A 2Y31A 5CXGA 2XPVA 2NX4A 4PXIA 4V2GA 1JT0A 4GCKA 2NS8A 3LHQA 4HKUA 5FMPA 4W97A 4AF5A 3BCGA 2RAEA 3JSJA 3E7QA 3NPIA 2ZOZA 2OPTA 4V2FA 1QVTA 2IBDA 3Q0UA 5D18A 3TP3A 2RHAA 3BR0A 2ZCMA 3BQZA 2DTZA 5K7FA 1JUSA 5F0HA 1QPIA 1SGMA 3IH4A 3ON4A 4I6ZA 3KKCA 1JTYA 3VOKA 3B6CA 2XDNA 5EZGA 3VW1A 1ORKA 2ZOYA 3CCYA 3VW2A 5J1YA 2HQ5A 2YVHA 5K7HA 5IOZA 3ZQHA 2QTQA 4M3DA 2XGCA 2OERA 4I76A 1A6IA 5IOYA 3FK6A 2G0EA 3KNWA 4JL3A 3HIMA 3NNRA 4KWAA 4XK4A 4AUXA 5FKNA 1ZKGA 5F0FA 4L62A 5GPCA 3AQTA 2TRTA 3HTAA 4ABZA 2G7SA 2WUIA 2WGBA 3WHBA 2UXUA 2VPRA 3VUQA 5IP6A 3HGGA 3BT9A 5FKKA
chains in the Genus database with same CATH superfamily
3BTCA 2G3BA 5FKMA 5FGLA 4AC6A 2GBYA 4UDSA 3ANGA 3LOCA 2UXIA 3NI7A 3PPBA 2R7RA 1Z77A 3DPJA 3VVYA 2FD5A 4NN1A 2OF7A 2XGDA 5K7ZA 3PM1A 3BR6A 3ZQLA 2ZCNA 5J3LA 3BHQA 1Z0XA 2UXPA 3EGQA 3P9TA 4WIBA 2ZB9A 2R7UA 3ON2A 3BTJA 3LWJA 5CXIA 5IPAA 2OI8A 2XPUA 2QKOA 5F27A 3SFIA 5D19A 2V57A 3VVXA 2D6YA 5EZHA 2NP3A 3HE0A 3WHCA 3QPLA 5DAJA 2ZCXA 4GFKA 3VTIA 4ACIA 3KKDA 4GCLA 3QBMA 2O7OA 5F0CA 2Y2ZA 3LSJA 3LSPA 3BQYA 3TP0A 4MO7A 1QVUA 3ZQGA 4M3FA 4OD5A 3BNIA 3ZQFA 2QCOA 2I10A 2IU5A 2VKEA 3QKXA 5J1UA 3NS4A 3CDLA 1RKTA 4D7NA 2REKA 2UXOA 3G1MA 3KYLA 3G1OA 1T56A 3Q0VA 3HTJA 3DCFA 4DVYP 3FIWA 4M3GA 3DEWA 5CW8A 3HTIA 3GZIA 3F0CA 4JYKA 4AC0A 5C4YA 4ICHA 3F1BA 4C2MA 2HKUA 3C07A 3BR3A 4X1EA 4D7MA 2NP5A 3CRJA 3VPRA 1BJZA 3VW0A 2IAIA 3ANPA 2RASA 3S5RA 2R7SA 5FHPA 3RH2A 1RKWA 3NRGA 3RD3A 5H9TA 5EYRA 3VOXA 3AQSA 4DW6A 3BR2A 2XB5A 4YZEA 3C2BA 3FRQA 3BTLA 4NELA 4GFLA 2GENA 4GCTA 2XGEA 3Q3SA 3SDGA 3FK7A 1UI5A 3G56A 2HYJA 3BR1A 5EFYA 2GFNA 5HSZA 2ZY9A 3G1LA 2JJ7A 3B81A 2QOPA 3HTHA 3O60A 3PASA 3CJDA 3VVZA 4W1UA 2Y30A 3K8PC 2JK3A 2O7TA 2EH3A 3BR5A 1UI6A 3LJLA 5FKLA 2DG8A 2G7GA 2A2FX 3ZQIA 2HXIA 2HYTA 1T33A 5K58A 2G7LA 2PZ9A 2ID6A 2W53A 4B1RA 3LSRA 2X9DA 3MNLA 3Q0WA 3COLA 5F04A 5D1RA 3VIBA 1VI0A 3QQAA 3DU6A 5AQCA 5FKOA 4ME9A 4B3AA 5HAWA 5F1JA 5GP9A 3G7RA 5HBUA 3IH3A 1RPWA 1JUMA 4D5FA 3NXCA 1ZK8A 3B6AA 1JT6A 2QWTA 2WV1A 3VP5A 2PBXA 3IH2A 2YVXA 4G12A 3IUVA 3SWHA 2TCTA 5F08A 3V78A 3EUPA 3CWRA 2XRLA 4JKZA 2R7XA 4M3BA 4M3EA 4CGRA 2B3WA 1U9NA 2DG7A 4MK6A 4IRVA 3BTIA 1U9OA 2IEKA 2HXOA 2VKVA 1JUPA 3GEUA 2GUHA 4MXMA 3QPSA 1JTXA 4OD4A 3O8HA 2UXHA 2NS7A 2Q24A 2YVEA 4D5CA 5J1RA 2B1EA 3BJBA 2XPWA 2R7VA 2F07A 2FJ1A 3MVPA 3O8GA 3T6NA 5GPAA 2PFVA 2QIBA 2FX0A 2FBQA 3HGYA 3BRUA 4JNNA 3V6GA 2X6OA 2FQ4A 3KZ9A 4U9LA 2ID3A 2Y31A 2R7OA 5CXGA 2XPVA 2NX4A 4PXIA 4V2GA 1JT0A 4GCKA 2NS8A 3LHQA 5CQGA 4HKUA 5FMPA 4W97A 4AF5A 3BCGA 2RAEA 3JSJA 3E7QA 3NPIA 2ZOZA 2OPTA 4V2FA 1QVTA 3DU5A 2IBDA 4U9NA 3Q0UA 5D18A 3TP3A 2RHAA 3BR0A 2ZCMA 3BQZA 2DTZA 5K7FA 3FHNA 1JUSA 5F0HA 1QPIA 1SGMA 3IH4A 3ON4A 4I6ZA 3KKCA 1JTYA 3VOKA 3B6CA 2XDNA 5EZGA 3VW1A 1ORKA 2ZOYA 3CCYA 3VW2A 5J1YA 2HQ5A 2YVHA 5K7HA 5IOZA 3ZQHA 2QTQA 4M3DA 2XGCA 2OERA 4I76A 1A6IA 5IOYA 3FK6A 2G0EA 3KNWA 4JL3A 3HIMA 3NNRA 4KWAA 4XK4A 4AUXA 5FKNA 1ZKGA 5F0FA 2R7QA 4L62A 5GPCA 3AQTA 2TRTA 3HTAA 4ABZA 2G7SA 2WUIA 2WGBA 2FJI1 3WHBA 2UXUA 2R7WA 2VPRA 3VUQA 5IP6A 3HGGA 2R7TA 3BT9A 5FKKA
chains in the Genus database with same CATH topology
3BTCA 2G3BA 5FKMA 5FGLA 4AC6A 2GBYA 4UDSA 3ANGA 3LOCA 2UXIA 3NI7A 3PPBA 1Z77A 3DPJA 3VVYA 2FD5A 4NN1A 2OF7A 2XGDA 5K7ZA 3PM1A 3BR6A 3ZQLA 2ZCNA 5J3LA 3BHQA 1Z0XA 2UXPA 3EGQA 3P9TA 2ZB9A 3ON2A 3BTJA 3LWJA 5CXIA 5IPAA 2OI8A 2XPUA 2QKOA 5F27A 3SFIA 5D19A 2V57A 3VVXA 2D6YA 5EZHA 2NP3A 3HE0A 3WHCA 3QPLA 5DAJA 2ZCXA 4GFKA 4ACIA 3KKDA 4GCLA 3QBMA 2O7OA 5F0CA 2Y2ZA 3LSJA 3LSPA 3BQYA 3TP0A 4MO7A 1QVUA 3ZQGA 4M3FA 3BNIA 3ZQFA 2QCOA 2I10A 2IU5A 2VKEA 3QKXA 5J1UA 3CDLA 1RKTA 4D7NA 2REKA 2UXOA 3G1MA 3G1OA 1T56A 3Q0VA 3HTJA 3DCFA 3FIWA 4M3GA 3DEWA 5CW8A 3HTIA 3GZIA 3F0CA 4JYKA 4AC0A 5C4YA 4ICHA 3F1BA 2HKUA 3C07A 3BR3A 4X1EA 4D7MA 2NP5A 3CRJA 3VPRA 1BJZA 3VW0A 2IAIA 3ANPA 2RASA 3S5RA 5FHPA 3RH2A 1RKWA 3NRGA 3RD3A 5H9TA 5EYRA 3VOXA 3AQSA 4DW6A 3BR2A 2XB5A 4YZEA 3C2BA 3FRQA 3BTLA 4NELA 4GFLA 2GENA 4GCTA 2XGEA 3Q3SA 3SDGA 3FK7A 1UI5A 3G56A 2HYJA 3BR1A 5EFYA 2GFNA 5HSZA 3G1LA 2JJ7A 3B81A 2QOPA 3HTHA 3O60A 3PASA 3CJDA 3VVZA 4W1UA 2Y30A 2JK3A 2O7TA 2EH3A 3BR5A 1UI6A 3LJLA 5FKLA 2DG8A 2G7GA 3ZQIA 2HXIA 2HYTA 1T33A 5K58A 2G7LA 2PZ9A 2ID6A 2W53A 4B1RA 3LSRA 2X9DA 3MNLA 3Q0WA 3COLA 5F04A 5D1RA 3VIBA 1VI0A 3QQAA 5AQCA 5FKOA 4ME9A 4B3AA 5HAWA 5F1JA 5GP9A 3G7RA 5HBUA 3IH3A 1RPWA 1JUMA 4D5FA 3NXCA 1ZK8A 3B6AA 1JT6A 2QWTA 2WV1A 3VP5A 2PBXA 3IH2A 4G12A 3IUVA 2TCTA 5F08A 3V78A 3EUPA 3CWRA 2XRLA 4JKZA 4M3BA 4M3EA 4CGRA 1U9NA 2DG7A 4MK6A 3BTIA 1U9OA 2IEKA 2HXOA 2VKVA 1JUPA 3GEUA 2GUHA 4MXMA 3QPSA 1JTXA 3O8HA 2UXHA 2NS7A 2Q24A 2YVEA 4D5CA 5J1RA 3BJBA 2XPWA 2F07A 2FJ1A 3MVPA 3O8GA 3T6NA 5GPAA 2QIBA 2FX0A 2FBQA 3HGYA 3BRUA 4JNNA 3V6GA 2X6OA 2FQ4A 3KZ9A 2ID3A 2Y31A 5CXGA 2XPVA 2NX4A 4PXIA 4V2GA 1JT0A 4GCKA 2NS8A 3LHQA 4HKUA 5FMPA 4W97A 4AF5A 3BCGA 2RAEA 3JSJA 3E7QA 3NPIA 2ZOZA 2OPTA 4V2FA 1QVTA 2IBDA 3Q0UA 5D18A 3TP3A 2RHAA 3BR0A 2ZCMA 3BQZA 2DTZA 5K7FA 1JUSA 5F0HA 1QPIA 1SGMA 3IH4A 3ON4A 4I6ZA 3KKCA 1JTYA 3VOKA 3B6CA 2XDNA 5EZGA 3VW1A 1ORKA 2ZOYA 3CCYA 3VW2A 5J1YA 2HQ5A 2YVHA 5K7HA 5IOZA 3ZQHA 2QTQA 4M3DA 2XGCA 2OERA 4I76A 1A6IA 5IOYA 3FK6A 2G0EA 3KNWA 4JL3A 3HIMA 3NNRA 4KWAA 4XK4A 4AUXA 5FKNA 1ZKGA 5F0FA 4L62A 5GPCA 3AQTA 2TRTA 3HTAA 4ABZA 2G7SA 2WUIA 2WGBA 3WHBA 2UXUA 2VPRA 3VUQA 5IP6A 3HGGA 3BT9A 5FKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTC A;  2G3B A;  5FKM A;  5FGL A;  4AC6 A;  2GBY A;  4UDS A;  3ANG A;  3LOC A;  2UXI A;  3NI7 A;  3PPB A;  1Z77 A;  3DPJ A;  3VVY A;  2FD5 A;  4NN1 A;  2OF7 A;  2XGD A;  5K7Z A;  3PM1 A;  3BR6 A;  3ZQL A;  2ZCN A;  5J3L A;  3BHQ A;  1Z0X A;  2UXP A;  3EGQ A;  3P9T A;  2ZB9 A;  3ON2 A;  3BTJ A;  3LWJ A;  5CXI A;  5IPA A;  2OI8 A;  2XPU A;  2QKO A;  5F27 A;  3SFI A;  5D19 A;  2V57 A;  3VVX A;  2D6Y A;  5EZH A;  2NP3 A;  3HE0 A;  3WHC A;  3QPL A;  5DAJ A;  2ZCX A;  4GFK A;  4ACI A;  3KKD A;  4GCL A;  3QBM A;  2O7O A;  5F0C A;  2Y2Z A;  3LSJ A;  3LSP A;  3BQY A;  3TP0 A;  4MO7 A;  1QVU A;  3ZQG A;  4M3F A;  3BNI A;  3ZQF A;  2QCO A;  2I10 A;  2IU5 A;  2VKE A;  3QKX A;  5J1U A;  3CDL A;  1RKT A;  4D7N A;  2REK A;  2UXO A;  3G1M A;  3G1O A;  1T56 A;  3Q0V A;  3HTJ A;  3DCF A;  3FIW A;  4M3G A;  3DEW A;  5CW8 A;  3HTI A;  3GZI A;  3F0C A;  4JYK A;  4AC0 A;  5C4Y A;  4ICH A;  3F1B A;  2HKU A;  3C07 A;  3BR3 A;  4X1E A;  4D7M A;  2NP5 A;  3CRJ A;  3VPR A;  1BJZ A;  3VW0 A;  2IAI A;  3ANP A;  2RAS A;  3S5R A;  5FHP A;  3RH2 A;  1RKW A;  3NRG A;  3RD3 A;  5H9T A;  5EYR A;  3VOX A;  3AQS A;  4DW6 A;  3BR2 A;  2XB5 A;  4YZE A;  3C2B A;  3FRQ A;  3BTL A;  4NEL A;  4GFL A;  2GEN A;  4GCT A;  2XGE A;  3Q3S A;  3SDG A;  3FK7 A;  1UI5 A;  3G56 A;  2HYJ A;  3BR1 A;  5EFY A;  2GFN A;  5HSZ A;  3G1L A;  2JJ7 A;  3B81 A;  2QOP A;  3HTH A;  3O60 A;  3PAS A;  3CJD A;  3VVZ A;  4W1U A;  2Y30 A;  2JK3 A;  2O7T A;  2EH3 A;  3BR5 A;  1UI6 A;  3LJL A;  5FKL A;  2DG8 A;  2G7G A;  3ZQI A;  2HXI A;  2HYT A;  1T33 A;  5K58 A;  2G7L A;  2PZ9 A;  2ID6 A;  2W53 A;  4B1R A;  3LSR A;  2X9D A;  3MNL A;  3Q0W A;  3COL A;  5F04 A;  5D1R A;  3VIB A;  1VI0 A;  3QQA A;  5AQC A;  5FKO A;  4ME9 A;  4B3A A;  5HAW A;  5F1J A;  5GP9 A;  3G7R A;  5HBU A;  3IH3 A;  1RPW A;  1JUM A;  4D5F A;  3NXC A;  1ZK8 A;  3B6A A;  1JT6 A;  2QWT A;  2WV1 A;  3VP5 A;  2PBX A;  3IH2 A;  4G12 A;  3IUV A;  2TCT A;  5F08 A;  3V78 A;  3EUP A;  3CWR A;  2XRL A;  4JKZ A;  4M3B A;  4M3E A;  4CGR A;  1U9N A;  2DG7 A;  4MK6 A;  3BTI A;  1U9O A;  2IEK A;  2HXO A;  2VKV A;  1JUP A;  3GEU A;  2GUH A;  4MXM A;  3QPS A;  1JTX A;  3O8H A;  2UXH A;  2NS7 A;  2Q24 A;  2YVE A;  4D5C A;  5J1R A;  3BJB A;  2XPW A;  2F07 A;  2FJ1 A;  3MVP A;  3O8G A;  3T6N A;  5GPA A;  2QIB A;  2FX0 A;  2FBQ A;  3HGY A;  3BRU A;  4JNN A;  3V6G A;  2X6O A;  2FQ4 A;  3KZ9 A;  2ID3 A;  2Y31 A;  5CXG A;  2XPV A;  2NX4 A;  4PXI A;  4V2G A;  1JT0 A;  4GCK A;  2NS8 A;  3LHQ A;  4HKU A;  5FMP A;  4W97 A;  4AF5 A;  3BCG A;  2RAE A;  3JSJ A;  3E7Q A;  3NPI A;  2ZOZ A;  2OPT A;  4V2F A;  1QVT A;  2IBD A;  3Q0U A;  5D18 A;  3TP3 A;  2RHA A;  3BR0 A;  2ZCM A;  3BQZ A;  2DTZ A;  5K7F A;  1JUS A;  5F0H A;  1QPI A;  1SGM A;  3IH4 A;  3ON4 A;  4I6Z A;  3KKC A;  1JTY A;  3VOK A;  3B6C A;  2XDN A;  5EZG A;  3VW1 A;  1ORK A;  2ZOY A;  3CCY A;  3VW2 A;  5J1Y A;  2HQ5 A;  2YVH A;  5K7H A;  5IOZ A;  3ZQH A;  2QTQ A;  4M3D A;  2XGC A;  2OER A;  4I76 A;  1A6I A;  5IOY A;  3FK6 A;  2G0E A;  3KNW A;  4JL3 A;  3HIM A;  3NNR A;  4KWA A;  4XK4 A;  4AUX A;  5FKN A;  1ZKG A;  5F0F A;  4L62 A;  5GPC A;  3AQT A;  2TRT A;  3HTA A;  4ABZ A;  2G7S A;  2WUI A;  2WGB A;  3WHB A;  2UXU A;  2VPR A;  3VUQ A;  5IP6 A;  3HGG A;  3BT9 A;  5FKK A; 
#chains in the Genus database with same CATH topology
 3BTC A;  2G3B A;  5FKM A;  5FGL A;  4AC6 A;  2GBY A;  4UDS A;  3ANG A;  3LOC A;  2UXI A;  3NI7 A;  3PPB A;  2R7R A;  1Z77 A;  3DPJ A;  3VVY A;  2FD5 A;  4NN1 A;  2OF7 A;  2XGD A;  5K7Z A;  3PM1 A;  3BR6 A;  3ZQL A;  2ZCN A;  5J3L A;  3BHQ A;  1Z0X A;  2UXP A;  3EGQ A;  3P9T A;  4WIB A;  2ZB9 A;  2R7U A;  3ON2 A;  3BTJ A;  3LWJ A;  5CXI A;  5IPA A;  2OI8 A;  2XPU A;  2QKO A;  5F27 A;  3SFI A;  5D19 A;  2V57 A;  3VVX A;  2D6Y A;  5EZH A;  2NP3 A;  3HE0 A;  3WHC A;  3QPL A;  5DAJ A;  2ZCX A;  4GFK A;  3VTI A;  4ACI A;  3KKD A;  4GCL A;  3QBM A;  2O7O A;  5F0C A;  2Y2Z A;  3LSJ A;  3LSP A;  3BQY A;  3TP0 A;  4MO7 A;  1QVU A;  3ZQG A;  4M3F A;  4OD5 A;  3BNI A;  3ZQF A;  2QCO A;  2I10 A;  2IU5 A;  2VKE A;  3QKX A;  5J1U A;  3NS4 A;  3CDL A;  1RKT A;  4D7N A;  2REK A;  2UXO A;  3G1M A;  3KYL A;  3G1O A;  1T56 A;  3Q0V A;  3HTJ A;  3DCF A;  4DVY P;  3FIW A;  4M3G A;  3DEW A;  5CW8 A;  3HTI A;  3GZI A;  3F0C A;  4JYK A;  4AC0 A;  5C4Y A;  4ICH A;  3F1B A;  4C2M A;  2HKU A;  3C07 A;  3BR3 A;  4X1E A;  4D7M A;  2NP5 A;  3CRJ A;  3VPR A;  1BJZ A;  3VW0 A;  2IAI A;  3ANP A;  2RAS A;  3S5R A;  2R7S A;  5FHP A;  3RH2 A;  1RKW A;  3NRG A;  3RD3 A;  5H9T A;  5EYR A;  3VOX A;  3AQS A;  4DW6 A;  3BR2 A;  2XB5 A;  4YZE A;  3C2B A;  3FRQ A;  3BTL A;  4NEL A;  4GFL A;  2GEN A;  4GCT A;  2XGE A;  3Q3S A;  3SDG A;  3FK7 A;  1UI5 A;  3G56 A;  2HYJ A;  3BR1 A;  5EFY A;  2GFN A;  5HSZ A;  2ZY9 A;  3G1L A;  2JJ7 A;  3B81 A;  2QOP A;  3HTH A;  3O60 A;  3PAS A;  3CJD A;  3VVZ A;  4W1U A;  2Y30 A;  3K8P C;  2JK3 A;  2O7T A;  2EH3 A;  3BR5 A;  1UI6 A;  3LJL A;  5FKL A;  2DG8 A;  2G7G A;  2A2F X;  3ZQI A;  2HXI A;  2HYT A;  1T33 A;  5K58 A;  2G7L A;  2PZ9 A;  2ID6 A;  2W53 A;  4B1R A;  3LSR A;  2X9D A;  3MNL A;  3Q0W A;  3COL A;  5F04 A;  5D1R A;  3VIB A;  1VI0 A;  3QQA A;  3DU6 A;  5AQC A;  5FKO A;  4ME9 A;  4B3A A;  5HAW A;  5F1J A;  5GP9 A;  3G7R A;  5HBU A;  3IH3 A;  1RPW A;  1JUM A;  4D5F A;  3NXC A;  1ZK8 A;  3B6A A;  1JT6 A;  2QWT A;  2WV1 A;  3VP5 A;  2PBX A;  3IH2 A;  2YVX A;  4G12 A;  3IUV A;  3SWH A;  2TCT A;  5F08 A;  3V78 A;  3EUP A;  3CWR A;  2XRL A;  4JKZ A;  2R7X A;  4M3B A;  4M3E A;  4CGR A;  2B3W A;  1U9N A;  2DG7 A;  4MK6 A;  4IRV A;  3BTI A;  1U9O A;  2IEK A;  2HXO A;  2VKV A;  1JUP A;  3GEU A;  2GUH A;  4MXM A;  3QPS A;  1JTX A;  4OD4 A;  3O8H A;  2UXH A;  2NS7 A;  2Q24 A;  2YVE A;  4D5C A;  5J1R A;  2B1E A;  3BJB A;  2XPW A;  2R7V A;  2F07 A;  2FJ1 A;  3MVP A;  3O8G A;  3T6N A;  5GPA A;  2PFV A;  2QIB A;  2FX0 A;  2FBQ A;  3HGY A;  3BRU A;  4JNN A;  3V6G A;  2X6O A;  2FQ4 A;  3KZ9 A;  4U9L A;  2ID3 A;  2Y31 A;  2R7O A;  5CXG A;  2XPV A;  2NX4 A;  4PXI A;  4V2G A;  1JT0 A;  4GCK A;  2NS8 A;  3LHQ A;  5CQG A;  4HKU A;  5FMP A;  4W97 A;  4AF5 A;  3BCG A;  2RAE A;  3JSJ A;  3E7Q A;  3NPI A;  2ZOZ A;  2OPT A;  4V2F A;  1QVT A;  3DU5 A;  2IBD A;  4U9N A;  3Q0U A;  5D18 A;  3TP3 A;  2RHA A;  3BR0 A;  2ZCM A;  3BQZ A;  2DTZ A;  5K7F A;  3FHN A;  1JUS A;  5F0H A;  1QPI A;  1SGM A;  3IH4 A;  3ON4 A;  4I6Z A;  3KKC A;  1JTY A;  3VOK A;  3B6C A;  2XDN A;  5EZG A;  3VW1 A;  1ORK A;  2ZOY A;  3CCY A;  3VW2 A;  5J1Y A;  2HQ5 A;  2YVH A;  5K7H A;  5IOZ A;  3ZQH A;  2QTQ A;  4M3D A;  2XGC A;  2OER A;  4I76 A;  1A6I A;  5IOY A;  3FK6 A;  2G0E A;  3KNW A;  4JL3 A;  3HIM A;  3NNR A;  4KWA A;  4XK4 A;  4AUX A;  5FKN A;  1ZKG A;  5F0F A;  2R7Q A;  4L62 A;  5GPC A;  3AQT A;  2TRT A;  3HTA A;  4ABZ A;  2G7S A;  2WUI A;  2WGB A;  2FJI 1;  3WHB A;  2UXU A;  2R7W A;  2VPR A;  3VUQ A;  5IP6 A;  3HGG A;  2R7T A;  3BT9 A;  5FKK A; 
#chains in the Genus database with same CATH homology
 3BTC A;  2G3B A;  5FKM A;  5FGL A;  4AC6 A;  2GBY A;  4UDS A;  3ANG A;  3LOC A;  2UXI A;  3NI7 A;  3PPB A;  1Z77 A;  3DPJ A;  3VVY A;  2FD5 A;  4NN1 A;  2OF7 A;  2XGD A;  5K7Z A;  3PM1 A;  3BR6 A;  3ZQL A;  2ZCN A;  5J3L A;  3BHQ A;  1Z0X A;  2UXP A;  3EGQ A;  3P9T A;  2ZB9 A;  3ON2 A;  3BTJ A;  3LWJ A;  5CXI A;  5IPA A;  2OI8 A;  2XPU A;  2QKO A;  5F27 A;  3SFI A;  5D19 A;  2V57 A;  3VVX A;  2D6Y A;  5EZH A;  2NP3 A;  3HE0 A;  3WHC A;  3QPL A;  5DAJ A;  2ZCX A;  4GFK A;  4ACI A;  3KKD A;  4GCL A;  3QBM A;  2O7O A;  5F0C A;  2Y2Z A;  3LSJ A;  3LSP A;  3BQY A;  3TP0 A;  4MO7 A;  1QVU A;  3ZQG A;  4M3F A;  3BNI A;  3ZQF A;  2QCO A;  2I10 A;  2IU5 A;  2VKE A;  3QKX A;  5J1U A;  3CDL A;  1RKT A;  4D7N A;  2REK A;  2UXO A;  3G1M A;  3G1O A;  1T56 A;  3Q0V A;  3HTJ A;  3DCF A;  3FIW A;  4M3G A;  3DEW A;  5CW8 A;  3HTI A;  3GZI A;  3F0C A;  4JYK A;  4AC0 A;  5C4Y A;  4ICH A;  3F1B A;  2HKU A;  3C07 A;  3BR3 A;  4X1E A;  4D7M A;  2NP5 A;  3CRJ A;  3VPR A;  1BJZ A;  3VW0 A;  2IAI A;  3ANP A;  2RAS A;  3S5R A;  5FHP A;  3RH2 A;  1RKW A;  3NRG A;  3RD3 A;  5H9T A;  5EYR A;  3VOX A;  3AQS A;  4DW6 A;  3BR2 A;  2XB5 A;  4YZE A;  3C2B A;  3FRQ A;  3BTL A;  4NEL A;  4GFL A;  2GEN A;  4GCT A;  2XGE A;  3Q3S A;  3SDG A;  3FK7 A;  1UI5 A;  3G56 A;  2HYJ A;  3BR1 A;  5EFY A;  2GFN A;  5HSZ A;  3G1L A;  2JJ7 A;  3B81 A;  2QOP A;  3HTH A;  3O60 A;  3PAS A;  3CJD A;  3VVZ A;  4W1U A;  2Y30 A;  2JK3 A;  2O7T A;  2EH3 A;  3BR5 A;  1UI6 A;  3LJL A;  5FKL A;  2DG8 A;  2G7G A;  3ZQI A;  2HXI A;  2HYT A;  1T33 A;  5K58 A;  2G7L A;  2PZ9 A;  2ID6 A;  2W53 A;  4B1R A;  3LSR A;  2X9D A;  3MNL A;  3Q0W A;  3COL A;  5F04 A;  5D1R A;  3VIB A;  1VI0 A;  3QQA A;  5AQC A;  5FKO A;  4ME9 A;  4B3A A;  5HAW A;  5F1J A;  5GP9 A;  3G7R A;  5HBU A;  3IH3 A;  1RPW A;  1JUM A;  4D5F A;  3NXC A;  1ZK8 A;  3B6A A;  1JT6 A;  2QWT A;  2WV1 A;  3VP5 A;  2PBX A;  3IH2 A;  4G12 A;  3IUV A;  2TCT A;  5F08 A;  3V78 A;  3EUP A;  3CWR A;  2XRL A;  4JKZ A;  4M3B A;  4M3E A;  4CGR A;  1U9N A;  2DG7 A;  4MK6 A;  3BTI A;  1U9O A;  2IEK A;  2HXO A;  2VKV A;  1JUP A;  3GEU A;  2GUH A;  4MXM A;  3QPS A;  1JTX A;  3O8H A;  2UXH A;  2NS7 A;  2Q24 A;  2YVE A;  4D5C A;  5J1R A;  3BJB A;  2XPW A;  2F07 A;  2FJ1 A;  3MVP A;  3O8G A;  3T6N A;  5GPA A;  2QIB A;  2FX0 A;  2FBQ A;  3HGY A;  3BRU A;  4JNN A;  3V6G A;  2X6O A;  2FQ4 A;  3KZ9 A;  2ID3 A;  2Y31 A;  5CXG A;  2XPV A;  2NX4 A;  4PXI A;  4V2G A;  1JT0 A;  4GCK A;  2NS8 A;  3LHQ A;  4HKU A;  5FMP A;  4W97 A;  4AF5 A;  3BCG A;  2RAE A;  3JSJ A;  3E7Q A;  3NPI A;  2ZOZ A;  2OPT A;  4V2F A;  1QVT A;  2IBD A;  3Q0U A;  5D18 A;  3TP3 A;  2RHA A;  3BR0 A;  2ZCM A;  3BQZ A;  2DTZ A;  5K7F A;  1JUS A;  5F0H A;  1QPI A;  1SGM A;  3IH4 A;  3ON4 A;  4I6Z A;  3KKC A;  1JTY A;  3VOK A;  3B6C A;  2XDN A;  5EZG A;  3VW1 A;  1ORK A;  2ZOY A;  3CCY A;  3VW2 A;  5J1Y A;  2HQ5 A;  2YVH A;  5K7H A;  5IOZ A;  3ZQH A;  2QTQ A;  4M3D A;  2XGC A;  2OER A;  4I76 A;  1A6I A;  5IOY A;  3FK6 A;  2G0E A;  3KNW A;  4JL3 A;  3HIM A;  3NNR A;  4KWA A;  4XK4 A;  4AUX A;  5FKN A;  1ZKG A;  5F0F A;  4L62 A;  5GPC A;  3AQT A;  2TRT A;  3HTA A;  4ABZ A;  2G7S A;  2WUI A;  2WGB A;  3WHB A;  2UXU A;  2VPR A;  3VUQ A;  5IP6 A;  3HGG A;  3BT9 A;  5FKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...