4GFKA

Structures of no factors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
184
Chain Sequence
NRREEILQALAEMLESNITTAKLAKQVGVSEAALYRHFPSKTRMFEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAERNPGLTRILSGHALMFENERLRDRINQLFERIETSLRQILRERKLREGKSFPVDENILAAQLLGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoid occlusion factor SlmA
publication title SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Dna binding protein
total genus 75
structure length 184
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4gfkA00
5J1YA 5DAJA 3KNWA 3HTAA 4MO7A 4ABZA 4KWAA 5HBUA 3ON2A 3DPJA 2QTQA 3HTJA 2TRTA 2NP5A 3ZQHA 3NNRA 3QPSA 5EFYA 4M3GA 3MVPA 3BJBA 4M3FA 3CCYA 2FJ1A 1U9OA 2IBDA 4W1UA 3Q0WA 2YVEA 3QQAA 3VVZA 3LSPA 3B6CA 1Z0XA 4YZEA 3E7QA 1SGMA 4L62A 3HTIA 3O60A 4GCTA 4D5CA 5HSZA 3BTCA 2X9DA 3Q0UA 4GFLA 2JJ7A 3BR5A 5HAWA 3VW2A 3QKXA 5CW8A 2ID3A 2OF7A 3NPIA 3C2BA 1JTXA 3FIWA 5FKKA 4PXIA 2HXOA 3IUVA 2REKA 4M3EA 3BR2A 3BR0A 2NS8A 2HQ5A 5F0FA 2UXPA 2XDNA 3BHQA 2PZ9A 5F27A 2DG7A 2ZOYA 2VKVA 3G1OA 4ACIA 3V6GA 3KKCA 4JYKA 2V57A 3VIBA 5K7ZA 5D1RA 3PASA 4ICHA 1RKWA 3B6AA 5GPCA 5IP6A 1QVUA 3FK7A 1U9NA 2FD5A 2W53A 3CWRA 2HYTA 3CDLA 3LHQA 2PBXA 1JT6A 3FK6A 4I6ZA 3HGYA 3MNLA 3P9TA 5CXIA 4GCLA 1T33A 2XPVA 3AQTA 3AQSA 1ORKA 2ZB9A 4D7MA 3ZQIA 2YVHA 5FKMA 2HXIA 2I10A 3LJLA 5F0CA 3O8GA 2DTZA 3VP5A 3BCGA 3WHBA 2G0EA 3IH3A 4GFKA 5J1UA 5H9TA 4D7NA 3BTLA 3S5RA 4CGRA 5EZHA 3BR1A 2NS7A 5FKNA 2VKEA 4G12A 3BT9A 2VPRA 4X1EA 2XPWA 3BQZA 2NP3A 3TP3A 5C4YA 4XK4A 2NX4A 5K7FA 5F08A 1BJZA 3IH2A 2EH3A 2DG8A 3IH4A 3BTIA 4HKUA 1JUMA 2QOPA 3V78A 2GENA 4AUXA 3KKDA 2G3BA 3BNIA 5FKOA 3HIMA 5EZGA 3JSJA 3RH2A 3ZQLA 4GCKA 1RPWA 2D6YA 2IU5A 2UXOA 3CJDA 5F04A 3QPLA 5J1RA 2JK3A 3CRJA 2FQ4A 3LWJA 2XRLA 3DEWA 2WGBA 3ON4A 5FMPA 1JT0A 4DW6A 3COLA 1JUPA 5J3LA 3BTJA 2ZCNA 3HTHA 2XPUA 2FX0A 2HYJA 3B81A 5D18A 2O7TA 2XGDA 4B1RA 3VW1A 2IEKA 4M3DA 3SFIA 2UXIA 2OI8A 3O8HA 1UI5A 3PM1A 1JUSA 5FKLA 2FBQA 3ANPA 2ID6A 3DCFA 1Z77A 4D5FA 1ZKGA 3NXCA 3BRUA 4UDSA 5F1JA 5GP9A 3LOCA 2RAEA 3WHCA 3VOXA 3RD3A 2Y31A 2G7SA 3BR6A 2OERA 5IOZA 3VVYA 4AC6A 3EGQA 2G7LA 2Y30A 4JL3A 4MK6A 4NN1A 4B3AA 4M3BA 5D19A 1JTYA 3HGGA 2Y2ZA 2QKOA 1QVTA 2F07A 2WV1A 5EYRA 4V2FA 3KZ9A 4AC0A 3VOKA 2QIBA 3NRGA 3Q3SA 2O7OA 4V2GA 3PPBA 2QWTA 5GPAA 3G1MA 2ZCXA 3NI7A 3LSRA 3BQYA 3BR3A 2XGCA 3QBMA 4NELA 3VVXA 5F0HA 5CXGA 3GEUA 4JKZA 2GBYA 2OPTA 3LSJA 5FHPA 3ANGA 3TP0A 5FGLA 2RHAA 3C07A 3HE0A 1T56A 3F1BA 4W97A 5AQCA 4AF5A 2QCOA 4JNNA 2TCTA 5IOYA 2HKUA 2XGEA 3GZIA 4I76A 3VW0A 3FRQA 4ME9A 3VPRA 3EUPA 5K58A 1VI0A 2ZCMA 3Q0VA 1A6IA 3T6NA 2G7GA 1UI6A 3G1LA 1QPIA 4MXMA 2GUHA 1RKTA 2Q24A 3SDGA 2RASA 2XB5A 3G7RA 2ZOZA 2WUIA 2X6OA 5IPAA 2GFNA 3G56A 3ZQFA 2UXUA 3VUQA 5K7HA 2IAIA 2UXHA 3F0CA 3ZQGA 1ZK8A
chains in the Genus database with same CATH superfamily
5J1YA 5DAJA 3KNWA 3HTAA 4MO7A 4ABZA 4KWAA 5HBUA 3ON2A 3DPJA 2QTQA 3HTJA 2TRTA 2NP5A 3ZQHA 3NNRA 3QPSA 5EFYA 4M3GA 3MVPA 3BJBA 4M3FA 3CCYA 2FJ1A 1U9OA 2IBDA 4W1UA 3Q0WA 2YVEA 3QQAA 3VVZA 3LSPA 3B6CA 1Z0XA 4YZEA 3E7QA 1SGMA 4L62A 3HTIA 2R7TA 3O60A 4GCTA 4D5CA 5HSZA 3BTCA 4OD4A 2X9DA 3Q0UA 4GFLA 2JJ7A 3BR5A 5HAWA 3VW2A 3QKXA 5CW8A 2ID3A 2OF7A 3NPIA 3C2BA 1JTXA 3FIWA 5FKKA 4PXIA 2HXOA 3IUVA 2REKA 4M3EA 3BR2A 3BR0A 2NS8A 2HQ5A 5F0FA 2UXPA 2XDNA 3BHQA 2PZ9A 5F27A 2DG7A 2ZOYA 2VKVA 3G1OA 4ACIA 3V6GA 3KKCA 4JYKA 2V57A 3VIBA 5K7ZA 5D1RA 3PASA 4ICHA 1RKWA 3B6AA 5GPCA 5IP6A 1QVUA 4OD5A 3FK7A 1U9NA 2FD5A 2W53A 3CWRA 2HYTA 3CDLA 3LHQA 2R7WA 2PBXA 1JT6A 3FK6A 4I6ZA 3HGYA 3MNLA 3P9TA 3DU6A 5CXIA 3NS4A 4GCLA 1T33A 2XPVA 3AQTA 3AQSA 1ORKA 4DVYP 2ZB9A 4D7MA 3ZQIA 2YVHA 5FKMA 2R7XA 2HXIA 2I10A 3LJLA 5F0CA 3O8GA 2DTZA 2PFVA 3VP5A 3VTIA 3BCGA 5CQGA 3WHBA 2G0EA 3IH3A 4GFKA 5J1UA 5H9TA 4C2MA 4U9NA 4D7NA 3BTLA 3S5RA 4CGRA 5EZHA 3BR1A 2NS7A 2R7OA 5FKNA 2VKEA 4G12A 2R7UA 3BT9A 2VPRA 4X1EA 2XPWA 3BQZA 2NP3A 3TP3A 5C4YA 4XK4A 2NX4A 5K7FA 5F08A 1BJZA 3IH2A 2EH3A 2DG8A 3IH4A 3BTIA 4HKUA 1JUMA 2QOPA 3V78A 2GENA 4AUXA 3KKDA 2G3BA 3BNIA 5FKOA 3HIMA 5EZGA 3JSJA 3RH2A 3ZQLA 2ZY9A 4GCKA 3SWHA 1RPWA 2D6YA 2IU5A 2UXOA 3CJDA 5F04A 3QPLA 5J1RA 2JK3A 3CRJA 2FQ4A 2R7VA 3LWJA 2XRLA 3DEWA 2WGBA 3ON4A 5FMPA 1JT0A 4DW6A 3COLA 1JUPA 5J3LA 3BTJA 2ZCNA 3HTHA 2XPUA 2FX0A 2HYJA 3B81A 5D18A 2O7TA 2XGDA 4B1RA 3VW1A 2IEKA 4M3DA 3SFIA 2UXIA 2OI8A 3O8HA 1UI5A 3PM1A 1JUSA 3DU5A 3KYLA 5FKLA 2FBQA 3ANPA 2ID6A 3DCFA 1Z77A 4D5FA 1ZKGA 3NXCA 3BRUA 4UDSA 5F1JA 5GP9A 3LOCA 2RAEA 3WHCA 3VOXA 3RD3A 2Y31A 2G7SA 3BR6A 2OERA 5IOZA 3VVYA 2FJI1 4AC6A 3EGQA 2G7LA 2R7SA 2Y30A 4JL3A 4MK6A 4NN1A 4B3AA 4M3BA 5D19A 3K8PC 1JTYA 3HGGA 2Y2ZA 2QKOA 1QVTA 2R7QA 2F07A 2WV1A 5EYRA 4V2FA 3KZ9A 4AC0A 3VOKA 2QIBA 3NRGA 3Q3SA 3FHNA 2O7OA 4V2GA 3PPBA 2QWTA 5GPAA 3G1MA 2ZCXA 3NI7A 3LSRA 3BQYA 3BR3A 2XGCA 3QBMA 4NELA 3VVXA 5F0HA 5CXGA 3GEUA 4JKZA 2YVXA 2GBYA 2OPTA 3LSJA 5FHPA 3ANGA 3TP0A 5FGLA 2RHAA 3C07A 3HE0A 1T56A 3F1BA 4W97A 5AQCA 4AF5A 2QCOA 4JNNA 2TCTA 5IOYA 2HKUA 2XGEA 3GZIA 4I76A 3VW0A 3FRQA 4ME9A 3VPRA 3EUPA 5K58A 1VI0A 2ZCMA 3Q0VA 1A6IA 3T6NA 2G7GA 1UI6A 3G1LA 1QPIA 4MXMA 2GUHA 1RKTA 4U9LA 2Q24A 3SDGA 2RASA 2XB5A 3G7RA 2B3WA 2ZOZA 2WUIA 2X6OA 5IPAA 4IRVA 2GFNA 3G56A 3ZQFA 2A2FX 2R7RA 2UXUA 3VUQA 4WIBA 5K7HA 2B1EA 2IAIA 2UXHA 3F0CA 3ZQGA 1ZK8A
chains in the Genus database with same CATH topology
5J1YA 5DAJA 3KNWA 3HTAA 4MO7A 4ABZA 4KWAA 5HBUA 3ON2A 3DPJA 2QTQA 3HTJA 2TRTA 2NP5A 3ZQHA 3NNRA 3QPSA 5EFYA 4M3GA 3MVPA 3BJBA 4M3FA 3CCYA 2FJ1A 1U9OA 2IBDA 4W1UA 3Q0WA 2YVEA 3QQAA 3VVZA 3LSPA 3B6CA 1Z0XA 4YZEA 3E7QA 1SGMA 4L62A 3HTIA 3O60A 4GCTA 4D5CA 5HSZA 3BTCA 2X9DA 3Q0UA 4GFLA 2JJ7A 3BR5A 5HAWA 3VW2A 3QKXA 5CW8A 2ID3A 2OF7A 3NPIA 3C2BA 1JTXA 3FIWA 5FKKA 4PXIA 2HXOA 3IUVA 2REKA 4M3EA 3BR2A 3BR0A 2NS8A 2HQ5A 5F0FA 2UXPA 2XDNA 3BHQA 2PZ9A 5F27A 2DG7A 2ZOYA 2VKVA 3G1OA 4ACIA 3V6GA 3KKCA 4JYKA 2V57A 3VIBA 5K7ZA 5D1RA 3PASA 4ICHA 1RKWA 3B6AA 5GPCA 5IP6A 1QVUA 3FK7A 1U9NA 2FD5A 2W53A 3CWRA 2HYTA 3CDLA 3LHQA 2PBXA 1JT6A 3FK6A 4I6ZA 3HGYA 3MNLA 3P9TA 5CXIA 4GCLA 1T33A 2XPVA 3AQTA 3AQSA 1ORKA 2ZB9A 4D7MA 3ZQIA 2YVHA 5FKMA 2HXIA 2I10A 3LJLA 5F0CA 3O8GA 2DTZA 3VP5A 3BCGA 3WHBA 2G0EA 3IH3A 4GFKA 5J1UA 5H9TA 4D7NA 3BTLA 3S5RA 4CGRA 5EZHA 3BR1A 2NS7A 5FKNA 2VKEA 4G12A 3BT9A 2VPRA 4X1EA 2XPWA 3BQZA 2NP3A 3TP3A 5C4YA 4XK4A 2NX4A 5K7FA 5F08A 1BJZA 3IH2A 2EH3A 2DG8A 3IH4A 3BTIA 4HKUA 1JUMA 2QOPA 3V78A 2GENA 4AUXA 3KKDA 2G3BA 3BNIA 5FKOA 3HIMA 5EZGA 3JSJA 3RH2A 3ZQLA 4GCKA 1RPWA 2D6YA 2IU5A 2UXOA 3CJDA 5F04A 3QPLA 5J1RA 2JK3A 3CRJA 2FQ4A 3LWJA 2XRLA 3DEWA 2WGBA 3ON4A 5FMPA 1JT0A 4DW6A 3COLA 1JUPA 5J3LA 3BTJA 2ZCNA 3HTHA 2XPUA 2FX0A 2HYJA 3B81A 5D18A 2O7TA 2XGDA 4B1RA 3VW1A 2IEKA 4M3DA 3SFIA 2UXIA 2OI8A 3O8HA 1UI5A 3PM1A 1JUSA 5FKLA 2FBQA 3ANPA 2ID6A 3DCFA 1Z77A 4D5FA 1ZKGA 3NXCA 3BRUA 4UDSA 5F1JA 5GP9A 3LOCA 2RAEA 3WHCA 3VOXA 3RD3A 2Y31A 2G7SA 3BR6A 2OERA 5IOZA 3VVYA 4AC6A 3EGQA 2G7LA 2Y30A 4JL3A 4MK6A 4NN1A 4B3AA 4M3BA 5D19A 1JTYA 3HGGA 2Y2ZA 2QKOA 1QVTA 2F07A 2WV1A 5EYRA 4V2FA 3KZ9A 4AC0A 3VOKA 2QIBA 3NRGA 3Q3SA 2O7OA 4V2GA 3PPBA 2QWTA 5GPAA 3G1MA 2ZCXA 3NI7A 3LSRA 3BQYA 3BR3A 2XGCA 3QBMA 4NELA 3VVXA 5F0HA 5CXGA 3GEUA 4JKZA 2GBYA 2OPTA 3LSJA 5FHPA 3ANGA 3TP0A 5FGLA 2RHAA 3C07A 3HE0A 1T56A 3F1BA 4W97A 5AQCA 4AF5A 2QCOA 4JNNA 2TCTA 5IOYA 2HKUA 2XGEA 3GZIA 4I76A 3VW0A 3FRQA 4ME9A 3VPRA 3EUPA 5K58A 1VI0A 2ZCMA 3Q0VA 1A6IA 3T6NA 2G7GA 1UI6A 3G1LA 1QPIA 4MXMA 2GUHA 1RKTA 2Q24A 3SDGA 2RASA 2XB5A 3G7RA 2ZOZA 2WUIA 2X6OA 5IPAA 2GFNA 3G56A 3ZQFA 2UXUA 3VUQA 5K7HA 2IAIA 2UXHA 3F0CA 3ZQGA 1ZK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1Y A;  5DAJ A;  3KNW A;  3HTA A;  4MO7 A;  4ABZ A;  4KWA A;  5HBU A;  3ON2 A;  3DPJ A;  2QTQ A;  3HTJ A;  2TRT A;  2NP5 A;  3ZQH A;  3NNR A;  3QPS A;  5EFY A;  4M3G A;  3MVP A;  3BJB A;  4M3F A;  3CCY A;  2FJ1 A;  1U9O A;  2IBD A;  4W1U A;  3Q0W A;  2YVE A;  3QQA A;  3VVZ A;  3LSP A;  3B6C A;  1Z0X A;  4YZE A;  3E7Q A;  1SGM A;  4L62 A;  3HTI A;  3O60 A;  4GCT A;  4D5C A;  5HSZ A;  3BTC A;  2X9D A;  3Q0U A;  4GFL A;  2JJ7 A;  3BR5 A;  5HAW A;  3VW2 A;  3QKX A;  5CW8 A;  2ID3 A;  2OF7 A;  3NPI A;  3C2B A;  1JTX A;  3FIW A;  5FKK A;  4PXI A;  2HXO A;  3IUV A;  2REK A;  4M3E A;  3BR2 A;  3BR0 A;  2NS8 A;  2HQ5 A;  5F0F A;  2UXP A;  2XDN A;  3BHQ A;  2PZ9 A;  5F27 A;  2DG7 A;  2ZOY A;  2VKV A;  3G1O A;  4ACI A;  3V6G A;  3KKC A;  4JYK A;  2V57 A;  3VIB A;  5K7Z A;  5D1R A;  3PAS A;  4ICH A;  1RKW A;  3B6A A;  5GPC A;  5IP6 A;  1QVU A;  3FK7 A;  1U9N A;  2FD5 A;  2W53 A;  3CWR A;  2HYT A;  3CDL A;  3LHQ A;  2PBX A;  1JT6 A;  3FK6 A;  4I6Z A;  3HGY A;  3MNL A;  3P9T A;  5CXI A;  4GCL A;  1T33 A;  2XPV A;  3AQT A;  3AQS A;  1ORK A;  2ZB9 A;  4D7M A;  3ZQI A;  2YVH A;  5FKM A;  2HXI A;  2I10 A;  3LJL A;  5F0C A;  3O8G A;  2DTZ A;  3VP5 A;  3BCG A;  3WHB A;  2G0E A;  3IH3 A;  4GFK A;  5J1U A;  5H9T A;  4D7N A;  3BTL A;  3S5R A;  4CGR A;  5EZH A;  3BR1 A;  2NS7 A;  5FKN A;  2VKE A;  4G12 A;  3BT9 A;  2VPR A;  4X1E A;  2XPW A;  3BQZ A;  2NP3 A;  3TP3 A;  5C4Y A;  4XK4 A;  2NX4 A;  5K7F A;  5F08 A;  1BJZ A;  3IH2 A;  2EH3 A;  2DG8 A;  3IH4 A;  3BTI A;  4HKU A;  1JUM A;  2QOP A;  3V78 A;  2GEN A;  4AUX A;  3KKD A;  2G3B A;  3BNI A;  5FKO A;  3HIM A;  5EZG A;  3JSJ A;  3RH2 A;  3ZQL A;  4GCK A;  1RPW A;  2D6Y A;  2IU5 A;  2UXO A;  3CJD A;  5F04 A;  3QPL A;  5J1R A;  2JK3 A;  3CRJ A;  2FQ4 A;  3LWJ A;  2XRL A;  3DEW A;  2WGB A;  3ON4 A;  5FMP A;  1JT0 A;  4DW6 A;  3COL A;  1JUP A;  5J3L A;  3BTJ A;  2ZCN A;  3HTH A;  2XPU A;  2FX0 A;  2HYJ A;  3B81 A;  5D18 A;  2O7T A;  2XGD A;  4B1R A;  3VW1 A;  2IEK A;  4M3D A;  3SFI A;  2UXI A;  2OI8 A;  3O8H A;  1UI5 A;  3PM1 A;  1JUS A;  5FKL A;  2FBQ A;  3ANP A;  2ID6 A;  3DCF A;  1Z77 A;  4D5F A;  1ZKG A;  3NXC A;  3BRU A;  4UDS A;  5F1J A;  5GP9 A;  3LOC A;  2RAE A;  3WHC A;  3VOX A;  3RD3 A;  2Y31 A;  2G7S A;  3BR6 A;  2OER A;  5IOZ A;  3VVY A;  4AC6 A;  3EGQ A;  2G7L A;  2Y30 A;  4JL3 A;  4MK6 A;  4NN1 A;  4B3A A;  4M3B A;  5D19 A;  1JTY A;  3HGG A;  2Y2Z A;  2QKO A;  1QVT A;  2F07 A;  2WV1 A;  5EYR A;  4V2F A;  3KZ9 A;  4AC0 A;  3VOK A;  2QIB A;  3NRG A;  3Q3S A;  2O7O A;  4V2G A;  3PPB A;  2QWT A;  5GPA A;  3G1M A;  2ZCX A;  3NI7 A;  3LSR A;  3BQY A;  3BR3 A;  2XGC A;  3QBM A;  4NEL A;  3VVX A;  5F0H A;  5CXG A;  3GEU A;  4JKZ A;  2GBY A;  2OPT A;  3LSJ A;  5FHP A;  3ANG A;  3TP0 A;  5FGL A;  2RHA A;  3C07 A;  3HE0 A;  1T56 A;  3F1B A;  4W97 A;  5AQC A;  4AF5 A;  2QCO A;  4JNN A;  2TCT A;  5IOY A;  2HKU A;  2XGE A;  3GZI A;  4I76 A;  3VW0 A;  3FRQ A;  4ME9 A;  3VPR A;  3EUP A;  5K58 A;  1VI0 A;  2ZCM A;  3Q0V A;  1A6I A;  3T6N A;  2G7G A;  1UI6 A;  3G1L A;  1QPI A;  4MXM A;  2GUH A;  1RKT A;  2Q24 A;  3SDG A;  2RAS A;  2XB5 A;  3G7R A;  2ZOZ A;  2WUI A;  2X6O A;  5IPA A;  2GFN A;  3G56 A;  3ZQF A;  2UXU A;  3VUQ A;  5K7H A;  2IAI A;  2UXH A;  3F0C A;  3ZQG A;  1ZK8 A; 
#chains in the Genus database with same CATH topology
 5J1Y A;  5DAJ A;  3KNW A;  3HTA A;  4MO7 A;  4ABZ A;  4KWA A;  5HBU A;  3ON2 A;  3DPJ A;  2QTQ A;  3HTJ A;  2TRT A;  2NP5 A;  3ZQH A;  3NNR A;  3QPS A;  5EFY A;  4M3G A;  3MVP A;  3BJB A;  4M3F A;  3CCY A;  2FJ1 A;  1U9O A;  2IBD A;  4W1U A;  3Q0W A;  2YVE A;  3QQA A;  3VVZ A;  3LSP A;  3B6C A;  1Z0X A;  4YZE A;  3E7Q A;  1SGM A;  4L62 A;  3HTI A;  2R7T A;  3O60 A;  4GCT A;  4D5C A;  5HSZ A;  3BTC A;  4OD4 A;  2X9D A;  3Q0U A;  4GFL A;  2JJ7 A;  3BR5 A;  5HAW A;  3VW2 A;  3QKX A;  5CW8 A;  2ID3 A;  2OF7 A;  3NPI A;  3C2B A;  1JTX A;  3FIW A;  5FKK A;  4PXI A;  2HXO A;  3IUV A;  2REK A;  4M3E A;  3BR2 A;  3BR0 A;  2NS8 A;  2HQ5 A;  5F0F A;  2UXP A;  2XDN A;  3BHQ A;  2PZ9 A;  5F27 A;  2DG7 A;  2ZOY A;  2VKV A;  3G1O A;  4ACI A;  3V6G A;  3KKC A;  4JYK A;  2V57 A;  3VIB A;  5K7Z A;  5D1R A;  3PAS A;  4ICH A;  1RKW A;  3B6A A;  5GPC A;  5IP6 A;  1QVU A;  4OD5 A;  3FK7 A;  1U9N A;  2FD5 A;  2W53 A;  3CWR A;  2HYT A;  3CDL A;  3LHQ A;  2R7W A;  2PBX A;  1JT6 A;  3FK6 A;  4I6Z A;  3HGY A;  3MNL A;  3P9T A;  3DU6 A;  5CXI A;  3NS4 A;  4GCL A;  1T33 A;  2XPV A;  3AQT A;  3AQS A;  1ORK A;  4DVY P;  2ZB9 A;  4D7M A;  3ZQI A;  2YVH A;  5FKM A;  2R7X A;  2HXI A;  2I10 A;  3LJL A;  5F0C A;  3O8G A;  2DTZ A;  2PFV A;  3VP5 A;  3VTI A;  3BCG A;  5CQG A;  3WHB A;  2G0E A;  3IH3 A;  4GFK A;  5J1U A;  5H9T A;  4C2M A;  4U9N A;  4D7N A;  3BTL A;  3S5R A;  4CGR A;  5EZH A;  3BR1 A;  2NS7 A;  2R7O A;  5FKN A;  2VKE A;  4G12 A;  2R7U A;  3BT9 A;  2VPR A;  4X1E A;  2XPW A;  3BQZ A;  2NP3 A;  3TP3 A;  5C4Y A;  4XK4 A;  2NX4 A;  5K7F A;  5F08 A;  1BJZ A;  3IH2 A;  2EH3 A;  2DG8 A;  3IH4 A;  3BTI A;  4HKU A;  1JUM A;  2QOP A;  3V78 A;  2GEN A;  4AUX A;  3KKD A;  2G3B A;  3BNI A;  5FKO A;  3HIM A;  5EZG A;  3JSJ A;  3RH2 A;  3ZQL A;  2ZY9 A;  4GCK A;  3SWH A;  1RPW A;  2D6Y A;  2IU5 A;  2UXO A;  3CJD A;  5F04 A;  3QPL A;  5J1R A;  2JK3 A;  3CRJ A;  2FQ4 A;  2R7V A;  3LWJ A;  2XRL A;  3DEW A;  2WGB A;  3ON4 A;  5FMP A;  1JT0 A;  4DW6 A;  3COL A;  1JUP A;  5J3L A;  3BTJ A;  2ZCN A;  3HTH A;  2XPU A;  2FX0 A;  2HYJ A;  3B81 A;  5D18 A;  2O7T A;  2XGD A;  4B1R A;  3VW1 A;  2IEK A;  4M3D A;  3SFI A;  2UXI A;  2OI8 A;  3O8H A;  1UI5 A;  3PM1 A;  1JUS A;  3DU5 A;  3KYL A;  5FKL A;  2FBQ A;  3ANP A;  2ID6 A;  3DCF A;  1Z77 A;  4D5F A;  1ZKG A;  3NXC A;  3BRU A;  4UDS A;  5F1J A;  5GP9 A;  3LOC A;  2RAE A;  3WHC A;  3VOX A;  3RD3 A;  2Y31 A;  2G7S A;  3BR6 A;  2OER A;  5IOZ A;  3VVY A;  2FJI 1;  4AC6 A;  3EGQ A;  2G7L A;  2R7S A;  2Y30 A;  4JL3 A;  4MK6 A;  4NN1 A;  4B3A A;  4M3B A;  5D19 A;  3K8P C;  1JTY A;  3HGG A;  2Y2Z A;  2QKO A;  1QVT A;  2R7Q A;  2F07 A;  2WV1 A;  5EYR A;  4V2F A;  3KZ9 A;  4AC0 A;  3VOK A;  2QIB A;  3NRG A;  3Q3S A;  3FHN A;  2O7O A;  4V2G A;  3PPB A;  2QWT A;  5GPA A;  3G1M A;  2ZCX A;  3NI7 A;  3LSR A;  3BQY A;  3BR3 A;  2XGC A;  3QBM A;  4NEL A;  3VVX A;  5F0H A;  5CXG A;  3GEU A;  4JKZ A;  2YVX A;  2GBY A;  2OPT A;  3LSJ A;  5FHP A;  3ANG A;  3TP0 A;  5FGL A;  2RHA A;  3C07 A;  3HE0 A;  1T56 A;  3F1B A;  4W97 A;  5AQC A;  4AF5 A;  2QCO A;  4JNN A;  2TCT A;  5IOY A;  2HKU A;  2XGE A;  3GZI A;  4I76 A;  3VW0 A;  3FRQ A;  4ME9 A;  3VPR A;  3EUP A;  5K58 A;  1VI0 A;  2ZCM A;  3Q0V A;  1A6I A;  3T6N A;  2G7G A;  1UI6 A;  3G1L A;  1QPI A;  4MXM A;  2GUH A;  1RKT A;  4U9L A;  2Q24 A;  3SDG A;  2RAS A;  2XB5 A;  3G7R A;  2B3W A;  2ZOZ A;  2WUI A;  2X6O A;  5IPA A;  4IRV A;  2GFN A;  3G56 A;  3ZQF A;  2A2F X;  2R7R A;  2UXU A;  3VUQ A;  4WIB A;  5K7H A;  2B1E A;  2IAI A;  2UXH A;  3F0C A;  3ZQG A;  1ZK8 A; 
#chains in the Genus database with same CATH homology
 5J1Y A;  5DAJ A;  3KNW A;  3HTA A;  4MO7 A;  4ABZ A;  4KWA A;  5HBU A;  3ON2 A;  3DPJ A;  2QTQ A;  3HTJ A;  2TRT A;  2NP5 A;  3ZQH A;  3NNR A;  3QPS A;  5EFY A;  4M3G A;  3MVP A;  3BJB A;  4M3F A;  3CCY A;  2FJ1 A;  1U9O A;  2IBD A;  4W1U A;  3Q0W A;  2YVE A;  3QQA A;  3VVZ A;  3LSP A;  3B6C A;  1Z0X A;  4YZE A;  3E7Q A;  1SGM A;  4L62 A;  3HTI A;  3O60 A;  4GCT A;  4D5C A;  5HSZ A;  3BTC A;  2X9D A;  3Q0U A;  4GFL A;  2JJ7 A;  3BR5 A;  5HAW A;  3VW2 A;  3QKX A;  5CW8 A;  2ID3 A;  2OF7 A;  3NPI A;  3C2B A;  1JTX A;  3FIW A;  5FKK A;  4PXI A;  2HXO A;  3IUV A;  2REK A;  4M3E A;  3BR2 A;  3BR0 A;  2NS8 A;  2HQ5 A;  5F0F A;  2UXP A;  2XDN A;  3BHQ A;  2PZ9 A;  5F27 A;  2DG7 A;  2ZOY A;  2VKV A;  3G1O A;  4ACI A;  3V6G A;  3KKC A;  4JYK A;  2V57 A;  3VIB A;  5K7Z A;  5D1R A;  3PAS A;  4ICH A;  1RKW A;  3B6A A;  5GPC A;  5IP6 A;  1QVU A;  3FK7 A;  1U9N A;  2FD5 A;  2W53 A;  3CWR A;  2HYT A;  3CDL A;  3LHQ A;  2PBX A;  1JT6 A;  3FK6 A;  4I6Z A;  3HGY A;  3MNL A;  3P9T A;  5CXI A;  4GCL A;  1T33 A;  2XPV A;  3AQT A;  3AQS A;  1ORK A;  2ZB9 A;  4D7M A;  3ZQI A;  2YVH A;  5FKM A;  2HXI A;  2I10 A;  3LJL A;  5F0C A;  3O8G A;  2DTZ A;  3VP5 A;  3BCG A;  3WHB A;  2G0E A;  3IH3 A;  4GFK A;  5J1U A;  5H9T A;  4D7N A;  3BTL A;  3S5R A;  4CGR A;  5EZH A;  3BR1 A;  2NS7 A;  5FKN A;  2VKE A;  4G12 A;  3BT9 A;  2VPR A;  4X1E A;  2XPW A;  3BQZ A;  2NP3 A;  3TP3 A;  5C4Y A;  4XK4 A;  2NX4 A;  5K7F A;  5F08 A;  1BJZ A;  3IH2 A;  2EH3 A;  2DG8 A;  3IH4 A;  3BTI A;  4HKU A;  1JUM A;  2QOP A;  3V78 A;  2GEN A;  4AUX A;  3KKD A;  2G3B A;  3BNI A;  5FKO A;  3HIM A;  5EZG A;  3JSJ A;  3RH2 A;  3ZQL A;  4GCK A;  1RPW A;  2D6Y A;  2IU5 A;  2UXO A;  3CJD A;  5F04 A;  3QPL A;  5J1R A;  2JK3 A;  3CRJ A;  2FQ4 A;  3LWJ A;  2XRL A;  3DEW A;  2WGB A;  3ON4 A;  5FMP A;  1JT0 A;  4DW6 A;  3COL A;  1JUP A;  5J3L A;  3BTJ A;  2ZCN A;  3HTH A;  2XPU A;  2FX0 A;  2HYJ A;  3B81 A;  5D18 A;  2O7T A;  2XGD A;  4B1R A;  3VW1 A;  2IEK A;  4M3D A;  3SFI A;  2UXI A;  2OI8 A;  3O8H A;  1UI5 A;  3PM1 A;  1JUS A;  5FKL A;  2FBQ A;  3ANP A;  2ID6 A;  3DCF A;  1Z77 A;  4D5F A;  1ZKG A;  3NXC A;  3BRU A;  4UDS A;  5F1J A;  5GP9 A;  3LOC A;  2RAE A;  3WHC A;  3VOX A;  3RD3 A;  2Y31 A;  2G7S A;  3BR6 A;  2OER A;  5IOZ A;  3VVY A;  4AC6 A;  3EGQ A;  2G7L A;  2Y30 A;  4JL3 A;  4MK6 A;  4NN1 A;  4B3A A;  4M3B A;  5D19 A;  1JTY A;  3HGG A;  2Y2Z A;  2QKO A;  1QVT A;  2F07 A;  2WV1 A;  5EYR A;  4V2F A;  3KZ9 A;  4AC0 A;  3VOK A;  2QIB A;  3NRG A;  3Q3S A;  2O7O A;  4V2G A;  3PPB A;  2QWT A;  5GPA A;  3G1M A;  2ZCX A;  3NI7 A;  3LSR A;  3BQY A;  3BR3 A;  2XGC A;  3QBM A;  4NEL A;  3VVX A;  5F0H A;  5CXG A;  3GEU A;  4JKZ A;  2GBY A;  2OPT A;  3LSJ A;  5FHP A;  3ANG A;  3TP0 A;  5FGL A;  2RHA A;  3C07 A;  3HE0 A;  1T56 A;  3F1B A;  4W97 A;  5AQC A;  4AF5 A;  2QCO A;  4JNN A;  2TCT A;  5IOY A;  2HKU A;  2XGE A;  3GZI A;  4I76 A;  3VW0 A;  3FRQ A;  4ME9 A;  3VPR A;  3EUP A;  5K58 A;  1VI0 A;  2ZCM A;  3Q0V A;  1A6I A;  3T6N A;  2G7G A;  1UI6 A;  3G1L A;  1QPI A;  4MXM A;  2GUH A;  1RKT A;  2Q24 A;  3SDG A;  2RAS A;  2XB5 A;  3G7R A;  2ZOZ A;  2WUI A;  2X6O A;  5IPA A;  2GFN A;  3G56 A;  3ZQF A;  2UXU A;  3VUQ A;  5K7H A;  2IAI A;  2UXH A;  3F0C A;  3ZQG A;  1ZK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...