4GFNA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 57
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gfnA00
2XHTA 3VHAA 4XIRA 1GKZA 4B6CA 2XD6A 3EKOA 3K98A 5CTXA 4CE1A 4GCZA 4BXIA 2IOQA 4URLA 4LWEA 3GIGB 3R4MA 4WUBA 4EFTA 2BU6A 3BM9A 2WI5A 2CH4A 1UYDA 5C93A 1AJ6A 3OMUA 1MX0A 4R3AA 4R3MA 1UYIA 2YK2A 4JAUA 4O0BA 3QDDA 2UWDA 2CCUA 1U2OA 4EEHA 4PU9A 3EHGA 4PRVA 1UYFA 1YT1A 5FNCA 3CRKA 4QPKA 1GKXA 1UYGA 3U2DA 5CTYA 4JASA 4KSHA 4EGIA 2YECA 5IDJA 4FMTA 2QG2A 3INWA 1U0ZA 4MBCA 1JM6A 2YI7A 3EHFA 3Q5LA 2YE7A 2YE6A 2FYPA 3JZ3A 2Q8GA 3K97A 4MB9A 1PVGA 2YE2A 2CCSA 4E00A 1Y8OA 3FV5A 3T10A 2IOPA 1H7SA 1QYEA 4XIQA 2C2AA 4U93A 4URNA 1YSRA 5IDMA 2XDUA 1L0OA 4U7OA 4DZYA 1ZXMA 3CGZA 4LWHA 1EA6A 3B26A 3C0EA 5CF0A 4HXZA 2XDXA 4GFNA 4MP2A 5BOCA 1ID0A 3EHHA 3R92A 2VWCA 3CRLA 1YC1A 1Y8PA 3A0ZA 3WHAA 2ESAA 2YKIA 4LWGA 2IORA 3HYYA 3A0RA 5FWKA 3A0WA 3TZ5A 4HXWA 4MPNA 2YGEA 4XTJA 1YC4A 2YEGA 2IWSA 4HYMA 2YJWA 4V26A 3EHJA 1NHIA 2VCIA 4ASBA 1KIJA 4YKYA 2AKPA 2QF6A 2YEJA 4U7NA 3R91A 1YETA 3VHDA 3T2SA 1THNA 4XKOA 3FT8A 2CG9A 2HG1A 3B27A 1UYCA 3GIEA 3OPDA 3Q5JA 3VADA 4HYPA 3IEDA 2BU2A 2YEAA 4CE3A 3ZXOA 2WI2A 1TC0A 1I5AA 2FXSA 4E01A 4O09A 4CWOA 3GIFA 5J6AA 4DUHA 4NH7A 4AWOA 4GEEA 1B62A 2XJJA 2YGFA 2WEQA 5M4NA 3G7EA 1ZW9A 2YE4A 3A0XA 5D7RA 3HYZA 2H55A 4YKWA 1OSFA 4O07A 2QG0A 1BGQA 1YERA 4JQLA 3TZ2A 1YT0A 1UYHA 4KSGA 3HZ1A 2YKJA 1KZNA 2YEDA 5FNDA 4R1FA 1YSZA 2ZDYA 3RLRA 4MPCA 3PEHA 3OW6A 1Y8NA 2GFDA 3T0HA 1AMWA 1UY9A 2HKJA 1TH8A 4MPEA 3TTZA 4XITA 4AWQA 4ZKIA 4ASFA 2XDKA 1ZXNA 3FT5A 3B25A 2BYHA 2JJCA 4PRXA 4EFUA 4MOTA 4CWSA 2ZKJA 1H7UA 1TILA 5CPHA 3VHCA 1QZRA 2BU7A 3RLQA 4MP7A 3H80A 5D7CA 4CWNA 1Z5AA 4BIUA 4ASGA 2BT0A 4BIZA 4HZ0A 3RLPA 4H81A 4XC0A 2Q8HA 1TC6A 4L94A 3A0YA 1R62A 3CWVA 4EGKA 3C11A 1I58A 4X9LA 3O2FA 2CGFA 3T0ZA 3TUHA 4EMVA 1US7A 5CTWA 4K4OA 4YKZA 2IWXA 4CWTA 2YKEA 2XCMA 4WUCA 4I3HA 4XKAA 1Z5BA 4Q20A 3PEJA 4FCPA 3ZXQA 2QFOA 3K60A 2O1WA 1Y4SA 4JAVA 3HZ5A 4LWIA 4L91A 2YGAA 3OWDA 4YKRA 3NMQA 3H4LA 3TZ0A 5M4MA 4I5SA 3GIGA 4FCRA 1ZWHA 4HZ5A 5D6PA 2BSMA 4CE2A 4H85A 4L93A 2WI1A 3D0BA 3O6OA 4FCQA 4YKQA 2WERA 1AH8A 2YEFA 4XD8A 1Z59A 5M4EA 4KTNA 4BQJA 4LPBA 1S16A 2YJXA 2BRCA 2YEBA 5M4KA 1B63A 3CGYA 2YI0A 2Q2EB 2YEEA 4YKUA 2WI7A 3OWBA 5M4HA 1YESA 2YEHA 4XIPA 4FPPA 2ZBKB 1UY8A 3WQ9A 4P8OA 2O1VA 3R4OA 3U67A 1I5BA 1UYEA 2BREA 4CWRA 2K5BA 4CWPA 3SL2A 3U2KA 5IN9A 4UROA 5GGZA 1TIDA 3LPSA 3MNRP 4XKKA 4O05A 1S14A 4ZVIA 4XCJA 1UYLA 2YK9A 4XE2A 2YKBA 3G7BA 2CCTA 2YE5A 4P7AA 1YT2A 2BTZA 2IWUA 2YI5A 1Z5CA 2VCJA 4URMA 1TBWA 1I5CA 2WI3A 3LNUA 4GQTA 1BKNA 2XHRA 4GT8A 1UY7A 2XX2A 1I59A 1I5DA 3Q5KA 3O0IA 5BODA 3KE6A 4O04A 2YE8A 2VW5A 4KP4A 4CWFA 1NHHA 4XDMA 4GGLA 1YS3A 2FWZA 3HHUA 1BXDA 2PNRA 5CTUA 5M4PA 1EI1A 1GJVA 5D7DA 2XDSA 4B7PA 4AS9A 2XJGA 2YE9A 2JKIA 4KQVA 2ZDXA 3G75A 4NH8A 3EKRA 3A0TA 1UY6A 5FNFA 4BAEA 2BU8A 4HY6A 2XX5A 4AWPA 1QY8A 3DGEA 4WUDA 3D36A 2Q8IA 4EGHA 4CWQA 2E0AA 5D6QA 4L8ZA 1YC3A 3HEKA 4V25A 2BZ5A 4E02A 2GQPA 2WI6A 1AM1A 3K99A 2YKCA 2BYIA 2H8MA 2FWYA 4EM7A 4YKXA 1UYMA 3ZKDA 2HCHA 4YKTA 1B3QA 4XCLA 4QPJA 1AH6A 4BQGA 1MU5A 2XABA 1UYKA 4H7QA 3ZM7A 3ZKBA 3B28A 3BMYA 4KFGA 2YE3A 2XK2A 5F5RA 3TZ4A 3D2RA 3T1KA 4ASAA 2WEPA 5J71A 5L3JA 3R4NA 2XJXA 2XX4A 2WI4A 2EXLA 3R4PA 3INXA 1A4HA 4NH9A 2XHXA 1Y4UA 1NHJA 4LP0A 5F3KA 4LWFA 2YI6A 2Q8FA 4W7TA 2BU5A 1BYQA 2XDLA 4HY1A 2O1UA 2YEIA 3RKZA 4PL9A 4L90A 3QTFA 3B24A
chains in the Genus database with same CATH superfamily
2XHTA 3VHAA 4XIRA 1GKZA 4B6CA 2XD6A 3EKOA 3K98A 5CTXA 4CE1A 4GCZA 4BXIA 2IOQA 4URLA 4LWEA 3GIGB 3R4MA 4WUBA 4EFTA 2BU6A 3BM9A 2WI5A 2CH4A 1UYDA 5C93A 1AJ6A 3OMUA 1MX0A 4R3AA 4R3MA 1UYIA 2YK2A 4JAUA 4O0BA 3QDDA 2UWDA 2CCUA 1U2OA 4EEHA 4PU9A 3EHGA 4PRVA 1UYFA 1YT1A 5FNCA 3CRKA 4QPKA 1GKXA 1UYGA 3U2DA 5CTYA 4JASA 4KSHA 4EGIA 2YECA 5IDJA 4FMTA 2QG2A 3INWA 1U0ZA 4MBCA 1JM6A 2YI7A 3EHFA 3Q5LA 2YE7A 1F51A 2YE6A 2FYPA 3JZ3A 2Q8GA 3K97A 4MB9A 1PVGA 2YE2A 2CCSA 4E00A 1Y8OA 3FV5A 3T10A 2IOPA 1H7SA 1QYEA 4XIQA 2C2AA 4U93A 4URNA 1YSRA 5IDMA 2XDUA 1L0OA 4U7OA 4DZYA 1ZXMA 3CGZA 4LWHA 1EA6A 3B26A 3C0EA 5CF0A 4HXZA 2XDXA 4GFNA 4MP2A 5BOCA 1ID0A 3EHHA 3R92A 2VWCA 3CRLA 1YC1A 1Y8PA 3A0ZA 3WHAA 2ESAA 2YKIA 4LWGA 2IORA 3HYYA 3A0RA 5FWKA 3A0WA 3TZ5A 4HXWA 4MPNA 2YGEA 4XTJA 1YC4A 2YEGA 2IWSA 4HYMA 2YJWA 4V26A 3EHJA 1NHIA 2VCIA 4ASBA 1KIJA 4YKYA 2AKPA 2QF6A 2YEJA 4U7NA 3R91A 1YETA 3VHDA 3T2SA 1THNA 4XKOA 3FT8A 2CG9A 2HG1A 3B27A 1UYCA 3GIEA 3OPDA 3Q5JA 3VADA 4HYPA 3IEDA 2BU2A 2YEAA 4CE3A 3ZXOA 2WI2A 1TC0A 1I5AA 2FXSA 4E01A 4O09A 4CWOA 3GIFA 5J6AA 4DUHA 4NH7A 4AWOA 4GEEA 1B62A 2XJJA 2YGFA 2WEQA 5M4NA 3G7EA 1ZW9A 2YE4A 3A0XA 5D7RA 4E72A 3HYZA 2H55A 4YKWA 1OSFA 4O07A 2QG0A 1BGQA 1YERA 4JQLA 3TZ2A 2C1GA 1YT0A 1UYHA 2HHIA 4KSGA 3HZ1A 2YKJA 1KZNA 2YEDA 5FNDA 4R1FA 1YSZA 2ZDYA 3RLRA 4MPCA 3PEHA 3OW6A 1Y8NA 2GFDA 3T0HA 1AMWA 1UY9A 2HKJA 1TH8A 4MPEA 3TTZA 4XITA 4AWQA 4ZKIA 4ASFA 2XDKA 1ZXNA 3FT5A 3B25A 2BYHA 2JJCA 4PRXA 4EFUA 4MOTA 4CWSA 2ZKJA 1H7UA 1TILA 5CPHA 3VHCA 1QZRA 2BU7A 3RLQA 4MP7A 3H80A 5D7CA 4CWNA 1Z5AA 4BIUA 4ASGA 2BT0A 4BIZA 4HZ0A 3RLPA 4H81A 4XC0A 2Q8HA 1TC6A 4L94A 3A0YA 1R62A 3CWVA 4EGKA 3C11A 1I58A 4X9LA 3O2FA 2CGFA 3T0ZA 3TUHA 4EMVA 1US7A 5CTWA 4K4OA 4YKZA 2IWXA 4CWTA 2YKEA 2XCMA 4WUCA 4I3HA 4XKAA 1Z5BA 4Q20A 3PEJA 4FCPA 3ZXQA 2QFOA 3K60A 2O1WA 1Y4SA 4JAVA 3HZ5A 4LWIA 4L91A 2YGAA 3OWDA 4YKRA 3NMQA 3H4LA 3TZ0A 5M4MA 4I5SA 3GIGA 4FCRA 1ZWHA 4HZ5A 5D6PA 2BSMA 4CE2A 4H85A 4L93A 2WI1A 3D0BA 3O6OA 4FCQA 4YKQA 2WERA 1AH8A 2YEFA 4XD8A 1Z59A 5M4EA 4KTNA 4BQJA 4LPBA 1S16A 2YJXA 2BRCA 2YEBA 5M4KA 1B63A 3CGYA 2YI0A 2Q2EB 2YEEA 4YKUA 2WI7A 3OWBA 3CYGA 1YESA 2YEHA 5M4HA 4XIPA 4FPPA 2ZBKB 1UY8A 3WQ9A 4P8OA 2O1VA 3R4OA 3U67A 2C1IA 1I5BA 1UYEA 2BREA 4CWRA 2K5BA 4CWPA 3SL2A 3U2KA 5IN9A 4UROA 5GGZA 1TIDA 3LPSA 3MNRP 4XKKA 4O05A 1S14A 4ZVIA 4XCJA 1UYLA 2YK9A 4XE2A 2YKBA 3G7BA 2CCTA 2YE5A 1IXMA 4P7AA 1YT2A 2BTZA 2IWUA 2YI5A 1Z5CA 2VCJA 4URMA 1TBWA 1I5CA 2WI3A 3LNUA 4GQTA 1BKNA 2XHRA 4GT8A 1UY7A 2XX2A 1I59A 1I5DA 3Q5KA 3O0IA 5BODA 3KE6A 4O04A 2YE8A 3S5TA 2VW5A 4KP4A 4CWFA 1NHHA 4XDMA 4GGLA 1YS3A 2FWZA 3HHUA 1BXDA 2PNRA 5CTUA 5M4PA 1EI1A 1GJVA 5D7DA 2XDSA 4B7PA 4AS9A 2XJGA 2YE9A 2JKIA 4KQVA 2ZDXA 3G75A 4NH8A 3EKRA 3A0TA 1UY6A 5FNFA 4BAEA 2BU8A 4HY6A 2XX5A 4AWPA 1QY8A 3DGEA 4WUDA 3D36A 2Q8IA 4EGHA 4CWQA 2E0AA 5D6QA 4L8ZA 1YC3A 3HEKA 4V25A 2BZ5A 4E02A 2GQPA 2WI6A 1AM1A 3K99A 2YKCA 2BYIA 2H8MA 2FWYA 4EM7A 4YKXA 1UYMA 3ZKDA 2HCHA 4YKTA 1B3QA 4XCLA 4QPJA 1AH6A 4BQGA 1MU5A 2XABA 1UYKA 4H7QA 3ZM7A 3ZKBA 3B28A 3BMYA 4KFGA 2YE3A 2XK2A 5F5RA 3TZ4A 3D2RA 3T1KA 4ASAA 2WEPA 5J71A 5L3JA 3R4NA 2XJXA 2XX4A 2WI4A 2EXLA 3R4PA 3INXA 1A4HA 4NH9A 2XHXA 1Y4UA 3LMMA 1NHJA 4LP0A 5F3KA 4LWFA 2YI6A 2Q8FA 4W7TA 2BU5A 1BYQA 2XDLA 4HY1A 2O1UA 2YEIA 3RKZA 2FTKA 4PL9A 5JENA 4L90A 3QTFA 3B24A
chains in the Genus database with same CATH topology
2XHTA 3VHAA 4XIRA 1GKZA 4B6CA 2XD6A 3EKOA 3K98A 5CTXA 4CE1A 4GCZA 4BXIA 2IOQA 4URLA 4LWEA 3GIGB 3R4MA 4WUBA 4EFTA 2BU6A 3BM9A 2WI5A 2CH4A 1UYDA 5C93A 1AJ6A 3OMUA 1MX0A 4R3AA 4R3MA 1UYIA 2YK2A 4JAUA 4O0BA 3QDDA 2UWDA 2CCUA 1U2OA 4EEHA 4PU9A 3EHGA 4PRVA 1UYFA 1YT1A 5FNCA 3CRKA 4QPKA 1GKXA 1UYGA 3U2DA 5CTYA 4JASA 4KSHA 4EGIA 2YECA 5IDJA 4FMTA 2QG2A 3INWA 1U0ZA 4MBCA 1JM6A 2YI7A 3EHFA 3Q5LA 2YE7A 2YE6A 2FYPA 3JZ3A 2Q8GA 3K97A 4MB9A 1PVGA 2YE2A 2CCSA 4E00A 1Y8OA 3FV5A 3T10A 2IOPA 1H7SA 1QYEA 4XIQA 2C2AA 4U93A 4URNA 1YSRA 5IDMA 2XDUA 1L0OA 4U7OA 4DZYA 1ZXMA 3CGZA 4LWHA 1EA6A 3B26A 3C0EA 5CF0A 4HXZA 2XDXA 4GFNA 4MP2A 5BOCA 1ID0A 3EHHA 3R92A 2VWCA 3CRLA 1YC1A 1Y8PA 3A0ZA 3WHAA 2ESAA 2YKIA 4LWGA 2IORA 3HYYA 3A0RA 5FWKA 3A0WA 3TZ5A 4HXWA 4MPNA 2YGEA 4XTJA 1YC4A 2YEGA 2IWSA 4HYMA 2YJWA 4V26A 3EHJA 1NHIA 2VCIA 4ASBA 1KIJA 4YKYA 2AKPA 2QF6A 2YEJA 4U7NA 3R91A 1YETA 3VHDA 3T2SA 1THNA 4XKOA 3FT8A 2CG9A 2HG1A 3B27A 1UYCA 3GIEA 3OPDA 3Q5JA 3VADA 4HYPA 3IEDA 2BU2A 2YEAA 4CE3A 3ZXOA 2WI2A 1TC0A 1I5AA 2FXSA 4E01A 4O09A 4CWOA 3GIFA 5J6AA 4DUHA 4NH7A 4AWOA 4GEEA 1B62A 2XJJA 2YGFA 2WEQA 5M4NA 3G7EA 1ZW9A 2YE4A 3A0XA 5D7RA 3HYZA 2H55A 4YKWA 1OSFA 4O07A 2QG0A 1BGQA 1YERA 4JQLA 3TZ2A 1YT0A 1UYHA 4KSGA 3HZ1A 2YKJA 1KZNA 2YEDA 5FNDA 4R1FA 1YSZA 2ZDYA 3RLRA 4MPCA 3PEHA 3OW6A 1Y8NA 2GFDA 3T0HA 1AMWA 1UY9A 2HKJA 1TH8A 4MPEA 3TTZA 4XITA 4AWQA 4ZKIA 4ASFA 2XDKA 1ZXNA 3FT5A 3B25A 2BYHA 2JJCA 4PRXA 4EFUA 4MOTA 4CWSA 2ZKJA 1H7UA 1TILA 5CPHA 3VHCA 1QZRA 2BU7A 3RLQA 4MP7A 3H80A 5D7CA 4CWNA 1Z5AA 4BIUA 4ASGA 2BT0A 4BIZA 4HZ0A 3RLPA 4H81A 4XC0A 2Q8HA 1TC6A 4L94A 3A0YA 1R62A 3CWVA 4EGKA 3C11A 1I58A 4X9LA 3O2FA 2CGFA 3T0ZA 3TUHA 4EMVA 1US7A 5CTWA 4K4OA 4YKZA 2IWXA 4CWTA 2YKEA 2XCMA 4WUCA 4I3HA 4XKAA 1Z5BA 4Q20A 3PEJA 4FCPA 3ZXQA 2QFOA 3K60A 2O1WA 1Y4SA 4JAVA 3HZ5A 4LWIA 4L91A 2YGAA 3OWDA 4YKRA 3NMQA 3H4LA 3TZ0A 5M4MA 4I5SA 3GIGA 4FCRA 1ZWHA 4HZ5A 5D6PA 2BSMA 4CE2A 4H85A 4L93A 2WI1A 3D0BA 3O6OA 4FCQA 4YKQA 2WERA 1AH8A 2YEFA 4XD8A 1Z59A 5M4EA 4KTNA 4BQJA 4LPBA 1S16A 2YJXA 2BRCA 2YEBA 5M4KA 1B63A 3CGYA 2YI0A 2Q2EB 2YEEA 4YKUA 2WI7A 3OWBA 5M4HA 1YESA 2YEHA 4XIPA 4FPPA 2ZBKB 1UY8A 3WQ9A 4P8OA 2O1VA 3R4OA 3U67A 1I5BA 1UYEA 2BREA 4CWRA 2K5BA 4CWPA 3SL2A 3U2KA 5IN9A 4UROA 5GGZA 1TIDA 3LPSA 3MNRP 4XKKA 4O05A 1S14A 4ZVIA 4XCJA 1UYLA 2YK9A 4XE2A 2YKBA 3G7BA 2CCTA 2YE5A 4P7AA 1YT2A 2BTZA 2IWUA 2YI5A 1Z5CA 2VCJA 4URMA 1TBWA 1I5CA 2WI3A 3LNUA 4GQTA 1BKNA 2XHRA 4GT8A 1UY7A 2XX2A 1I59A 1I5DA 3Q5KA 3O0IA 5BODA 3KE6A 4O04A 2YE8A 2VW5A 4KP4A 4CWFA 1NHHA 4XDMA 4GGLA 1YS3A 2FWZA 3HHUA 1BXDA 2PNRA 5CTUA 5M4PA 1EI1A 1GJVA 5D7DA 2XDSA 4B7PA 4AS9A 2XJGA 2YE9A 2JKIA 4KQVA 2ZDXA 3G75A 4NH8A 3EKRA 3A0TA 1UY6A 5FNFA 4BAEA 2BU8A 4HY6A 2XX5A 4AWPA 1QY8A 3DGEA 4WUDA 3D36A 2Q8IA 4EGHA 4CWQA 2E0AA 5D6QA 4L8ZA 1YC3A 3HEKA 4V25A 2BZ5A 4E02A 2GQPA 2WI6A 1AM1A 3K99A 2YKCA 2BYIA 2H8MA 2FWYA 4EM7A 4YKXA 1UYMA 3ZKDA 2HCHA 4YKTA 1B3QA 4XCLA 4QPJA 1AH6A 4BQGA 1MU5A 2XABA 1UYKA 4H7QA 3ZM7A 3ZKBA 3B28A 3BMYA 4KFGA 2YE3A 2XK2A 5F5RA 3TZ4A 3D2RA 3T1KA 4ASAA 2WEPA 5J71A 5L3JA 3R4NA 2XJXA 2XX4A 2WI4A 2EXLA 3R4PA 3INXA 1A4HA 4NH9A 2XHXA 1Y4UA 1NHJA 4LP0A 5F3KA 4LWFA 2YI6A 2Q8FA 4W7TA 2BU5A 1BYQA 2XDLA 4HY1A 2O1UA 2YEIA 3RKZA 4PL9A 4L90A 3QTFA 3B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHT A;  3VHA A;  4XIR A;  1GKZ A;  4B6C A;  2XD6 A;  3EKO A;  3K98 A;  5CTX A;  4CE1 A;  4GCZ A;  4BXI A;  2IOQ A;  4URL A;  4LWE A;  3GIG B;  3R4M A;  4WUB A;  4EFT A;  2BU6 A;  3BM9 A;  2WI5 A;  2CH4 A;  1UYD A;  5C93 A;  1AJ6 A;  3OMU A;  1MX0 A;  4R3A A;  4R3M A;  1UYI A;  2YK2 A;  4JAU A;  4O0B A;  3QDD A;  2UWD A;  2CCU A;  1U2O A;  4EEH A;  4PU9 A;  3EHG A;  4PRV A;  1UYF A;  1YT1 A;  5FNC A;  3CRK A;  4QPK A;  1GKX A;  1UYG A;  3U2D A;  5CTY A;  4JAS A;  4KSH A;  4EGI A;  2YEC A;  5IDJ A;  4FMT A;  2QG2 A;  3INW A;  1U0Z A;  4MBC A;  1JM6 A;  2YI7 A;  3EHF A;  3Q5L A;  2YE7 A;  2YE6 A;  2FYP A;  3JZ3 A;  2Q8G A;  3K97 A;  4MB9 A;  1PVG A;  2YE2 A;  2CCS A;  4E00 A;  1Y8O A;  3FV5 A;  3T10 A;  2IOP A;  1H7S A;  1QYE A;  4XIQ A;  2C2A A;  4U93 A;  4URN A;  1YSR A;  5IDM A;  2XDU A;  1L0O A;  4U7O A;  4DZY A;  1ZXM A;  3CGZ A;  4LWH A;  1EA6 A;  3B26 A;  3C0E A;  5CF0 A;  4HXZ A;  2XDX A;  4GFN A;  4MP2 A;  5BOC A;  1ID0 A;  3EHH A;  3R92 A;  2VWC A;  3CRL A;  1YC1 A;  1Y8P A;  3A0Z A;  3WHA A;  2ESA A;  2YKI A;  4LWG A;  2IOR A;  3HYY A;  3A0R A;  5FWK A;  3A0W A;  3TZ5 A;  4HXW A;  4MPN A;  2YGE A;  4XTJ A;  1YC4 A;  2YEG A;  2IWS A;  4HYM A;  2YJW A;  4V26 A;  3EHJ A;  1NHI A;  2VCI A;  4ASB A;  1KIJ A;  4YKY A;  2AKP A;  2QF6 A;  2YEJ A;  4U7N A;  3R91 A;  1YET A;  3VHD A;  3T2S A;  1THN A;  4XKO A;  3FT8 A;  2CG9 A;  2HG1 A;  3B27 A;  1UYC A;  3GIE A;  3OPD A;  3Q5J A;  3VAD A;  4HYP A;  3IED A;  2BU2 A;  2YEA A;  4CE3 A;  3ZXO A;  2WI2 A;  1TC0 A;  1I5A A;  2FXS A;  4E01 A;  4O09 A;  4CWO A;  3GIF A;  5J6A A;  4DUH A;  4NH7 A;  4AWO A;  4GEE A;  1B62 A;  2XJJ A;  2YGF A;  2WEQ A;  5M4N A;  3G7E A;  1ZW9 A;  2YE4 A;  3A0X A;  5D7R A;  3HYZ A;  2H55 A;  4YKW A;  1OSF A;  4O07 A;  2QG0 A;  1BGQ A;  1YER A;  4JQL A;  3TZ2 A;  1YT0 A;  1UYH A;  4KSG A;  3HZ1 A;  2YKJ A;  1KZN A;  2YED A;  5FND A;  4R1F A;  1YSZ A;  2ZDY A;  3RLR A;  4MPC A;  3PEH A;  3OW6 A;  1Y8N A;  2GFD A;  3T0H A;  1AMW A;  1UY9 A;  2HKJ A;  1TH8 A;  4MPE A;  3TTZ A;  4XIT A;  4AWQ A;  4ZKI A;  4ASF A;  2XDK A;  1ZXN A;  3FT5 A;  3B25 A;  2BYH A;  2JJC A;  4PRX A;  4EFU A;  4MOT A;  4CWS A;  2ZKJ A;  1H7U A;  1TIL A;  5CPH A;  3VHC A;  1QZR A;  2BU7 A;  3RLQ A;  4MP7 A;  3H80 A;  5D7C A;  4CWN A;  1Z5A A;  4BIU A;  4ASG A;  2BT0 A;  4BIZ A;  4HZ0 A;  3RLP A;  4H81 A;  4XC0 A;  2Q8H A;  1TC6 A;  4L94 A;  3A0Y A;  1R62 A;  3CWV A;  4EGK A;  3C11 A;  1I58 A;  4X9L A;  3O2F A;  2CGF A;  3T0Z A;  3TUH A;  4EMV A;  1US7 A;  5CTW A;  4K4O A;  4YKZ A;  2IWX A;  4CWT A;  2YKE A;  2XCM A;  4WUC A;  4I3H A;  4XKA A;  1Z5B A;  4Q20 A;  3PEJ A;  4FCP A;  3ZXQ A;  2QFO A;  3K60 A;  2O1W A;  1Y4S A;  4JAV A;  3HZ5 A;  4LWI A;  4L91 A;  2YGA A;  3OWD A;  4YKR A;  3NMQ A;  3H4L A;  3TZ0 A;  5M4M A;  4I5S A;  3GIG A;  4FCR A;  1ZWH A;  4HZ5 A;  5D6P A;  2BSM A;  4CE2 A;  4H85 A;  4L93 A;  2WI1 A;  3D0B A;  3O6O A;  4FCQ A;  4YKQ A;  2WER A;  1AH8 A;  2YEF A;  4XD8 A;  1Z59 A;  5M4E A;  4KTN A;  4BQJ A;  4LPB A;  1S16 A;  2YJX A;  2BRC A;  2YEB A;  5M4K A;  1B63 A;  3CGY A;  2YI0 A;  2Q2E B;  2YEE A;  4YKU A;  2WI7 A;  3OWB A;  5M4H A;  1YES A;  2YEH A;  4XIP A;  4FPP A;  2ZBK B;  1UY8 A;  3WQ9 A;  4P8O A;  2O1V A;  3R4O A;  3U67 A;  1I5B A;  1UYE A;  2BRE A;  4CWR A;  2K5B A;  4CWP A;  3SL2 A;  3U2K A;  5IN9 A;  4URO A;  5GGZ A;  1TID A;  3LPS A;  3MNR P;  4XKK A;  4O05 A;  1S14 A;  4ZVI A;  4XCJ A;  1UYL A;  2YK9 A;  4XE2 A;  2YKB A;  3G7B A;  2CCT A;  2YE5 A;  4P7A A;  1YT2 A;  2BTZ A;  2IWU A;  2YI5 A;  1Z5C A;  2VCJ A;  4URM A;  1TBW A;  1I5C A;  2WI3 A;  3LNU A;  4GQT A;  1BKN A;  2XHR A;  4GT8 A;  1UY7 A;  2XX2 A;  1I59 A;  1I5D A;  3Q5K A;  3O0I A;  5BOD A;  3KE6 A;  4O04 A;  2YE8 A;  2VW5 A;  4KP4 A;  4CWF A;  1NHH A;  4XDM A;  4GGL A;  1YS3 A;  2FWZ A;  3HHU A;  1BXD A;  2PNR A;  5CTU A;  5M4P A;  1EI1 A;  1GJV A;  5D7D A;  2XDS A;  4B7P A;  4AS9 A;  2XJG A;  2YE9 A;  2JKI A;  4KQV A;  2ZDX A;  3G75 A;  4NH8 A;  3EKR A;  3A0T A;  1UY6 A;  5FNF A;  4BAE A;  2BU8 A;  4HY6 A;  2XX5 A;  4AWP A;  1QY8 A;  3DGE A;  4WUD A;  3D36 A;  2Q8I A;  4EGH A;  4CWQ A;  2E0A A;  5D6Q A;  4L8Z A;  1YC3 A;  3HEK A;  4V25 A;  2BZ5 A;  4E02 A;  2GQP A;  2WI6 A;  1AM1 A;  3K99 A;  2YKC A;  2BYI A;  2H8M A;  2FWY A;  4EM7 A;  4YKX A;  1UYM A;  3ZKD A;  2HCH A;  4YKT A;  1B3Q A;  4XCL A;  4QPJ A;  1AH6 A;  4BQG A;  1MU5 A;  2XAB A;  1UYK A;  4H7Q A;  3ZM7 A;  3ZKB A;  3B28 A;  3BMY A;  4KFG A;  2YE3 A;  2XK2 A;  5F5R A;  3TZ4 A;  3D2R A;  3T1K A;  4ASA A;  2WEP A;  5J71 A;  5L3J A;  3R4N A;  2XJX A;  2XX4 A;  2WI4 A;  2EXL A;  3R4P A;  3INX A;  1A4H A;  4NH9 A;  2XHX A;  1Y4U A;  1NHJ A;  4LP0 A;  5F3K A;  4LWF A;  2YI6 A;  2Q8F A;  4W7T A;  2BU5 A;  1BYQ A;  2XDL A;  4HY1 A;  2O1U A;  2YEI A;  3RKZ A;  4PL9 A;  4L90 A;  3QTF A;  3B24 A; 
#chains in the Genus database with same CATH topology
 2XHT A;  3VHA A;  4XIR A;  1GKZ A;  4B6C A;  2XD6 A;  3EKO A;  3K98 A;  5CTX A;  4CE1 A;  4GCZ A;  4BXI A;  2IOQ A;  4URL A;  4LWE A;  3GIG B;  3R4M A;  4WUB A;  4EFT A;  2BU6 A;  3BM9 A;  2WI5 A;  2CH4 A;  1UYD A;  5C93 A;  1AJ6 A;  3OMU A;  1MX0 A;  4R3A A;  4R3M A;  1UYI A;  2YK2 A;  4JAU A;  4O0B A;  3QDD A;  2UWD A;  2CCU A;  1U2O A;  4EEH A;  4PU9 A;  3EHG A;  4PRV A;  1UYF A;  1YT1 A;  5FNC A;  3CRK A;  4QPK A;  1GKX A;  1UYG A;  3U2D A;  5CTY A;  4JAS A;  4KSH A;  4EGI A;  2YEC A;  5IDJ A;  4FMT A;  2QG2 A;  3INW A;  1U0Z A;  4MBC A;  1JM6 A;  2YI7 A;  3EHF A;  3Q5L A;  2YE7 A;  1F51 A;  2YE6 A;  2FYP A;  3JZ3 A;  2Q8G A;  3K97 A;  4MB9 A;  1PVG A;  2YE2 A;  2CCS A;  4E00 A;  1Y8O A;  3FV5 A;  3T10 A;  2IOP A;  1H7S A;  1QYE A;  4XIQ A;  2C2A A;  4U93 A;  4URN A;  1YSR A;  5IDM A;  2XDU A;  1L0O A;  4U7O A;  4DZY A;  1ZXM A;  3CGZ A;  4LWH A;  1EA6 A;  3B26 A;  3C0E A;  5CF0 A;  4HXZ A;  2XDX A;  4GFN A;  4MP2 A;  5BOC A;  1ID0 A;  3EHH A;  3R92 A;  2VWC A;  3CRL A;  1YC1 A;  1Y8P A;  3A0Z A;  3WHA A;  2ESA A;  2YKI A;  4LWG A;  2IOR A;  3HYY A;  3A0R A;  5FWK A;  3A0W A;  3TZ5 A;  4HXW A;  4MPN A;  2YGE A;  4XTJ A;  1YC4 A;  2YEG A;  2IWS A;  4HYM A;  2YJW A;  4V26 A;  3EHJ A;  1NHI A;  2VCI A;  4ASB A;  1KIJ A;  4YKY A;  2AKP A;  2QF6 A;  2YEJ A;  4U7N A;  3R91 A;  1YET A;  3VHD A;  3T2S A;  1THN A;  4XKO A;  3FT8 A;  2CG9 A;  2HG1 A;  3B27 A;  1UYC A;  3GIE A;  3OPD A;  3Q5J A;  3VAD A;  4HYP A;  3IED A;  2BU2 A;  2YEA A;  4CE3 A;  3ZXO A;  2WI2 A;  1TC0 A;  1I5A A;  2FXS A;  4E01 A;  4O09 A;  4CWO A;  3GIF A;  5J6A A;  4DUH A;  4NH7 A;  4AWO A;  4GEE A;  1B62 A;  2XJJ A;  2YGF A;  2WEQ A;  5M4N A;  3G7E A;  1ZW9 A;  2YE4 A;  3A0X A;  5D7R A;  4E72 A;  3HYZ A;  2H55 A;  4YKW A;  1OSF A;  4O07 A;  2QG0 A;  1BGQ A;  1YER A;  4JQL A;  3TZ2 A;  2C1G A;  1YT0 A;  1UYH A;  2HHI A;  4KSG A;  3HZ1 A;  2YKJ A;  1KZN A;  2YED A;  5FND A;  4R1F A;  1YSZ A;  2ZDY A;  3RLR A;  4MPC A;  3PEH A;  3OW6 A;  1Y8N A;  2GFD A;  3T0H A;  1AMW A;  1UY9 A;  2HKJ A;  1TH8 A;  4MPE A;  3TTZ A;  4XIT A;  4AWQ A;  4ZKI A;  4ASF A;  2XDK A;  1ZXN A;  3FT5 A;  3B25 A;  2BYH A;  2JJC A;  4PRX A;  4EFU A;  4MOT A;  4CWS A;  2ZKJ A;  1H7U A;  1TIL A;  5CPH A;  3VHC A;  1QZR A;  2BU7 A;  3RLQ A;  4MP7 A;  3H80 A;  5D7C A;  4CWN A;  1Z5A A;  4BIU A;  4ASG A;  2BT0 A;  4BIZ A;  4HZ0 A;  3RLP A;  4H81 A;  4XC0 A;  2Q8H A;  1TC6 A;  4L94 A;  3A0Y A;  1R62 A;  3CWV A;  4EGK A;  3C11 A;  1I58 A;  4X9L A;  3O2F A;  2CGF A;  3T0Z A;  3TUH A;  4EMV A;  1US7 A;  5CTW A;  4K4O A;  4YKZ A;  2IWX A;  4CWT A;  2YKE A;  2XCM A;  4WUC A;  4I3H A;  4XKA A;  1Z5B A;  4Q20 A;  3PEJ A;  4FCP A;  3ZXQ A;  2QFO A;  3K60 A;  2O1W A;  1Y4S A;  4JAV A;  3HZ5 A;  4LWI A;  4L91 A;  2YGA A;  3OWD A;  4YKR A;  3NMQ A;  3H4L A;  3TZ0 A;  5M4M A;  4I5S A;  3GIG A;  4FCR A;  1ZWH A;  4HZ5 A;  5D6P A;  2BSM A;  4CE2 A;  4H85 A;  4L93 A;  2WI1 A;  3D0B A;  3O6O A;  4FCQ A;  4YKQ A;  2WER A;  1AH8 A;  2YEF A;  4XD8 A;  1Z59 A;  5M4E A;  4KTN A;  4BQJ A;  4LPB A;  1S16 A;  2YJX A;  2BRC A;  2YEB A;  5M4K A;  1B63 A;  3CGY A;  2YI0 A;  2Q2E B;  2YEE A;  4YKU A;  2WI7 A;  3OWB A;  3CYG A;  1YES A;  2YEH A;  5M4H A;  4XIP A;  4FPP A;  2ZBK B;  1UY8 A;  3WQ9 A;  4P8O A;  2O1V A;  3R4O A;  3U67 A;  2C1I A;  1I5B A;  1UYE A;  2BRE A;  4CWR A;  2K5B A;  4CWP A;  3SL2 A;  3U2K A;  5IN9 A;  4URO A;  5GGZ A;  1TID A;  3LPS A;  3MNR P;  4XKK A;  4O05 A;  1S14 A;  4ZVI A;  4XCJ A;  1UYL A;  2YK9 A;  4XE2 A;  2YKB A;  3G7B A;  2CCT A;  2YE5 A;  1IXM A;  4P7A A;  1YT2 A;  2BTZ A;  2IWU A;  2YI5 A;  1Z5C A;  2VCJ A;  4URM A;  1TBW A;  1I5C A;  2WI3 A;  3LNU A;  4GQT A;  1BKN A;  2XHR A;  4GT8 A;  1UY7 A;  2XX2 A;  1I59 A;  1I5D A;  3Q5K A;  3O0I A;  5BOD A;  3KE6 A;  4O04 A;  2YE8 A;  3S5T A;  2VW5 A;  4KP4 A;  4CWF A;  1NHH A;  4XDM A;  4GGL A;  1YS3 A;  2FWZ A;  3HHU A;  1BXD A;  2PNR A;  5CTU A;  5M4P A;  1EI1 A;  1GJV A;  5D7D A;  2XDS A;  4B7P A;  4AS9 A;  2XJG A;  2YE9 A;  2JKI A;  4KQV A;  2ZDX A;  3G75 A;  4NH8 A;  3EKR A;  3A0T A;  1UY6 A;  5FNF A;  4BAE A;  2BU8 A;  4HY6 A;  2XX5 A;  4AWP A;  1QY8 A;  3DGE A;  4WUD A;  3D36 A;  2Q8I A;  4EGH A;  4CWQ A;  2E0A A;  5D6Q A;  4L8Z A;  1YC3 A;  3HEK A;  4V25 A;  2BZ5 A;  4E02 A;  2GQP A;  2WI6 A;  1AM1 A;  3K99 A;  2YKC A;  2BYI A;  2H8M A;  2FWY A;  4EM7 A;  4YKX A;  1UYM A;  3ZKD A;  2HCH A;  4YKT A;  1B3Q A;  4XCL A;  4QPJ A;  1AH6 A;  4BQG A;  1MU5 A;  2XAB A;  1UYK A;  4H7Q A;  3ZM7 A;  3ZKB A;  3B28 A;  3BMY A;  4KFG A;  2YE3 A;  2XK2 A;  5F5R A;  3TZ4 A;  3D2R A;  3T1K A;  4ASA A;  2WEP A;  5J71 A;  5L3J A;  3R4N A;  2XJX A;  2XX4 A;  2WI4 A;  2EXL A;  3R4P A;  3INX A;  1A4H A;  4NH9 A;  2XHX A;  1Y4U A;  3LMM A;  1NHJ A;  4LP0 A;  5F3K A;  4LWF A;  2YI6 A;  2Q8F A;  4W7T A;  2BU5 A;  1BYQ A;  2XDL A;  4HY1 A;  2O1U A;  2YEI A;  3RKZ A;  2FTK A;  4PL9 A;  5JEN A;  4L90 A;  3QTF A;  3B24 A; 
#chains in the Genus database with same CATH homology
 2XHT A;  3VHA A;  4XIR A;  1GKZ A;  4B6C A;  2XD6 A;  3EKO A;  3K98 A;  5CTX A;  4CE1 A;  4GCZ A;  4BXI A;  2IOQ A;  4URL A;  4LWE A;  3GIG B;  3R4M A;  4WUB A;  4EFT A;  2BU6 A;  3BM9 A;  2WI5 A;  2CH4 A;  1UYD A;  5C93 A;  1AJ6 A;  3OMU A;  1MX0 A;  4R3A A;  4R3M A;  1UYI A;  2YK2 A;  4JAU A;  4O0B A;  3QDD A;  2UWD A;  2CCU A;  1U2O A;  4EEH A;  4PU9 A;  3EHG A;  4PRV A;  1UYF A;  1YT1 A;  5FNC A;  3CRK A;  4QPK A;  1GKX A;  1UYG A;  3U2D A;  5CTY A;  4JAS A;  4KSH A;  4EGI A;  2YEC A;  5IDJ A;  4FMT A;  2QG2 A;  3INW A;  1U0Z A;  4MBC A;  1JM6 A;  2YI7 A;  3EHF A;  3Q5L A;  2YE7 A;  2YE6 A;  2FYP A;  3JZ3 A;  2Q8G A;  3K97 A;  4MB9 A;  1PVG A;  2YE2 A;  2CCS A;  4E00 A;  1Y8O A;  3FV5 A;  3T10 A;  2IOP A;  1H7S A;  1QYE A;  4XIQ A;  2C2A A;  4U93 A;  4URN A;  1YSR A;  5IDM A;  2XDU A;  1L0O A;  4U7O A;  4DZY A;  1ZXM A;  3CGZ A;  4LWH A;  1EA6 A;  3B26 A;  3C0E A;  5CF0 A;  4HXZ A;  2XDX A;  4GFN A;  4MP2 A;  5BOC A;  1ID0 A;  3EHH A;  3R92 A;  2VWC A;  3CRL A;  1YC1 A;  1Y8P A;  3A0Z A;  3WHA A;  2ESA A;  2YKI A;  4LWG A;  2IOR A;  3HYY A;  3A0R A;  5FWK A;  3A0W A;  3TZ5 A;  4HXW A;  4MPN A;  2YGE A;  4XTJ A;  1YC4 A;  2YEG A;  2IWS A;  4HYM A;  2YJW A;  4V26 A;  3EHJ A;  1NHI A;  2VCI A;  4ASB A;  1KIJ A;  4YKY A;  2AKP A;  2QF6 A;  2YEJ A;  4U7N A;  3R91 A;  1YET A;  3VHD A;  3T2S A;  1THN A;  4XKO A;  3FT8 A;  2CG9 A;  2HG1 A;  3B27 A;  1UYC A;  3GIE A;  3OPD A;  3Q5J A;  3VAD A;  4HYP A;  3IED A;  2BU2 A;  2YEA A;  4CE3 A;  3ZXO A;  2WI2 A;  1TC0 A;  1I5A A;  2FXS A;  4E01 A;  4O09 A;  4CWO A;  3GIF A;  5J6A A;  4DUH A;  4NH7 A;  4AWO A;  4GEE A;  1B62 A;  2XJJ A;  2YGF A;  2WEQ A;  5M4N A;  3G7E A;  1ZW9 A;  2YE4 A;  3A0X A;  5D7R A;  3HYZ A;  2H55 A;  4YKW A;  1OSF A;  4O07 A;  2QG0 A;  1BGQ A;  1YER A;  4JQL A;  3TZ2 A;  1YT0 A;  1UYH A;  4KSG A;  3HZ1 A;  2YKJ A;  1KZN A;  2YED A;  5FND A;  4R1F A;  1YSZ A;  2ZDY A;  3RLR A;  4MPC A;  3PEH A;  3OW6 A;  1Y8N A;  2GFD A;  3T0H A;  1AMW A;  1UY9 A;  2HKJ A;  1TH8 A;  4MPE A;  3TTZ A;  4XIT A;  4AWQ A;  4ZKI A;  4ASF A;  2XDK A;  1ZXN A;  3FT5 A;  3B25 A;  2BYH A;  2JJC A;  4PRX A;  4EFU A;  4MOT A;  4CWS A;  2ZKJ A;  1H7U A;  1TIL A;  5CPH A;  3VHC A;  1QZR A;  2BU7 A;  3RLQ A;  4MP7 A;  3H80 A;  5D7C A;  4CWN A;  1Z5A A;  4BIU A;  4ASG A;  2BT0 A;  4BIZ A;  4HZ0 A;  3RLP A;  4H81 A;  4XC0 A;  2Q8H A;  1TC6 A;  4L94 A;  3A0Y A;  1R62 A;  3CWV A;  4EGK A;  3C11 A;  1I58 A;  4X9L A;  3O2F A;  2CGF A;  3T0Z A;  3TUH A;  4EMV A;  1US7 A;  5CTW A;  4K4O A;  4YKZ A;  2IWX A;  4CWT A;  2YKE A;  2XCM A;  4WUC A;  4I3H A;  4XKA A;  1Z5B A;  4Q20 A;  3PEJ A;  4FCP A;  3ZXQ A;  2QFO A;  3K60 A;  2O1W A;  1Y4S A;  4JAV A;  3HZ5 A;  4LWI A;  4L91 A;  2YGA A;  3OWD A;  4YKR A;  3NMQ A;  3H4L A;  3TZ0 A;  5M4M A;  4I5S A;  3GIG A;  4FCR A;  1ZWH A;  4HZ5 A;  5D6P A;  2BSM A;  4CE2 A;  4H85 A;  4L93 A;  2WI1 A;  3D0B A;  3O6O A;  4FCQ A;  4YKQ A;  2WER A;  1AH8 A;  2YEF A;  4XD8 A;  1Z59 A;  5M4E A;  4KTN A;  4BQJ A;  4LPB A;  1S16 A;  2YJX A;  2BRC A;  2YEB A;  5M4K A;  1B63 A;  3CGY A;  2YI0 A;  2Q2E B;  2YEE A;  4YKU A;  2WI7 A;  3OWB A;  5M4H A;  1YES A;  2YEH A;  4XIP A;  4FPP A;  2ZBK B;  1UY8 A;  3WQ9 A;  4P8O A;  2O1V A;  3R4O A;  3U67 A;  1I5B A;  1UYE A;  2BRE A;  4CWR A;  2K5B A;  4CWP A;  3SL2 A;  3U2K A;  5IN9 A;  4URO A;  5GGZ A;  1TID A;  3LPS A;  3MNR P;  4XKK A;  4O05 A;  1S14 A;  4ZVI A;  4XCJ A;  1UYL A;  2YK9 A;  4XE2 A;  2YKB A;  3G7B A;  2CCT A;  2YE5 A;  4P7A A;  1YT2 A;  2BTZ A;  2IWU A;  2YI5 A;  1Z5C A;  2VCJ A;  4URM A;  1TBW A;  1I5C A;  2WI3 A;  3LNU A;  4GQT A;  1BKN A;  2XHR A;  4GT8 A;  1UY7 A;  2XX2 A;  1I59 A;  1I5D A;  3Q5K A;  3O0I A;  5BOD A;  3KE6 A;  4O04 A;  2YE8 A;  2VW5 A;  4KP4 A;  4CWF A;  1NHH A;  4XDM A;  4GGL A;  1YS3 A;  2FWZ A;  3HHU A;  1BXD A;  2PNR A;  5CTU A;  5M4P A;  1EI1 A;  1GJV A;  5D7D A;  2XDS A;  4B7P A;  4AS9 A;  2XJG A;  2YE9 A;  2JKI A;  4KQV A;  2ZDX A;  3G75 A;  4NH8 A;  3EKR A;  3A0T A;  1UY6 A;  5FNF A;  4BAE A;  2BU8 A;  4HY6 A;  2XX5 A;  4AWP A;  1QY8 A;  3DGE A;  4WUD A;  3D36 A;  2Q8I A;  4EGH A;  4CWQ A;  2E0A A;  5D6Q A;  4L8Z A;  1YC3 A;  3HEK A;  4V25 A;  2BZ5 A;  4E02 A;  2GQP A;  2WI6 A;  1AM1 A;  3K99 A;  2YKC A;  2BYI A;  2H8M A;  2FWY A;  4EM7 A;  4YKX A;  1UYM A;  3ZKD A;  2HCH A;  4YKT A;  1B3Q A;  4XCL A;  4QPJ A;  1AH6 A;  4BQG A;  1MU5 A;  2XAB A;  1UYK A;  4H7Q A;  3ZM7 A;  3ZKB A;  3B28 A;  3BMY A;  4KFG A;  2YE3 A;  2XK2 A;  5F5R A;  3TZ4 A;  3D2R A;  3T1K A;  4ASA A;  2WEP A;  5J71 A;  5L3J A;  3R4N A;  2XJX A;  2XX4 A;  2WI4 A;  2EXL A;  3R4P A;  3INX A;  1A4H A;  4NH9 A;  2XHX A;  1Y4U A;  1NHJ A;  4LP0 A;  5F3K A;  4LWF A;  2YI6 A;  2Q8F A;  4W7T A;  2BU5 A;  1BYQ A;  2XDL A;  4HY1 A;  2O1U A;  2YEI A;  3RKZ A;  4PL9 A;  4L90 A;  3QTF A;  3B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...