4GFNA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
total genus 57
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gfnA00
3EKOA 4EGKA 4L94A 1GJVA 2YK9A 4JQLA 4R1FA 4XIQA 2XK2A 1ZXMA 4B7PA 4LP0A 3OWBA 2YEEA 4L90A 1QYEA 3QDDA 1AJ6A 5CTYA 4U7NA 5M4PA 2YKJA 4AWOA 4KP4A 4XD8A 4FPPA 4YKTA 4X9LA 2YEGA 2CCUA 2ZKJA 3A0RA 1I5CA 2FXSA 1ZWHA 2ZBKB 1BXDA 3T10A 2BU6A 4FCRA 1UYDA 2WI4A 2WI6A 4FCPA 1ZW9A 1MU5A 4XIRA 3TTZA 3ZKBA 4JASA 4HXZA 5FNCA 4MPEA 3K98A 3B24A 4V25A 1YERA 3OWDA 1Z5BA 4FCQA 5BODA 2YJXA 4YKXA 3IEDA 4HZ0A 2H55A 4EGIA 4ZVIA 4GEEA 1Y4UA 3CRLA 4L93A 1Z5AA 1NHHA 4H85A 4MP2A 4DUHA 4GGLA 4UROA 2VCJA 1I58A 4CE1A 2QF6A 3HZ1A 3TZ2A 3U2KA 5D7DA 2O1WA 3O6OA 5FNFA 5J6AA 2XDSA 4HY1A 3MNRP 3FV5A 2HG1A 4E01A 3TZ4A 4EGHA 4BIUA 4URMA 2XDXA 3CGZA 4H81A 4K4OA 1Z5CA 4ZKIA 2IOQA 3HHUA 4JAUA 2Q2EB 1EA6A 1THNA 4LWIA 3A0WA 4CE3A 2FWYA 2BTZA 4V26A 1ZXNA 5IN9A 3T0HA 4PRXA 2BU5A 1QZRA 3A0ZA 4NH7A 2H8MA 4LWFA 4EFTA 5IDMA 2VCIA 4CWTA 4JAVA 2YE3A 1KZNA 3D2RA 4LPBA 1TC0A 3Q5LA 4I5SA 3A0TA 2XJGA 1EI1A 4CE2A 2CCSA 3WHAA 2EXLA 2ESAA 2ZDXA 4XITA 2O1UA 1H7SA 2QG0A 1R62A 4BAEA 2YEJA 4WUDA 2XCMA 1B62A 1AM1A 2YE5A 4YKUA 2XD6A 3R4MA 2WERA 3CRKA 1TBWA 5FNDA 1TIDA 1B63A 2BU8A 4P8OA 2VW5A 2YE4A 3C11A 3RLPA 4ASBA 2WI2A 2BSMA 5IDJA 3HZ5A 4U93A 1UYLA 4GCZA 1UYHA 2IWUA 1UYMA 3A0XA 3FT5A 2IWXA 3RKZA 5BOCA 4YKZA 2YKIA 4XE2A 4QPJA 2QG2A 1UYEA 1AH6A 4KSGA 4KQVA 4URNA 1U2OA 2YEBA 1U0ZA 2XJJA 3FT8A 2GFDA 3C0EA 2ZDYA 4KFGA 2IOPA 4XKKA 3ZXOA 4GT8A 3EHJA 1YESA 2AKPA 3TZ0A 4EMVA 3NMQA 4YKRA 1S16A 4GFNA 3EHGA 3PEHA 2YI5A 4O09A 2BREA 4YKWA 1Y8PA 4XTJA 2HCHA 4PU9A 4MOTA 5CF0A 1MX0A 3DGEA 3K60A 3H4LA 4CWOA 4WUBA 1GKXA 2YGAA 3G7BA 4O04A 1I5AA 2BZ5A 1US7A 1ID0A 3LPSA 4O05A 4XIPA 4YKQA 5D6PA 4AWQA 2YK2A 4CWQA 2YKBA 5D7CA 4BQGA 4QPKA 1UYGA 2YE7A 1UYKA 3HYYA 2QFOA 2XHXA 5M4EA 4XC0A 3A0YA 1A4HA 2Q8HA 2YE2A 3B25A 2YKEA 2XX5A 3B27A 4KTNA 4NH8A 1YSRA 1YT2A 4XDMA 2YEDA 1YT1A 1YT0A 1B3QA 4B6CA 1UYCA 5CTXA 1Y4SA 1Y8OA 4W7TA 3K99A 5M4KA 1UY9A 2XHTA 3PEJA 3RLQA 2UWDA 1TH8A 2XJXA 3LNUA 2YEFA 5CPHA 2XX2A 2CG9A 4ASFA 2YEIA 3OW6A 4MBCA 4HY6A 4BXIA 4MP7A 3R4OA 5L3JA 2VWCA 2WEQA 4LWEA 3EKRA 2YI6A 3K97A 4EM7A 1AH8A 1Z59A 1BYQA 4XKOA 4GQTA 1AMWA 1UYFA 2C2AA 1UYIA 4FMTA 4CWRA 4XCLA 4O07A 3VADA 4BIZA 3BMYA 3G7EA 2YI0A 2JKIA 3WQ9A 3GIEA 2YEHA 3QTFA 2BT0A 3INWA 4KSHA 3CGYA 3T2SA 3T0ZA 3T1KA 2WI3A 4EFUA 2BU2A 2K5BA 4EEHA 1TC6A 3ZKDA 4CWSA 4PL9A 3R91A 1KIJA 5D6QA 4NH9A 1YSZA 3VHDA 2YKCA 1JM6A 2YE9A 4R3MA 2FWZA 2XDLA 4L91A 4HXWA 2BU7A 1UY8A 3BM9A 4ASGA 1OSFA 3GIGA 3B28A 2YECA 3R4PA 3D36A 4HYMA 3OMUA 2JJCA 5FWKA 3H80A 3Q5JA 1YC1A 4E02A 3U2DA 2Q8FA 4AWPA 2PNRA 2WI1A 4R3AA 3ZM7A 3EHFA 3D0BA 2WEPA 2CH4A 2WI5A 3O0IA 2YI7A 2XHRA 1UY7A 4MB9A 4Q20A 2WI7A 4WUCA 4LWGA 2O1VA 2XDKA 1YC3A 4MPNA 2Q8IA 5M4MA 5M4NA 3B26A 2YGFA 2IWSA 3EHHA 3INXA 3U67A 2XDUA 1YS3A 4MPCA 1I59A 1YC4A 5F3KA 1NHIA 4XKAA 2BRCA 4L8ZA 2YE6A 3O2FA 2GQPA 3R92A 4CWNA 3HEKA 1S14A 4H7QA 3VHCA 5CTUA 2IORA 1TILA 2XABA 3HYZA 4HYPA 1QY8A 5C93A 1BKNA 2YEAA 3KE6A 2Q8GA 2CCTA 4XCJA 1UY6A 2FYPA 4BQJA 3Q5KA 2BYHA 4CWPA 4P7AA 3GIGB 1GKZA 1YETA 1Y8NA 1L0OA 3VHAA 3RLRA 4URLA 4ASAA 3G75A 2BYIA 4U7OA 5CTWA 2E0AA 2CGFA 4YKYA 3JZ3A 5GGZA 1NHJA 3OPDA 3TZ5A 3SL2A 4PRVA 5F5RA 4AS9A 2XX4A 2YE8A 1H7UA 5J71A 4DZYA 3R4NA 3TUHA 4LWHA 3ZXQA 1I5BA 5D7RA 4O0BA 2HKJA 1PVGA 4HZ5A 1BGQA 4E00A 2YJWA 4CWFA 3CWVA 4I3HA 2YGEA 5M4HA 1I5DA 3GIFA
chains in the Genus database with same CATH superfamily
3EKOA 4EGKA 4L94A 1GJVA 2YK9A 4JQLA 4R1FA 4XIQA 2XK2A 1ZXMA 4B7PA 4LP0A 3OWBA 2YEEA 4L90A 1QYEA 3QDDA 1AJ6A 5CTYA 4U7NA 5M4PA 2YKJA 4AWOA 4KP4A 4XD8A 4FPPA 4YKTA 4X9LA 2YEGA 2CCUA 2ZKJA 3A0RA 1I5CA 2FXSA 1ZWHA 2ZBKB 1BXDA 3T10A 2BU6A 4FCRA 1UYDA 2WI4A 2WI6A 4FCPA 1ZW9A 1MU5A 4XIRA 3TTZA 3ZKBA 4JASA 4HXZA 5FNCA 4MPEA 3K98A 3B24A 4V25A 1YERA 3OWDA 4E72A 1Z5BA 4FCQA 5BODA 2YJXA 4YKXA 3IEDA 4HZ0A 2H55A 4EGIA 4ZVIA 4GEEA 1Y4UA 3CRLA 4L93A 1Z5AA 1NHHA 4H85A 4MP2A 4DUHA 4GGLA 4UROA 2VCJA 1I58A 4CE1A 2QF6A 3HZ1A 3TZ2A 3U2KA 5D7DA 2O1WA 3O6OA 5FNFA 5J6AA 2XDSA 4HY1A 3MNRP 3FV5A 2HG1A 4E01A 3TZ4A 4EGHA 4BIUA 4URMA 5JENA 2XDXA 3CGZA 4H81A 4K4OA 1Z5CA 4ZKIA 2IOQA 3HHUA 4JAUA 2Q2EB 1EA6A 1THNA 4LWIA 3A0WA 4CE3A 2FWYA 2BTZA 4V26A 1ZXNA 5IN9A 3T0HA 4PRXA 2BU5A 1QZRA 3A0ZA 4NH7A 2H8MA 4LWFA 4EFTA 5IDMA 2VCIA 4CWTA 4JAVA 2YE3A 1KZNA 3D2RA 4LPBA 1TC0A 3Q5LA 4I5SA 3A0TA 2XJGA 1EI1A 4CE2A 2CCSA 3WHAA 2EXLA 2ESAA 2ZDXA 4XITA 2O1UA 1H7SA 2QG0A 3LMMA 1R62A 4BAEA 2YEJA 4WUDA 2XCMA 1B62A 1AM1A 2YE5A 4YKUA 2XD6A 3R4MA 2WERA 3CRKA 1TBWA 5FNDA 1TIDA 1B63A 2BU8A 4P8OA 2VW5A 2YE4A 3C11A 3RLPA 4ASBA 2WI2A 2BSMA 5IDJA 3HZ5A 4U93A 1UYLA 4GCZA 1UYHA 2IWUA 1UYMA 3A0XA 3FT5A 2IWXA 3RKZA 5BOCA 4YKZA 2YKIA 4XE2A 4QPJA 2QG2A 1UYEA 1AH6A 4KSGA 4KQVA 4URNA 1U2OA 2YEBA 1U0ZA 2XJJA 3FT8A 2GFDA 3C0EA 2ZDYA 4KFGA 2IOPA 4XKKA 3ZXOA 4GT8A 3EHJA 1YESA 2AKPA 3TZ0A 4EMVA 3NMQA 4YKRA 1S16A 4GFNA 3EHGA 3PEHA 2YI5A 4O09A 2BREA 4YKWA 1Y8PA 4XTJA 2HCHA 4PU9A 4MOTA 5CF0A 1MX0A 3DGEA 3K60A 3H4LA 4CWOA 4WUBA 1GKXA 2YGAA 3G7BA 4O04A 1I5AA 2BZ5A 1US7A 1ID0A 3LPSA 2HHIA 4O05A 4XIPA 4YKQA 5D6PA 4AWQA 2YK2A 4CWQA 2YKBA 5D7CA 4BQGA 4QPKA 1UYGA 2YE7A 1UYKA 3HYYA 2QFOA 2XHXA 5M4EA 4XC0A 3A0YA 1A4HA 2Q8HA 2YE2A 3B25A 2YKEA 2XX5A 3B27A 4KTNA 4NH8A 1YSRA 1YT2A 4XDMA 2YEDA 1YT1A 1YT0A 1B3QA 4B6CA 1UYCA 5CTXA 1Y4SA 1Y8OA 4W7TA 3K99A 5M4KA 1UY9A 2XHTA 3PEJA 3RLQA 2C1GA 2UWDA 1TH8A 2XJXA 3LNUA 2YEFA 5CPHA 2XX2A 2CG9A 1F51A 4ASFA 2YEIA 3S5TA 3OW6A 4MBCA 4HY6A 4BXIA 4MP7A 3R4OA 5L3JA 2VWCA 2WEQA 4LWEA 3EKRA 2YI6A 3K97A 4EM7A 1AH8A 1Z59A 1BYQA 4XKOA 4GQTA 1AMWA 1UYFA 2C2AA 1UYIA 4FMTA 4CWRA 4XCLA 4O07A 3VADA 4BIZA 3BMYA 3G7EA 2YI0A 2JKIA 3WQ9A 3GIEA 2YEHA 3QTFA 2BT0A 3INWA 4KSHA 3CGYA 3T2SA 3T0ZA 3T1KA 2WI3A 4EFUA 2BU2A 2K5BA 4EEHA 1TC6A 3ZKDA 4CWSA 4PL9A 3R91A 1KIJA 5D6QA 4NH9A 1YSZA 3VHDA 2YKCA 1JM6A 2YE9A 4R3MA 2FWZA 2XDLA 4L91A 4HXWA 2BU7A 1UY8A 3BM9A 4ASGA 1OSFA 3GIGA 3B28A 2YECA 3R4PA 3D36A 4HYMA 3OMUA 2JJCA 5FWKA 3H80A 3Q5JA 1YC1A 4E02A 3U2DA 2FTKA 2Q8FA 4AWPA 2PNRA 2WI1A 4R3AA 3ZM7A 3EHFA 3D0BA 2WEPA 2CH4A 2WI5A 3O0IA 2YI7A 2XHRA 1UY7A 4MB9A 4Q20A 2WI7A 4WUCA 4LWGA 2O1VA 2XDKA 1YC3A 4MPNA 2Q8IA 5M4MA 5M4NA 3B26A 2YGFA 2IWSA 3EHHA 3INXA 3U67A 2XDUA 3CYGA 1YS3A 4MPCA 1I59A 1YC4A 5F3KA 1NHIA 4XKAA 2BRCA 4L8ZA 2YE6A 3O2FA 2GQPA 3R92A 4CWNA 3HEKA 1S14A 4H7QA 3VHCA 5CTUA 2IORA 1TILA 2XABA 3HYZA 4HYPA 1QY8A 5C93A 1BKNA 2YEAA 3KE6A 2Q8GA 2CCTA 4XCJA 1UY6A 2FYPA 4BQJA 3Q5KA 2BYHA 4CWPA 4P7AA 3GIGB 1GKZA 1YETA 1Y8NA 2C1IA 1L0OA 3VHAA 3RLRA 4URLA 4ASAA 3G75A 2BYIA 4U7OA 5CTWA 2E0AA 2CGFA 4YKYA 3JZ3A 5GGZA 1NHJA 3OPDA 3TZ5A 3SL2A 4PRVA 5F5RA 4AS9A 2XX4A 2YE8A 1H7UA 5J71A 4DZYA 3R4NA 3TUHA 4LWHA 3ZXQA 1I5BA 5D7RA 4O0BA 2HKJA 1PVGA 4HZ5A 1IXMA 1BGQA 4E00A 2YJWA 4CWFA 3CWVA 4I3HA 2YGEA 5M4HA 1I5DA 3GIFA
chains in the Genus database with same CATH topology
3EKOA 4EGKA 4L94A 1GJVA 2YK9A 4JQLA 4R1FA 4XIQA 2XK2A 1ZXMA 4B7PA 4LP0A 3OWBA 2YEEA 4L90A 1QYEA 3QDDA 1AJ6A 5CTYA 4U7NA 5M4PA 2YKJA 4AWOA 4KP4A 4XD8A 4FPPA 4YKTA 4X9LA 2YEGA 2CCUA 2ZKJA 3A0RA 1I5CA 2FXSA 1ZWHA 2ZBKB 1BXDA 3T10A 2BU6A 4FCRA 1UYDA 2WI4A 2WI6A 4FCPA 1ZW9A 1MU5A 4XIRA 3TTZA 3ZKBA 4JASA 4HXZA 5FNCA 4MPEA 3K98A 3B24A 4V25A 1YERA 3OWDA 1Z5BA 4FCQA 5BODA 2YJXA 4YKXA 3IEDA 4HZ0A 2H55A 4EGIA 4ZVIA 4GEEA 1Y4UA 3CRLA 4L93A 1Z5AA 1NHHA 4H85A 4MP2A 4DUHA 4GGLA 4UROA 2VCJA 1I58A 4CE1A 2QF6A 3HZ1A 3TZ2A 3U2KA 5D7DA 2O1WA 3O6OA 5FNFA 5J6AA 2XDSA 4HY1A 3MNRP 3FV5A 2HG1A 4E01A 3TZ4A 4EGHA 4BIUA 4URMA 2XDXA 3CGZA 4H81A 4K4OA 1Z5CA 4ZKIA 2IOQA 3HHUA 4JAUA 2Q2EB 1EA6A 1THNA 4LWIA 3A0WA 4CE3A 2FWYA 2BTZA 4V26A 1ZXNA 5IN9A 3T0HA 4PRXA 2BU5A 1QZRA 3A0ZA 4NH7A 2H8MA 4LWFA 4EFTA 5IDMA 2VCIA 4CWTA 4JAVA 2YE3A 1KZNA 3D2RA 4LPBA 1TC0A 3Q5LA 4I5SA 3A0TA 2XJGA 1EI1A 4CE2A 2CCSA 3WHAA 2EXLA 2ESAA 2ZDXA 4XITA 2O1UA 1H7SA 2QG0A 1R62A 4BAEA 2YEJA 4WUDA 2XCMA 1B62A 1AM1A 2YE5A 4YKUA 2XD6A 3R4MA 2WERA 3CRKA 1TBWA 5FNDA 1TIDA 1B63A 2BU8A 4P8OA 2VW5A 2YE4A 3C11A 3RLPA 4ASBA 2WI2A 2BSMA 5IDJA 3HZ5A 4U93A 1UYLA 4GCZA 1UYHA 2IWUA 1UYMA 3A0XA 3FT5A 2IWXA 3RKZA 5BOCA 4YKZA 2YKIA 4XE2A 4QPJA 2QG2A 1UYEA 1AH6A 4KSGA 4KQVA 4URNA 1U2OA 2YEBA 1U0ZA 2XJJA 3FT8A 2GFDA 3C0EA 2ZDYA 4KFGA 2IOPA 4XKKA 3ZXOA 4GT8A 3EHJA 1YESA 2AKPA 3TZ0A 4EMVA 3NMQA 4YKRA 1S16A 4GFNA 3EHGA 3PEHA 2YI5A 4O09A 2BREA 4YKWA 1Y8PA 4XTJA 2HCHA 4PU9A 4MOTA 5CF0A 1MX0A 3DGEA 3K60A 3H4LA 4CWOA 4WUBA 1GKXA 2YGAA 3G7BA 4O04A 1I5AA 2BZ5A 1US7A 1ID0A 3LPSA 4O05A 4XIPA 4YKQA 5D6PA 4AWQA 2YK2A 4CWQA 2YKBA 5D7CA 4BQGA 4QPKA 1UYGA 2YE7A 1UYKA 3HYYA 2QFOA 2XHXA 5M4EA 4XC0A 3A0YA 1A4HA 2Q8HA 2YE2A 3B25A 2YKEA 2XX5A 3B27A 4KTNA 4NH8A 1YSRA 1YT2A 4XDMA 2YEDA 1YT1A 1YT0A 1B3QA 4B6CA 1UYCA 5CTXA 1Y4SA 1Y8OA 4W7TA 3K99A 5M4KA 1UY9A 2XHTA 3PEJA 3RLQA 2UWDA 1TH8A 2XJXA 3LNUA 2YEFA 5CPHA 2XX2A 2CG9A 4ASFA 2YEIA 3OW6A 4MBCA 4HY6A 4BXIA 4MP7A 3R4OA 5L3JA 2VWCA 2WEQA 4LWEA 3EKRA 2YI6A 3K97A 4EM7A 1AH8A 1Z59A 1BYQA 4XKOA 4GQTA 1AMWA 1UYFA 2C2AA 1UYIA 4FMTA 4CWRA 4XCLA 4O07A 3VADA 4BIZA 3BMYA 3G7EA 2YI0A 2JKIA 3WQ9A 3GIEA 2YEHA 3QTFA 2BT0A 3INWA 4KSHA 3CGYA 3T2SA 3T0ZA 3T1KA 2WI3A 4EFUA 2BU2A 2K5BA 4EEHA 1TC6A 3ZKDA 4CWSA 4PL9A 3R91A 1KIJA 5D6QA 4NH9A 1YSZA 3VHDA 2YKCA 1JM6A 2YE9A 4R3MA 2FWZA 2XDLA 4L91A 4HXWA 2BU7A 1UY8A 3BM9A 4ASGA 1OSFA 3GIGA 3B28A 2YECA 3R4PA 3D36A 4HYMA 3OMUA 2JJCA 5FWKA 3H80A 3Q5JA 1YC1A 4E02A 3U2DA 2Q8FA 4AWPA 2PNRA 2WI1A 4R3AA 3ZM7A 3EHFA 3D0BA 2WEPA 2CH4A 2WI5A 3O0IA 2YI7A 2XHRA 1UY7A 4MB9A 4Q20A 2WI7A 4WUCA 4LWGA 2O1VA 2XDKA 1YC3A 4MPNA 2Q8IA 5M4MA 5M4NA 3B26A 2YGFA 2IWSA 3EHHA 3INXA 3U67A 2XDUA 1YS3A 4MPCA 1I59A 1YC4A 5F3KA 1NHIA 4XKAA 2BRCA 4L8ZA 2YE6A 3O2FA 2GQPA 3R92A 4CWNA 3HEKA 1S14A 4H7QA 3VHCA 5CTUA 2IORA 1TILA 2XABA 3HYZA 4HYPA 1QY8A 5C93A 1BKNA 2YEAA 3KE6A 2Q8GA 2CCTA 4XCJA 1UY6A 2FYPA 4BQJA 3Q5KA 2BYHA 4CWPA 4P7AA 3GIGB 1GKZA 1YETA 1Y8NA 1L0OA 3VHAA 3RLRA 4URLA 4ASAA 3G75A 2BYIA 4U7OA 5CTWA 2E0AA 2CGFA 4YKYA 3JZ3A 5GGZA 1NHJA 3OPDA 3TZ5A 3SL2A 4PRVA 5F5RA 4AS9A 2XX4A 2YE8A 1H7UA 5J71A 4DZYA 3R4NA 3TUHA 4LWHA 3ZXQA 1I5BA 5D7RA 4O0BA 2HKJA 1PVGA 4HZ5A 1BGQA 4E00A 2YJWA 4CWFA 3CWVA 4I3HA 2YGEA 5M4HA 1I5DA 3GIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKO A;  4EGK A;  4L94 A;  1GJV A;  2YK9 A;  4JQL A;  4R1F A;  4XIQ A;  2XK2 A;  1ZXM A;  4B7P A;  4LP0 A;  3OWB A;  2YEE A;  4L90 A;  1QYE A;  3QDD A;  1AJ6 A;  5CTY A;  4U7N A;  5M4P A;  2YKJ A;  4AWO A;  4KP4 A;  4XD8 A;  4FPP A;  4YKT A;  4X9L A;  2YEG A;  2CCU A;  2ZKJ A;  3A0R A;  1I5C A;  2FXS A;  1ZWH A;  2ZBK B;  1BXD A;  3T10 A;  2BU6 A;  4FCR A;  1UYD A;  2WI4 A;  2WI6 A;  4FCP A;  1ZW9 A;  1MU5 A;  4XIR A;  3TTZ A;  3ZKB A;  4JAS A;  4HXZ A;  5FNC A;  4MPE A;  3K98 A;  3B24 A;  4V25 A;  1YER A;  3OWD A;  1Z5B A;  4FCQ A;  5BOD A;  2YJX A;  4YKX A;  3IED A;  4HZ0 A;  2H55 A;  4EGI A;  4ZVI A;  4GEE A;  1Y4U A;  3CRL A;  4L93 A;  1Z5A A;  1NHH A;  4H85 A;  4MP2 A;  4DUH A;  4GGL A;  4URO A;  2VCJ A;  1I58 A;  4CE1 A;  2QF6 A;  3HZ1 A;  3TZ2 A;  3U2K A;  5D7D A;  2O1W A;  3O6O A;  5FNF A;  5J6A A;  2XDS A;  4HY1 A;  3MNR P;  3FV5 A;  2HG1 A;  4E01 A;  3TZ4 A;  4EGH A;  4BIU A;  4URM A;  2XDX A;  3CGZ A;  4H81 A;  4K4O A;  1Z5C A;  4ZKI A;  2IOQ A;  3HHU A;  4JAU A;  2Q2E B;  1EA6 A;  1THN A;  4LWI A;  3A0W A;  4CE3 A;  2FWY A;  2BTZ A;  4V26 A;  1ZXN A;  5IN9 A;  3T0H A;  4PRX A;  2BU5 A;  1QZR A;  3A0Z A;  4NH7 A;  2H8M A;  4LWF A;  4EFT A;  5IDM A;  2VCI A;  4CWT A;  4JAV A;  2YE3 A;  1KZN A;  3D2R A;  4LPB A;  1TC0 A;  3Q5L A;  4I5S A;  3A0T A;  2XJG A;  1EI1 A;  4CE2 A;  2CCS A;  3WHA A;  2EXL A;  2ESA A;  2ZDX A;  4XIT A;  2O1U A;  1H7S A;  2QG0 A;  1R62 A;  4BAE A;  2YEJ A;  4WUD A;  2XCM A;  1B62 A;  1AM1 A;  2YE5 A;  4YKU A;  2XD6 A;  3R4M A;  2WER A;  3CRK A;  1TBW A;  5FND A;  1TID A;  1B63 A;  2BU8 A;  4P8O A;  2VW5 A;  2YE4 A;  3C11 A;  3RLP A;  4ASB A;  2WI2 A;  2BSM A;  5IDJ A;  3HZ5 A;  4U93 A;  1UYL A;  4GCZ A;  1UYH A;  2IWU A;  1UYM A;  3A0X A;  3FT5 A;  2IWX A;  3RKZ A;  5BOC A;  4YKZ A;  2YKI A;  4XE2 A;  4QPJ A;  2QG2 A;  1UYE A;  1AH6 A;  4KSG A;  4KQV A;  4URN A;  1U2O A;  2YEB A;  1U0Z A;  2XJJ A;  3FT8 A;  2GFD A;  3C0E A;  2ZDY A;  4KFG A;  2IOP A;  4XKK A;  3ZXO A;  4GT8 A;  3EHJ A;  1YES A;  2AKP A;  3TZ0 A;  4EMV A;  3NMQ A;  4YKR A;  1S16 A;  4GFN A;  3EHG A;  3PEH A;  2YI5 A;  4O09 A;  2BRE A;  4YKW A;  1Y8P A;  4XTJ A;  2HCH A;  4PU9 A;  4MOT A;  5CF0 A;  1MX0 A;  3DGE A;  3K60 A;  3H4L A;  4CWO A;  4WUB A;  1GKX A;  2YGA A;  3G7B A;  4O04 A;  1I5A A;  2BZ5 A;  1US7 A;  1ID0 A;  3LPS A;  4O05 A;  4XIP A;  4YKQ A;  5D6P A;  4AWQ A;  2YK2 A;  4CWQ A;  2YKB A;  5D7C A;  4BQG A;  4QPK A;  1UYG A;  2YE7 A;  1UYK A;  3HYY A;  2QFO A;  2XHX A;  5M4E A;  4XC0 A;  3A0Y A;  1A4H A;  2Q8H A;  2YE2 A;  3B25 A;  2YKE A;  2XX5 A;  3B27 A;  4KTN A;  4NH8 A;  1YSR A;  1YT2 A;  4XDM A;  2YED A;  1YT1 A;  1YT0 A;  1B3Q A;  4B6C A;  1UYC A;  5CTX A;  1Y4S A;  1Y8O A;  4W7T A;  3K99 A;  5M4K A;  1UY9 A;  2XHT A;  3PEJ A;  3RLQ A;  2UWD A;  1TH8 A;  2XJX A;  3LNU A;  2YEF A;  5CPH A;  2XX2 A;  2CG9 A;  4ASF A;  2YEI A;  3OW6 A;  4MBC A;  4HY6 A;  4BXI A;  4MP7 A;  3R4O A;  5L3J A;  2VWC A;  2WEQ A;  4LWE A;  3EKR A;  2YI6 A;  3K97 A;  4EM7 A;  1AH8 A;  1Z59 A;  1BYQ A;  4XKO A;  4GQT A;  1AMW A;  1UYF A;  2C2A A;  1UYI A;  4FMT A;  4CWR A;  4XCL A;  4O07 A;  3VAD A;  4BIZ A;  3BMY A;  3G7E A;  2YI0 A;  2JKI A;  3WQ9 A;  3GIE A;  2YEH A;  3QTF A;  2BT0 A;  3INW A;  4KSH A;  3CGY A;  3T2S A;  3T0Z A;  3T1K A;  2WI3 A;  4EFU A;  2BU2 A;  2K5B A;  4EEH A;  1TC6 A;  3ZKD A;  4CWS A;  4PL9 A;  3R91 A;  1KIJ A;  5D6Q A;  4NH9 A;  1YSZ A;  3VHD A;  2YKC A;  1JM6 A;  2YE9 A;  4R3M A;  2FWZ A;  2XDL A;  4L91 A;  4HXW A;  2BU7 A;  1UY8 A;  3BM9 A;  4ASG A;  1OSF A;  3GIG A;  3B28 A;  2YEC A;  3R4P A;  3D36 A;  4HYM A;  3OMU A;  2JJC A;  5FWK A;  3H80 A;  3Q5J A;  1YC1 A;  4E02 A;  3U2D A;  2Q8F A;  4AWP A;  2PNR A;  2WI1 A;  4R3A A;  3ZM7 A;  3EHF A;  3D0B A;  2WEP A;  2CH4 A;  2WI5 A;  3O0I A;  2YI7 A;  2XHR A;  1UY7 A;  4MB9 A;  4Q20 A;  2WI7 A;  4WUC A;  4LWG A;  2O1V A;  2XDK A;  1YC3 A;  4MPN A;  2Q8I A;  5M4M A;  5M4N A;  3B26 A;  2YGF A;  2IWS A;  3EHH A;  3INX A;  3U67 A;  2XDU A;  1YS3 A;  4MPC A;  1I59 A;  1YC4 A;  5F3K A;  1NHI A;  4XKA A;  2BRC A;  4L8Z A;  2YE6 A;  3O2F A;  2GQP A;  3R92 A;  4CWN A;  3HEK A;  1S14 A;  4H7Q A;  3VHC A;  5CTU A;  2IOR A;  1TIL A;  2XAB A;  3HYZ A;  4HYP A;  1QY8 A;  5C93 A;  1BKN A;  2YEA A;  3KE6 A;  2Q8G A;  2CCT A;  4XCJ A;  1UY6 A;  2FYP A;  4BQJ A;  3Q5K A;  2BYH A;  4CWP A;  4P7A A;  3GIG B;  1GKZ A;  1YET A;  1Y8N A;  1L0O A;  3VHA A;  3RLR A;  4URL A;  4ASA A;  3G75 A;  2BYI A;  4U7O A;  5CTW A;  2E0A A;  2CGF A;  4YKY A;  3JZ3 A;  5GGZ A;  1NHJ A;  3OPD A;  3TZ5 A;  3SL2 A;  4PRV A;  5F5R A;  4AS9 A;  2XX4 A;  2YE8 A;  1H7U A;  5J71 A;  4DZY A;  3R4N A;  3TUH A;  4LWH A;  3ZXQ A;  1I5B A;  5D7R A;  4O0B A;  2HKJ A;  1PVG A;  4HZ5 A;  1BGQ A;  4E00 A;  2YJW A;  4CWF A;  3CWV A;  4I3H A;  2YGE A;  5M4H A;  1I5D A;  3GIF A; 
#chains in the Genus database with same CATH topology
 3EKO A;  4EGK A;  4L94 A;  1GJV A;  2YK9 A;  4JQL A;  4R1F A;  4XIQ A;  2XK2 A;  1ZXM A;  4B7P A;  4LP0 A;  3OWB A;  2YEE A;  4L90 A;  1QYE A;  3QDD A;  1AJ6 A;  5CTY A;  4U7N A;  5M4P A;  2YKJ A;  4AWO A;  4KP4 A;  4XD8 A;  4FPP A;  4YKT A;  4X9L A;  2YEG A;  2CCU A;  2ZKJ A;  3A0R A;  1I5C A;  2FXS A;  1ZWH A;  2ZBK B;  1BXD A;  3T10 A;  2BU6 A;  4FCR A;  1UYD A;  2WI4 A;  2WI6 A;  4FCP A;  1ZW9 A;  1MU5 A;  4XIR A;  3TTZ A;  3ZKB A;  4JAS A;  4HXZ A;  5FNC A;  4MPE A;  3K98 A;  3B24 A;  4V25 A;  1YER A;  3OWD A;  4E72 A;  1Z5B A;  4FCQ A;  5BOD A;  2YJX A;  4YKX A;  3IED A;  4HZ0 A;  2H55 A;  4EGI A;  4ZVI A;  4GEE A;  1Y4U A;  3CRL A;  4L93 A;  1Z5A A;  1NHH A;  4H85 A;  4MP2 A;  4DUH A;  4GGL A;  4URO A;  2VCJ A;  1I58 A;  4CE1 A;  2QF6 A;  3HZ1 A;  3TZ2 A;  3U2K A;  5D7D A;  2O1W A;  3O6O A;  5FNF A;  5J6A A;  2XDS A;  4HY1 A;  3MNR P;  3FV5 A;  2HG1 A;  4E01 A;  3TZ4 A;  4EGH A;  4BIU A;  4URM A;  5JEN A;  2XDX A;  3CGZ A;  4H81 A;  4K4O A;  1Z5C A;  4ZKI A;  2IOQ A;  3HHU A;  4JAU A;  2Q2E B;  1EA6 A;  1THN A;  4LWI A;  3A0W A;  4CE3 A;  2FWY A;  2BTZ A;  4V26 A;  1ZXN A;  5IN9 A;  3T0H A;  4PRX A;  2BU5 A;  1QZR A;  3A0Z A;  4NH7 A;  2H8M A;  4LWF A;  4EFT A;  5IDM A;  2VCI A;  4CWT A;  4JAV A;  2YE3 A;  1KZN A;  3D2R A;  4LPB A;  1TC0 A;  3Q5L A;  4I5S A;  3A0T A;  2XJG A;  1EI1 A;  4CE2 A;  2CCS A;  3WHA A;  2EXL A;  2ESA A;  2ZDX A;  4XIT A;  2O1U A;  1H7S A;  2QG0 A;  3LMM A;  1R62 A;  4BAE A;  2YEJ A;  4WUD A;  2XCM A;  1B62 A;  1AM1 A;  2YE5 A;  4YKU A;  2XD6 A;  3R4M A;  2WER A;  3CRK A;  1TBW A;  5FND A;  1TID A;  1B63 A;  2BU8 A;  4P8O A;  2VW5 A;  2YE4 A;  3C11 A;  3RLP A;  4ASB A;  2WI2 A;  2BSM A;  5IDJ A;  3HZ5 A;  4U93 A;  1UYL A;  4GCZ A;  1UYH A;  2IWU A;  1UYM A;  3A0X A;  3FT5 A;  2IWX A;  3RKZ A;  5BOC A;  4YKZ A;  2YKI A;  4XE2 A;  4QPJ A;  2QG2 A;  1UYE A;  1AH6 A;  4KSG A;  4KQV A;  4URN A;  1U2O A;  2YEB A;  1U0Z A;  2XJJ A;  3FT8 A;  2GFD A;  3C0E A;  2ZDY A;  4KFG A;  2IOP A;  4XKK A;  3ZXO A;  4GT8 A;  3EHJ A;  1YES A;  2AKP A;  3TZ0 A;  4EMV A;  3NMQ A;  4YKR A;  1S16 A;  4GFN A;  3EHG A;  3PEH A;  2YI5 A;  4O09 A;  2BRE A;  4YKW A;  1Y8P A;  4XTJ A;  2HCH A;  4PU9 A;  4MOT A;  5CF0 A;  1MX0 A;  3DGE A;  3K60 A;  3H4L A;  4CWO A;  4WUB A;  1GKX A;  2YGA A;  3G7B A;  4O04 A;  1I5A A;  2BZ5 A;  1US7 A;  1ID0 A;  3LPS A;  2HHI A;  4O05 A;  4XIP A;  4YKQ A;  5D6P A;  4AWQ A;  2YK2 A;  4CWQ A;  2YKB A;  5D7C A;  4BQG A;  4QPK A;  1UYG A;  2YE7 A;  1UYK A;  3HYY A;  2QFO A;  2XHX A;  5M4E A;  4XC0 A;  3A0Y A;  1A4H A;  2Q8H A;  2YE2 A;  3B25 A;  2YKE A;  2XX5 A;  3B27 A;  4KTN A;  4NH8 A;  1YSR A;  1YT2 A;  4XDM A;  2YED A;  1YT1 A;  1YT0 A;  1B3Q A;  4B6C A;  1UYC A;  5CTX A;  1Y4S A;  1Y8O A;  4W7T A;  3K99 A;  5M4K A;  1UY9 A;  2XHT A;  3PEJ A;  3RLQ A;  2C1G A;  2UWD A;  1TH8 A;  2XJX A;  3LNU A;  2YEF A;  5CPH A;  2XX2 A;  2CG9 A;  1F51 A;  4ASF A;  2YEI A;  3S5T A;  3OW6 A;  4MBC A;  4HY6 A;  4BXI A;  4MP7 A;  3R4O A;  5L3J A;  2VWC A;  2WEQ A;  4LWE A;  3EKR A;  2YI6 A;  3K97 A;  4EM7 A;  1AH8 A;  1Z59 A;  1BYQ A;  4XKO A;  4GQT A;  1AMW A;  1UYF A;  2C2A A;  1UYI A;  4FMT A;  4CWR A;  4XCL A;  4O07 A;  3VAD A;  4BIZ A;  3BMY A;  3G7E A;  2YI0 A;  2JKI A;  3WQ9 A;  3GIE A;  2YEH A;  3QTF A;  2BT0 A;  3INW A;  4KSH A;  3CGY A;  3T2S A;  3T0Z A;  3T1K A;  2WI3 A;  4EFU A;  2BU2 A;  2K5B A;  4EEH A;  1TC6 A;  3ZKD A;  4CWS A;  4PL9 A;  3R91 A;  1KIJ A;  5D6Q A;  4NH9 A;  1YSZ A;  3VHD A;  2YKC A;  1JM6 A;  2YE9 A;  4R3M A;  2FWZ A;  2XDL A;  4L91 A;  4HXW A;  2BU7 A;  1UY8 A;  3BM9 A;  4ASG A;  1OSF A;  3GIG A;  3B28 A;  2YEC A;  3R4P A;  3D36 A;  4HYM A;  3OMU A;  2JJC A;  5FWK A;  3H80 A;  3Q5J A;  1YC1 A;  4E02 A;  3U2D A;  2FTK A;  2Q8F A;  4AWP A;  2PNR A;  2WI1 A;  4R3A A;  3ZM7 A;  3EHF A;  3D0B A;  2WEP A;  2CH4 A;  2WI5 A;  3O0I A;  2YI7 A;  2XHR A;  1UY7 A;  4MB9 A;  4Q20 A;  2WI7 A;  4WUC A;  4LWG A;  2O1V A;  2XDK A;  1YC3 A;  4MPN A;  2Q8I A;  5M4M A;  5M4N A;  3B26 A;  2YGF A;  2IWS A;  3EHH A;  3INX A;  3U67 A;  2XDU A;  3CYG A;  1YS3 A;  4MPC A;  1I59 A;  1YC4 A;  5F3K A;  1NHI A;  4XKA A;  2BRC A;  4L8Z A;  2YE6 A;  3O2F A;  2GQP A;  3R92 A;  4CWN A;  3HEK A;  1S14 A;  4H7Q A;  3VHC A;  5CTU A;  2IOR A;  1TIL A;  2XAB A;  3HYZ A;  4HYP A;  1QY8 A;  5C93 A;  1BKN A;  2YEA A;  3KE6 A;  2Q8G A;  2CCT A;  4XCJ A;  1UY6 A;  2FYP A;  4BQJ A;  3Q5K A;  2BYH A;  4CWP A;  4P7A A;  3GIG B;  1GKZ A;  1YET A;  1Y8N A;  2C1I A;  1L0O A;  3VHA A;  3RLR A;  4URL A;  4ASA A;  3G75 A;  2BYI A;  4U7O A;  5CTW A;  2E0A A;  2CGF A;  4YKY A;  3JZ3 A;  5GGZ A;  1NHJ A;  3OPD A;  3TZ5 A;  3SL2 A;  4PRV A;  5F5R A;  4AS9 A;  2XX4 A;  2YE8 A;  1H7U A;  5J71 A;  4DZY A;  3R4N A;  3TUH A;  4LWH A;  3ZXQ A;  1I5B A;  5D7R A;  4O0B A;  2HKJ A;  1PVG A;  4HZ5 A;  1IXM A;  1BGQ A;  4E00 A;  2YJW A;  4CWF A;  3CWV A;  4I3H A;  2YGE A;  5M4H A;  1I5D A;  3GIF A; 
#chains in the Genus database with same CATH homology
 3EKO A;  4EGK A;  4L94 A;  1GJV A;  2YK9 A;  4JQL A;  4R1F A;  4XIQ A;  2XK2 A;  1ZXM A;  4B7P A;  4LP0 A;  3OWB A;  2YEE A;  4L90 A;  1QYE A;  3QDD A;  1AJ6 A;  5CTY A;  4U7N A;  5M4P A;  2YKJ A;  4AWO A;  4KP4 A;  4XD8 A;  4FPP A;  4YKT A;  4X9L A;  2YEG A;  2CCU A;  2ZKJ A;  3A0R A;  1I5C A;  2FXS A;  1ZWH A;  2ZBK B;  1BXD A;  3T10 A;  2BU6 A;  4FCR A;  1UYD A;  2WI4 A;  2WI6 A;  4FCP A;  1ZW9 A;  1MU5 A;  4XIR A;  3TTZ A;  3ZKB A;  4JAS A;  4HXZ A;  5FNC A;  4MPE A;  3K98 A;  3B24 A;  4V25 A;  1YER A;  3OWD A;  1Z5B A;  4FCQ A;  5BOD A;  2YJX A;  4YKX A;  3IED A;  4HZ0 A;  2H55 A;  4EGI A;  4ZVI A;  4GEE A;  1Y4U A;  3CRL A;  4L93 A;  1Z5A A;  1NHH A;  4H85 A;  4MP2 A;  4DUH A;  4GGL A;  4URO A;  2VCJ A;  1I58 A;  4CE1 A;  2QF6 A;  3HZ1 A;  3TZ2 A;  3U2K A;  5D7D A;  2O1W A;  3O6O A;  5FNF A;  5J6A A;  2XDS A;  4HY1 A;  3MNR P;  3FV5 A;  2HG1 A;  4E01 A;  3TZ4 A;  4EGH A;  4BIU A;  4URM A;  2XDX A;  3CGZ A;  4H81 A;  4K4O A;  1Z5C A;  4ZKI A;  2IOQ A;  3HHU A;  4JAU A;  2Q2E B;  1EA6 A;  1THN A;  4LWI A;  3A0W A;  4CE3 A;  2FWY A;  2BTZ A;  4V26 A;  1ZXN A;  5IN9 A;  3T0H A;  4PRX A;  2BU5 A;  1QZR A;  3A0Z A;  4NH7 A;  2H8M A;  4LWF A;  4EFT A;  5IDM A;  2VCI A;  4CWT A;  4JAV A;  2YE3 A;  1KZN A;  3D2R A;  4LPB A;  1TC0 A;  3Q5L A;  4I5S A;  3A0T A;  2XJG A;  1EI1 A;  4CE2 A;  2CCS A;  3WHA A;  2EXL A;  2ESA A;  2ZDX A;  4XIT A;  2O1U A;  1H7S A;  2QG0 A;  1R62 A;  4BAE A;  2YEJ A;  4WUD A;  2XCM A;  1B62 A;  1AM1 A;  2YE5 A;  4YKU A;  2XD6 A;  3R4M A;  2WER A;  3CRK A;  1TBW A;  5FND A;  1TID A;  1B63 A;  2BU8 A;  4P8O A;  2VW5 A;  2YE4 A;  3C11 A;  3RLP A;  4ASB A;  2WI2 A;  2BSM A;  5IDJ A;  3HZ5 A;  4U93 A;  1UYL A;  4GCZ A;  1UYH A;  2IWU A;  1UYM A;  3A0X A;  3FT5 A;  2IWX A;  3RKZ A;  5BOC A;  4YKZ A;  2YKI A;  4XE2 A;  4QPJ A;  2QG2 A;  1UYE A;  1AH6 A;  4KSG A;  4KQV A;  4URN A;  1U2O A;  2YEB A;  1U0Z A;  2XJJ A;  3FT8 A;  2GFD A;  3C0E A;  2ZDY A;  4KFG A;  2IOP A;  4XKK A;  3ZXO A;  4GT8 A;  3EHJ A;  1YES A;  2AKP A;  3TZ0 A;  4EMV A;  3NMQ A;  4YKR A;  1S16 A;  4GFN A;  3EHG A;  3PEH A;  2YI5 A;  4O09 A;  2BRE A;  4YKW A;  1Y8P A;  4XTJ A;  2HCH A;  4PU9 A;  4MOT A;  5CF0 A;  1MX0 A;  3DGE A;  3K60 A;  3H4L A;  4CWO A;  4WUB A;  1GKX A;  2YGA A;  3G7B A;  4O04 A;  1I5A A;  2BZ5 A;  1US7 A;  1ID0 A;  3LPS A;  4O05 A;  4XIP A;  4YKQ A;  5D6P A;  4AWQ A;  2YK2 A;  4CWQ A;  2YKB A;  5D7C A;  4BQG A;  4QPK A;  1UYG A;  2YE7 A;  1UYK A;  3HYY A;  2QFO A;  2XHX A;  5M4E A;  4XC0 A;  3A0Y A;  1A4H A;  2Q8H A;  2YE2 A;  3B25 A;  2YKE A;  2XX5 A;  3B27 A;  4KTN A;  4NH8 A;  1YSR A;  1YT2 A;  4XDM A;  2YED A;  1YT1 A;  1YT0 A;  1B3Q A;  4B6C A;  1UYC A;  5CTX A;  1Y4S A;  1Y8O A;  4W7T A;  3K99 A;  5M4K A;  1UY9 A;  2XHT A;  3PEJ A;  3RLQ A;  2UWD A;  1TH8 A;  2XJX A;  3LNU A;  2YEF A;  5CPH A;  2XX2 A;  2CG9 A;  4ASF A;  2YEI A;  3OW6 A;  4MBC A;  4HY6 A;  4BXI A;  4MP7 A;  3R4O A;  5L3J A;  2VWC A;  2WEQ A;  4LWE A;  3EKR A;  2YI6 A;  3K97 A;  4EM7 A;  1AH8 A;  1Z59 A;  1BYQ A;  4XKO A;  4GQT A;  1AMW A;  1UYF A;  2C2A A;  1UYI A;  4FMT A;  4CWR A;  4XCL A;  4O07 A;  3VAD A;  4BIZ A;  3BMY A;  3G7E A;  2YI0 A;  2JKI A;  3WQ9 A;  3GIE A;  2YEH A;  3QTF A;  2BT0 A;  3INW A;  4KSH A;  3CGY A;  3T2S A;  3T0Z A;  3T1K A;  2WI3 A;  4EFU A;  2BU2 A;  2K5B A;  4EEH A;  1TC6 A;  3ZKD A;  4CWS A;  4PL9 A;  3R91 A;  1KIJ A;  5D6Q A;  4NH9 A;  1YSZ A;  3VHD A;  2YKC A;  1JM6 A;  2YE9 A;  4R3M A;  2FWZ A;  2XDL A;  4L91 A;  4HXW A;  2BU7 A;  1UY8 A;  3BM9 A;  4ASG A;  1OSF A;  3GIG A;  3B28 A;  2YEC A;  3R4P A;  3D36 A;  4HYM A;  3OMU A;  2JJC A;  5FWK A;  3H80 A;  3Q5J A;  1YC1 A;  4E02 A;  3U2D A;  2Q8F A;  4AWP A;  2PNR A;  2WI1 A;  4R3A A;  3ZM7 A;  3EHF A;  3D0B A;  2WEP A;  2CH4 A;  2WI5 A;  3O0I A;  2YI7 A;  2XHR A;  1UY7 A;  4MB9 A;  4Q20 A;  2WI7 A;  4WUC A;  4LWG A;  2O1V A;  2XDK A;  1YC3 A;  4MPN A;  2Q8I A;  5M4M A;  5M4N A;  3B26 A;  2YGF A;  2IWS A;  3EHH A;  3INX A;  3U67 A;  2XDU A;  1YS3 A;  4MPC A;  1I59 A;  1YC4 A;  5F3K A;  1NHI A;  4XKA A;  2BRC A;  4L8Z A;  2YE6 A;  3O2F A;  2GQP A;  3R92 A;  4CWN A;  3HEK A;  1S14 A;  4H7Q A;  3VHC A;  5CTU A;  2IOR A;  1TIL A;  2XAB A;  3HYZ A;  4HYP A;  1QY8 A;  5C93 A;  1BKN A;  2YEA A;  3KE6 A;  2Q8G A;  2CCT A;  4XCJ A;  1UY6 A;  2FYP A;  4BQJ A;  3Q5K A;  2BYH A;  4CWP A;  4P7A A;  3GIG B;  1GKZ A;  1YET A;  1Y8N A;  1L0O A;  3VHA A;  3RLR A;  4URL A;  4ASA A;  3G75 A;  2BYI A;  4U7O A;  5CTW A;  2E0A A;  2CGF A;  4YKY A;  3JZ3 A;  5GGZ A;  1NHJ A;  3OPD A;  3TZ5 A;  3SL2 A;  4PRV A;  5F5R A;  4AS9 A;  2XX4 A;  2YE8 A;  1H7U A;  5J71 A;  4DZY A;  3R4N A;  3TUH A;  4LWH A;  3ZXQ A;  1I5B A;  5D7R A;  4O0B A;  2HKJ A;  1PVG A;  4HZ5 A;  1BGQ A;  4E00 A;  2YJW A;  4CWF A;  3CWV A;  4I3H A;  2YGE A;  5M4H A;  1I5D A;  3GIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...