4GFNA

Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolopyrimidine inhibitors of DNA gyrase B (GyrB) and topoisomerase IV (ParE). Part I: Structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 57
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gfnA00
3OWDA 1YT1A 4CE2A 4PRVA 1TBWA 5IDJA 4XE2A 2BU5A 4CWQA 4CWSA 3D2RA 3RLPA 1S16A 2YE7A 1TILA 4AWQA 4ZVIA 5D6QA 3CGYA 4CE3A 2BU6A 4YKTA 4E02A 2CCTA 4XD8A 3RKZA 3K98A 2YI7A 4HYPA 4ASAA 4EGHA 3GIFA 2YI5A 4AS9A 5J71A 4EGKA 4L90A 2BSMA 1KZNA 3G7BA 5CPHA 4XDMA 1OSFA 3T10A 4H7QA 2IWSA 2BYIA 2YGFA 2YJXA 2VW5A 3K60A 2IWXA 3O0IA 3QTFA 5FNFA 3A0ZA 3MNRP 1I5AA 2CCSA 4EFTA 1Z59A 3EHHA 4O07A 2Q8GA 2YGEA 4X9LA 3TUHA 4R3AA 4GCZA 2XDUA 1U2OA 3GIGB 1GJVA 3ZKDA 4E00A 3A0XA 2XJJA 1BYQA 1ZW9A 2BRCA 3K99A 4MBCA 3C0EA 2YGAA 4HY1A 5C93A 4O04A 4YKWA 4B7PA 4JASA 4LWHA 2XX5A 3O6OA 3ZM7A 3CRKA 4ASGA 3ZXQA 3CRLA 4QPJA 3WQ9A 3HYYA 4LWIA 2FWYA 2QG0A 4MPNA 2XHTA 2YE2A 4FCRA 4CWNA 2VCJA 4DZYA 4E01A 1UYIA 4I5SA 4NH8A 2CH4A 3K97A 4XIRA 4JQLA 3SL2A 4KFGA 3VHDA 2XDLA 2YK9A 2YKBA 4GFNA 2BU2A 2YEFA 2XK2A 1AMWA 1Z5BA 4BIZA 1ZXMA 4V26A 2YKCA 5BOCA 2IWUA 2YK2A 5M4NA 2XX4A 1UYHA 1Z5AA 4W7TA 2BT0A 4URLA 2C2AA 4EFUA 4K4OA 1GKZA 2YEAA 2IOQA 3R4MA 1GKXA 3H4LA 3TZ2A 1U0ZA 2YKIA 1BKNA 3A0TA 3FT8A 2Q2EB 5FWKA 4XKKA 4MOTA 4GT8A 4AWPA 3GIEA 4CE1A 4KQVA 5FNCA 1I59A 4EMVA 4WUBA 4UROA 2BU7A 4LWGA 4BQGA 4BIUA 1UYKA 4L93A 2YI0A 2YE4A 1L0OA 4LP0A 3HYZA 4LWEA 5CTXA 4PL9A 5FNDA 4XITA 1I58A 4P7AA 5F3KA 3OW6A 3A0WA 2IOPA 2H55A 3BMYA 2BZ5A 5D6PA 3HZ5A 2WEQA 1US7A 1QYEA 1YC3A 2K5BA 1YSZA 4R3MA 2HCHA 3B26A 1Y4UA 3LPSA 2ZKJA 4L94A 4GQTA 4MPEA 3R91A 3T1KA 4XCJA 2WI1A 4HXZA 1H7SA 4JAUA 2WEPA 3CGZA 5D7RA 4BQJA 4MP2A 2XDXA 2IORA 4ASBA 4BAEA 4XTJA 1UYDA 2E0AA 2WI2A 3PEHA 5CF0A 1YESA 4MP7A 4FCPA 1UY7A 2YEGA 1BXDA 5M4MA 3B25A 5M4EA 1UYLA 1YC4A 1B63A 2YEEA 4CWRA 1TC6A 3T2SA 2ZDYA 4EM7A 4LWFA 4ZKIA 1AH8A 4V25A 4PU9A 2QF6A 4U7NA 1AM1A 5M4HA 4BXIA 2ZBKB 2Q8IA 1ZXNA 2BU8A 4HXWA 4XIPA 2FYPA 4MB9A 2XD6A 3KE6A 4CWOA 2WI3A 4XCLA 3R92A 4AWOA 2YKEA 3U67A 4HYMA 5CTYA 3B24A 4ASFA 3HEKA 4I3HA 3RLRA 1QZRA 2WI6A 3HZ1A 2ZDXA 1B3QA 1TC0A 2XABA 3EKOA 3PEJA 1A4HA 3TTZA 4L8ZA 1KIJA 2HG1A 3INWA 3B28A 1ZWHA 2WI5A 2XX2A 2CCUA 3TZ4A 1I5BA 3JZ3A 4LPBA 2GFDA 2Q8FA 4JAVA 2JJCA 4KTNA 4HY6A 4QPKA 5IDMA 2WI4A 4EGIA 2YE8A 2YKJA 1Y4SA 2QFOA 2UWDA 1YC1A 5D7CA 3OPDA 4YKRA 3FT5A 4XC0A 5CTWA 4YKYA 4KP4A 5J6AA 3TZ5A 2EXLA 1H7UA 3TZ0A 3EKRA 2YEJA 4H81A 3D36A 1S14A 3OMUA 4CWPA 1I5DA 3A0YA 5BODA 4XKAA 3EHJA 4HZ5A 2WI7A 4WUDA 4HZ0A 1NHHA 1YERA 3OWBA 2FWZA 4XKOA 4CWTA 4O0BA 4YKQA 2XHXA 3RLQA 2YE3A 2XDSA 4O09A 2AKPA 3ZKBA 4NH7A 3DGEA 1EA6A 4KSGA 4FCQA 2YI6A 1UY9A 4GEEA 4R1FA 4L91A 3LNUA 1THNA 2YECA 2H8MA 3G75A 3R4OA 3D0BA 1PVGA 3EHGA 1YT0A 4CWFA 3U2KA 1MX0A 1UYMA 3C11A 5D7DA 1Y8NA 3G7EA 2YE9A 3INXA 2QG2A 3VHAA 2XJXA 2YJWA 2XDKA 4EEHA 2FXSA 4O05A 4PRXA 1B62A 1QY8A 2WERA 3IEDA 3EHFA 1YETA 2O1WA 3T0ZA 4Q20A 3BM9A 3HHUA 1AJ6A 1EI1A 2CGFA 3GIGA 5M4PA 5L3JA 2XHRA 3H80A 4B6CA 3Q5JA 2Q8HA 5F5RA 1NHJA 2VCIA 1UYEA 4YKZA 2YE5A 2ESAA 2BYHA 3FV5A 3Q5KA 3Q5LA 4YKXA 4GGLA 4NH9A 3NMQA 2XJGA 4H85A 4URNA 1NHIA 1Y8OA 4MPCA 5CTUA 2YEIA 1BGQA 2PNRA 3CWVA 2GQPA 2XCMA 2O1VA 4U7OA 3R4NA 1TIDA 4KSHA 2O1UA 4DUHA 1UYGA 3R4PA 4FMTA 5IN9A 1YSRA 1ID0A 1R62A 4URMA 2YEDA 5GGZA 1Y8PA 4FPPA 3QDDA 2CG9A 1UY6A 3VADA 3U2DA 4P8OA 4U93A 2YE6A 1TH8A 3T0HA 1YT2A 1MU5A 2HKJA 3O2FA 1UYFA 3B27A 2BTZA 1UY8A 1UYCA 2YEBA 3WHAA 1JM6A 4YKUA 5M4KA 3VHCA 1Z5CA 4WUCA 1I5CA 3ZXOA 2YEHA 2BREA 4XIQA 2VWCA 1YS3A 2JKIA 3A0RA 1AH6A
chains in the Genus database with same CATH superfamily
3OWDA 1YT1A 4CE2A 4PRVA 1TBWA 5IDJA 4XE2A 2BU5A 4CWQA 4CWSA 3D2RA 2C1GA 3RLPA 1S16A 2YE7A 1TILA 4AWQA 4ZVIA 5D6QA 3CGYA 4CE3A 2BU6A 4YKTA 4E02A 2CCTA 4XD8A 3RKZA 3K98A 2YI7A 4HYPA 4ASAA 4EGHA 3GIFA 2YI5A 4AS9A 5J71A 4EGKA 4L90A 2BSMA 1KZNA 3G7BA 5CPHA 4XDMA 1OSFA 3T10A 4H7QA 2IWSA 2BYIA 2YGFA 2YJXA 2VW5A 3K60A 2IWXA 3O0IA 3QTFA 5FNFA 3A0ZA 3MNRP 1I5AA 2CCSA 4EFTA 1Z59A 3EHHA 4O07A 2Q8GA 2YGEA 4X9LA 3TUHA 4R3AA 4GCZA 2XDUA 5JENA 1U2OA 3GIGB 1GJVA 3ZKDA 4E00A 3A0XA 2XJJA 1BYQA 1ZW9A 2BRCA 3K99A 4MBCA 3C0EA 2YGAA 4HY1A 5C93A 4O04A 4YKWA 4B7PA 4JASA 4LWHA 2XX5A 3O6OA 3ZM7A 3CRKA 4ASGA 3ZXQA 3CRLA 4QPJA 3WQ9A 3HYYA 4LWIA 2FWYA 2QG0A 4MPNA 2XHTA 2YE2A 4FCRA 4CWNA 2VCJA 4DZYA 4E01A 1UYIA 4I5SA 4NH8A 2CH4A 3K97A 4XIRA 4JQLA 3SL2A 4KFGA 3LMMA 3VHDA 2XDLA 2YK9A 2YKBA 4GFNA 2BU2A 2YEFA 2XK2A 1AMWA 1Z5BA 4BIZA 1ZXMA 4V26A 2YKCA 5BOCA 2IWUA 2YK2A 5M4NA 2XX4A 1UYHA 1Z5AA 4W7TA 2BT0A 4URLA 2C2AA 4EFUA 4K4OA 1GKZA 2YEAA 2IOQA 3R4MA 1GKXA 3H4LA 3TZ2A 1U0ZA 2YKIA 1BKNA 3A0TA 3FT8A 2Q2EB 5FWKA 4XKKA 4MOTA 4GT8A 4AWPA 3GIEA 4CE1A 4KQVA 5FNCA 1I59A 4EMVA 4WUBA 4UROA 2BU7A 4LWGA 4BQGA 4BIUA 1UYKA 4L93A 2YI0A 2YE4A 1L0OA 4LP0A 3HYZA 4LWEA 5CTXA 4PL9A 5FNDA 4XITA 1I58A 4P7AA 5F3KA 2FTKA 3OW6A 3A0WA 2IOPA 2H55A 3BMYA 2BZ5A 5D6PA 3HZ5A 2WEQA 1US7A 1QYEA 1YC3A 2K5BA 1YSZA 4R3MA 2HCHA 3B26A 1Y4UA 3LPSA 2ZKJA 4L94A 4GQTA 4MPEA 3R91A 3T1KA 4XCJA 2WI1A 4HXZA 1H7SA 4JAUA 2WEPA 3CGZA 5D7RA 4BQJA 4MP2A 2XDXA 2IORA 4ASBA 4BAEA 4XTJA 1UYDA 2E0AA 2WI2A 3PEHA 5CF0A 1YESA 4MP7A 4FCPA 1UY7A 2YEGA 1BXDA 5M4MA 3B25A 5M4EA 1UYLA 1YC4A 1B63A 2YEEA 4CWRA 1TC6A 3T2SA 2ZDYA 4EM7A 4LWFA 4ZKIA 1AH8A 4V25A 4PU9A 2QF6A 4U7NA 1AM1A 5M4HA 4BXIA 2ZBKB 2Q8IA 1ZXNA 2BU8A 4HXWA 4XIPA 2FYPA 4MB9A 2XD6A 3KE6A 4CWOA 2WI3A 4XCLA 3R92A 4AWOA 2YKEA 3U67A 3S5TA 2C1IA 4HYMA 5CTYA 3B24A 4ASFA 3HEKA 4I3HA 3RLRA 1QZRA 2WI6A 3HZ1A 2ZDXA 1B3QA 1TC0A 2XABA 3EKOA 3PEJA 1A4HA 3TTZA 4L8ZA 1KIJA 2HG1A 3INWA 3B28A 1ZWHA 2WI5A 2XX2A 2CCUA 3TZ4A 1I5BA 3JZ3A 4LPBA 2GFDA 2Q8FA 4JAVA 2JJCA 4KTNA 4HY6A 4QPKA 5IDMA 2WI4A 4EGIA 2YE8A 2YKJA 1Y4SA 2QFOA 2UWDA 1YC1A 5D7CA 3OPDA 4YKRA 3FT5A 4XC0A 5CTWA 4YKYA 4KP4A 5J6AA 3TZ5A 2EXLA 1H7UA 3TZ0A 3EKRA 2YEJA 4H81A 3D36A 1S14A 3OMUA 4CWPA 1I5DA 3A0YA 5BODA 4XKAA 3EHJA 4HZ5A 2WI7A 4WUDA 4HZ0A 1NHHA 3CYGA 1YERA 3OWBA 2FWZA 4XKOA 4CWTA 4O0BA 4YKQA 1F51A 2XHXA 3RLQA 2YE3A 2XDSA 4O09A 2AKPA 3ZKBA 4NH7A 3DGEA 1EA6A 4KSGA 4FCQA 2YI6A 1UY9A 4GEEA 4R1FA 4L91A 3LNUA 1THNA 2YECA 2H8MA 3G75A 3R4OA 3D0BA 1PVGA 3EHGA 1YT0A 4CWFA 3U2KA 1MX0A 1UYMA 3C11A 5D7DA 1Y8NA 3G7EA 2YE9A 3INXA 2QG2A 3VHAA 2XJXA 2YJWA 2XDKA 4EEHA 2FXSA 4O05A 4PRXA 1B62A 1QY8A 2WERA 3IEDA 3EHFA 4E72A 1YETA 2O1WA 3T0ZA 4Q20A 3BM9A 3HHUA 1AJ6A 1EI1A 2CGFA 3GIGA 5M4PA 5L3JA 2XHRA 3H80A 4B6CA 3Q5JA 2Q8HA 5F5RA 1NHJA 2VCIA 1UYEA 4YKZA 2YE5A 2ESAA 2BYHA 3FV5A 3Q5KA 3Q5LA 4YKXA 4GGLA 4NH9A 3NMQA 2XJGA 4H85A 4URNA 1NHIA 1Y8OA 4MPCA 5CTUA 2YEIA 1BGQA 2PNRA 3CWVA 2GQPA 2XCMA 2O1VA 4U7OA 3R4NA 1TIDA 4KSHA 2O1UA 4DUHA 1UYGA 3R4PA 4FMTA 5IN9A 1YSRA 1ID0A 1R62A 4URMA 2YEDA 5GGZA 1Y8PA 4FPPA 3QDDA 2HHIA 2CG9A 1UY6A 3VADA 3U2DA 4P8OA 4U93A 2YE6A 1TH8A 3T0HA 1YT2A 1MU5A 2HKJA 3O2FA 1UYFA 3B27A 2BTZA 1UY8A 1UYCA 2YEBA 3WHAA 1JM6A 4YKUA 5M4KA 3VHCA 1Z5CA 1IXMA 1I5CA 4WUCA 2YEHA 2BREA 3ZXOA 4XIQA 2VWCA 1YS3A 2JKIA 3A0RA 1AH6A
chains in the Genus database with same CATH topology
3OWDA 1YT1A 4CE2A 4PRVA 1TBWA 5IDJA 4XE2A 2BU5A 4CWQA 4CWSA 3D2RA 3RLPA 1S16A 2YE7A 1TILA 4AWQA 4ZVIA 5D6QA 3CGYA 4CE3A 2BU6A 4YKTA 4E02A 2CCTA 4XD8A 3RKZA 3K98A 2YI7A 4HYPA 4ASAA 4EGHA 3GIFA 2YI5A 4AS9A 5J71A 4EGKA 4L90A 2BSMA 1KZNA 3G7BA 5CPHA 4XDMA 1OSFA 3T10A 4H7QA 2IWSA 2BYIA 2YGFA 2YJXA 2VW5A 3K60A 2IWXA 3O0IA 3QTFA 5FNFA 3A0ZA 3MNRP 1I5AA 2CCSA 4EFTA 1Z59A 3EHHA 4O07A 2Q8GA 2YGEA 4X9LA 3TUHA 4R3AA 4GCZA 2XDUA 1U2OA 3GIGB 1GJVA 3ZKDA 4E00A 3A0XA 2XJJA 1BYQA 1ZW9A 2BRCA 3K99A 4MBCA 3C0EA 2YGAA 4HY1A 5C93A 4O04A 4YKWA 4B7PA 4JASA 4LWHA 2XX5A 3O6OA 3ZM7A 3CRKA 4ASGA 3ZXQA 3CRLA 4QPJA 3WQ9A 3HYYA 4LWIA 2FWYA 2QG0A 4MPNA 2XHTA 2YE2A 4FCRA 4CWNA 2VCJA 4DZYA 4E01A 1UYIA 4I5SA 4NH8A 2CH4A 3K97A 4XIRA 4JQLA 3SL2A 4KFGA 3VHDA 2XDLA 2YK9A 2YKBA 4GFNA 2BU2A 2YEFA 2XK2A 1AMWA 1Z5BA 4BIZA 1ZXMA 4V26A 2YKCA 5BOCA 2IWUA 2YK2A 5M4NA 2XX4A 1UYHA 1Z5AA 4W7TA 2BT0A 4URLA 2C2AA 4EFUA 4K4OA 1GKZA 2YEAA 2IOQA 3R4MA 1GKXA 3H4LA 3TZ2A 1U0ZA 2YKIA 1BKNA 3A0TA 3FT8A 2Q2EB 5FWKA 4XKKA 4MOTA 4GT8A 4AWPA 3GIEA 4CE1A 4KQVA 5FNCA 1I59A 4EMVA 4WUBA 4UROA 2BU7A 4LWGA 4BQGA 4BIUA 1UYKA 4L93A 2YI0A 2YE4A 1L0OA 4LP0A 3HYZA 4LWEA 5CTXA 4PL9A 5FNDA 4XITA 1I58A 4P7AA 5F3KA 3OW6A 3A0WA 2IOPA 2H55A 3BMYA 2BZ5A 5D6PA 3HZ5A 2WEQA 1US7A 1QYEA 1YC3A 2K5BA 1YSZA 4R3MA 2HCHA 3B26A 1Y4UA 3LPSA 2ZKJA 4L94A 4GQTA 4MPEA 3R91A 3T1KA 4XCJA 2WI1A 4HXZA 1H7SA 4JAUA 2WEPA 3CGZA 5D7RA 4BQJA 4MP2A 2XDXA 2IORA 4ASBA 4BAEA 4XTJA 1UYDA 2E0AA 2WI2A 3PEHA 5CF0A 1YESA 4MP7A 4FCPA 1UY7A 2YEGA 1BXDA 5M4MA 3B25A 5M4EA 1UYLA 1YC4A 1B63A 2YEEA 4CWRA 1TC6A 3T2SA 2ZDYA 4EM7A 4LWFA 4ZKIA 1AH8A 4V25A 4PU9A 2QF6A 4U7NA 1AM1A 5M4HA 4BXIA 2ZBKB 2Q8IA 1ZXNA 2BU8A 4HXWA 4XIPA 2FYPA 4MB9A 2XD6A 3KE6A 4CWOA 2WI3A 4XCLA 3R92A 4AWOA 2YKEA 3U67A 4HYMA 5CTYA 3B24A 4ASFA 3HEKA 4I3HA 3RLRA 1QZRA 2WI6A 3HZ1A 2ZDXA 1B3QA 1TC0A 2XABA 3EKOA 3PEJA 1A4HA 3TTZA 4L8ZA 1KIJA 2HG1A 3INWA 3B28A 1ZWHA 2WI5A 2XX2A 2CCUA 3TZ4A 1I5BA 3JZ3A 4LPBA 2GFDA 2Q8FA 4JAVA 2JJCA 4KTNA 4HY6A 4QPKA 5IDMA 2WI4A 4EGIA 2YE8A 2YKJA 1Y4SA 2QFOA 2UWDA 1YC1A 5D7CA 3OPDA 4YKRA 3FT5A 4XC0A 5CTWA 4YKYA 4KP4A 5J6AA 3TZ5A 2EXLA 1H7UA 3TZ0A 3EKRA 2YEJA 4H81A 3D36A 1S14A 3OMUA 4CWPA 1I5DA 3A0YA 5BODA 4XKAA 3EHJA 4HZ5A 2WI7A 4WUDA 4HZ0A 1NHHA 1YERA 3OWBA 2FWZA 4XKOA 4CWTA 4O0BA 4YKQA 2XHXA 3RLQA 2YE3A 2XDSA 4O09A 2AKPA 3ZKBA 4NH7A 3DGEA 1EA6A 4KSGA 4FCQA 2YI6A 1UY9A 4GEEA 4R1FA 4L91A 3LNUA 1THNA 2YECA 2H8MA 3G75A 3R4OA 3D0BA 1PVGA 3EHGA 1YT0A 4CWFA 3U2KA 1MX0A 1UYMA 3C11A 5D7DA 1Y8NA 3G7EA 2YE9A 3INXA 2QG2A 3VHAA 2XJXA 2YJWA 2XDKA 4EEHA 2FXSA 4O05A 4PRXA 1B62A 1QY8A 2WERA 3IEDA 3EHFA 1YETA 2O1WA 3T0ZA 4Q20A 3BM9A 3HHUA 1AJ6A 1EI1A 2CGFA 3GIGA 5M4PA 5L3JA 2XHRA 3H80A 4B6CA 3Q5JA 2Q8HA 5F5RA 1NHJA 2VCIA 1UYEA 4YKZA 2YE5A 2ESAA 2BYHA 3FV5A 3Q5KA 3Q5LA 4YKXA 4GGLA 4NH9A 3NMQA 2XJGA 4H85A 4URNA 1NHIA 1Y8OA 4MPCA 5CTUA 2YEIA 1BGQA 2PNRA 3CWVA 2GQPA 2XCMA 2O1VA 4U7OA 3R4NA 1TIDA 4KSHA 2O1UA 4DUHA 1UYGA 3R4PA 4FMTA 5IN9A 1YSRA 1ID0A 1R62A 4URMA 2YEDA 5GGZA 1Y8PA 4FPPA 3QDDA 2CG9A 1UY6A 3VADA 3U2DA 4P8OA 4U93A 2YE6A 1TH8A 3T0HA 1YT2A 1MU5A 2HKJA 3O2FA 1UYFA 3B27A 2BTZA 1UY8A 1UYCA 2YEBA 3WHAA 1JM6A 4YKUA 5M4KA 3VHCA 1Z5CA 4WUCA 1I5CA 3ZXOA 2YEHA 2BREA 4XIQA 2VWCA 1YS3A 2JKIA 3A0RA 1AH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWD A;  1YT1 A;  4CE2 A;  4PRV A;  1TBW A;  5IDJ A;  4XE2 A;  2BU5 A;  4CWQ A;  4CWS A;  3D2R A;  3RLP A;  1S16 A;  2YE7 A;  1TIL A;  4AWQ A;  4ZVI A;  5D6Q A;  3CGY A;  4CE3 A;  2BU6 A;  4YKT A;  4E02 A;  2CCT A;  4XD8 A;  3RKZ A;  3K98 A;  2YI7 A;  4HYP A;  4ASA A;  4EGH A;  3GIF A;  2YI5 A;  4AS9 A;  5J71 A;  4EGK A;  4L90 A;  2BSM A;  1KZN A;  3G7B A;  5CPH A;  4XDM A;  1OSF A;  3T10 A;  4H7Q A;  2IWS A;  2BYI A;  2YGF A;  2YJX A;  2VW5 A;  3K60 A;  2IWX A;  3O0I A;  3QTF A;  5FNF A;  3A0Z A;  3MNR P;  1I5A A;  2CCS A;  4EFT A;  1Z59 A;  3EHH A;  4O07 A;  2Q8G A;  2YGE A;  4X9L A;  3TUH A;  4R3A A;  4GCZ A;  2XDU A;  1U2O A;  3GIG B;  1GJV A;  3ZKD A;  4E00 A;  3A0X A;  2XJJ A;  1BYQ A;  1ZW9 A;  2BRC A;  3K99 A;  4MBC A;  3C0E A;  2YGA A;  4HY1 A;  5C93 A;  4O04 A;  4YKW A;  4B7P A;  4JAS A;  4LWH A;  2XX5 A;  3O6O A;  3ZM7 A;  3CRK A;  4ASG A;  3ZXQ A;  3CRL A;  4QPJ A;  3WQ9 A;  3HYY A;  4LWI A;  2FWY A;  2QG0 A;  4MPN A;  2XHT A;  2YE2 A;  4FCR A;  4CWN A;  2VCJ A;  4DZY A;  4E01 A;  1UYI A;  4I5S A;  4NH8 A;  2CH4 A;  3K97 A;  4XIR A;  4JQL A;  3SL2 A;  4KFG A;  3VHD A;  2XDL A;  2YK9 A;  2YKB A;  4GFN A;  2BU2 A;  2YEF A;  2XK2 A;  1AMW A;  1Z5B A;  4BIZ A;  1ZXM A;  4V26 A;  2YKC A;  5BOC A;  2IWU A;  2YK2 A;  5M4N A;  2XX4 A;  1UYH A;  1Z5A A;  4W7T A;  2BT0 A;  4URL A;  2C2A A;  4EFU A;  4K4O A;  1GKZ A;  2YEA A;  2IOQ A;  3R4M A;  1GKX A;  3H4L A;  3TZ2 A;  1U0Z A;  2YKI A;  1BKN A;  3A0T A;  3FT8 A;  2Q2E B;  5FWK A;  4XKK A;  4MOT A;  4GT8 A;  4AWP A;  3GIE A;  4CE1 A;  4KQV A;  5FNC A;  1I59 A;  4EMV A;  4WUB A;  4URO A;  2BU7 A;  4LWG A;  4BQG A;  4BIU A;  1UYK A;  4L93 A;  2YI0 A;  2YE4 A;  1L0O A;  4LP0 A;  3HYZ A;  4LWE A;  5CTX A;  4PL9 A;  5FND A;  4XIT A;  1I58 A;  4P7A A;  5F3K A;  3OW6 A;  3A0W A;  2IOP A;  2H55 A;  3BMY A;  2BZ5 A;  5D6P A;  3HZ5 A;  2WEQ A;  1US7 A;  1QYE A;  1YC3 A;  2K5B A;  1YSZ A;  4R3M A;  2HCH A;  3B26 A;  1Y4U A;  3LPS A;  2ZKJ A;  4L94 A;  4GQT A;  4MPE A;  3R91 A;  3T1K A;  4XCJ A;  2WI1 A;  4HXZ A;  1H7S A;  4JAU A;  2WEP A;  3CGZ A;  5D7R A;  4BQJ A;  4MP2 A;  2XDX A;  2IOR A;  4ASB A;  4BAE A;  4XTJ A;  1UYD A;  2E0A A;  2WI2 A;  3PEH A;  5CF0 A;  1YES A;  4MP7 A;  4FCP A;  1UY7 A;  2YEG A;  1BXD A;  5M4M A;  3B25 A;  5M4E A;  1UYL A;  1YC4 A;  1B63 A;  2YEE A;  4CWR A;  1TC6 A;  3T2S A;  2ZDY A;  4EM7 A;  4LWF A;  4ZKI A;  1AH8 A;  4V25 A;  4PU9 A;  2QF6 A;  4U7N A;  1AM1 A;  5M4H A;  4BXI A;  2ZBK B;  2Q8I A;  1ZXN A;  2BU8 A;  4HXW A;  4XIP A;  2FYP A;  4MB9 A;  2XD6 A;  3KE6 A;  4CWO A;  2WI3 A;  4XCL A;  3R92 A;  4AWO A;  2YKE A;  3U67 A;  4HYM A;  5CTY A;  3B24 A;  4ASF A;  3HEK A;  4I3H A;  3RLR A;  1QZR A;  2WI6 A;  3HZ1 A;  2ZDX A;  1B3Q A;  1TC0 A;  2XAB A;  3EKO A;  3PEJ A;  1A4H A;  3TTZ A;  4L8Z A;  1KIJ A;  2HG1 A;  3INW A;  3B28 A;  1ZWH A;  2WI5 A;  2XX2 A;  2CCU A;  3TZ4 A;  1I5B A;  3JZ3 A;  4LPB A;  2GFD A;  2Q8F A;  4JAV A;  2JJC A;  4KTN A;  4HY6 A;  4QPK A;  5IDM A;  2WI4 A;  4EGI A;  2YE8 A;  2YKJ A;  1Y4S A;  2QFO A;  2UWD A;  1YC1 A;  5D7C A;  3OPD A;  4YKR A;  3FT5 A;  4XC0 A;  5CTW A;  4YKY A;  4KP4 A;  5J6A A;  3TZ5 A;  2EXL A;  1H7U A;  3TZ0 A;  3EKR A;  2YEJ A;  4H81 A;  3D36 A;  1S14 A;  3OMU A;  4CWP A;  1I5D A;  3A0Y A;  5BOD A;  4XKA A;  3EHJ A;  4HZ5 A;  2WI7 A;  4WUD A;  4HZ0 A;  1NHH A;  1YER A;  3OWB A;  2FWZ A;  4XKO A;  4CWT A;  4O0B A;  4YKQ A;  2XHX A;  3RLQ A;  2YE3 A;  2XDS A;  4O09 A;  2AKP A;  3ZKB A;  4NH7 A;  3DGE A;  1EA6 A;  4KSG A;  4FCQ A;  2YI6 A;  1UY9 A;  4GEE A;  4R1F A;  4L91 A;  3LNU A;  1THN A;  2YEC A;  2H8M A;  3G75 A;  3R4O A;  3D0B A;  1PVG A;  3EHG A;  1YT0 A;  4CWF A;  3U2K A;  1MX0 A;  1UYM A;  3C11 A;  5D7D A;  1Y8N A;  3G7E A;  2YE9 A;  3INX A;  2QG2 A;  3VHA A;  2XJX A;  2YJW A;  2XDK A;  4EEH A;  2FXS A;  4O05 A;  4PRX A;  1B62 A;  1QY8 A;  2WER A;  3IED A;  3EHF A;  1YET A;  2O1W A;  3T0Z A;  4Q20 A;  3BM9 A;  3HHU A;  1AJ6 A;  1EI1 A;  2CGF A;  3GIG A;  5M4P A;  5L3J A;  2XHR A;  3H80 A;  4B6C A;  3Q5J A;  2Q8H A;  5F5R A;  1NHJ A;  2VCI A;  1UYE A;  4YKZ A;  2YE5 A;  2ESA A;  2BYH A;  3FV5 A;  3Q5K A;  3Q5L A;  4YKX A;  4GGL A;  4NH9 A;  3NMQ A;  2XJG A;  4H85 A;  4URN A;  1NHI A;  1Y8O A;  4MPC A;  5CTU A;  2YEI A;  1BGQ A;  2PNR A;  3CWV A;  2GQP A;  2XCM A;  2O1V A;  4U7O A;  3R4N A;  1TID A;  4KSH A;  2O1U A;  4DUH A;  1UYG A;  3R4P A;  4FMT A;  5IN9 A;  1YSR A;  1ID0 A;  1R62 A;  4URM A;  2YED A;  5GGZ A;  1Y8P A;  4FPP A;  3QDD A;  2CG9 A;  1UY6 A;  3VAD A;  3U2D A;  4P8O A;  4U93 A;  2YE6 A;  1TH8 A;  3T0H A;  1YT2 A;  1MU5 A;  2HKJ A;  3O2F A;  1UYF A;  3B27 A;  2BTZ A;  1UY8 A;  1UYC A;  2YEB A;  3WHA A;  1JM6 A;  4YKU A;  5M4K A;  3VHC A;  1Z5C A;  4WUC A;  1I5C A;  3ZXO A;  2YEH A;  2BRE A;  4XIQ A;  2VWC A;  1YS3 A;  2JKI A;  3A0R A;  1AH6 A; 
#chains in the Genus database with same CATH topology
 3OWD A;  1YT1 A;  4CE2 A;  4PRV A;  1TBW A;  5IDJ A;  4XE2 A;  2BU5 A;  4CWQ A;  4CWS A;  3D2R A;  2C1G A;  3RLP A;  1S16 A;  2YE7 A;  1TIL A;  4AWQ A;  4ZVI A;  5D6Q A;  3CGY A;  4CE3 A;  2BU6 A;  4YKT A;  4E02 A;  2CCT A;  4XD8 A;  3RKZ A;  3K98 A;  2YI7 A;  4HYP A;  4ASA A;  4EGH A;  3GIF A;  2YI5 A;  4AS9 A;  5J71 A;  4EGK A;  4L90 A;  2BSM A;  1KZN A;  3G7B A;  5CPH A;  4XDM A;  1OSF A;  3T10 A;  4H7Q A;  2IWS A;  2BYI A;  2YGF A;  2YJX A;  2VW5 A;  3K60 A;  2IWX A;  3O0I A;  3QTF A;  5FNF A;  3A0Z A;  3MNR P;  1I5A A;  2CCS A;  4EFT A;  1Z59 A;  3EHH A;  4O07 A;  2Q8G A;  2YGE A;  4X9L A;  3TUH A;  4R3A A;  4GCZ A;  2XDU A;  5JEN A;  1U2O A;  3GIG B;  1GJV A;  3ZKD A;  4E00 A;  3A0X A;  2XJJ A;  1BYQ A;  1ZW9 A;  2BRC A;  3K99 A;  4MBC A;  3C0E A;  2YGA A;  4HY1 A;  5C93 A;  4O04 A;  4YKW A;  4B7P A;  4JAS A;  4LWH A;  2XX5 A;  3O6O A;  3ZM7 A;  3CRK A;  4ASG A;  3ZXQ A;  3CRL A;  4QPJ A;  3WQ9 A;  3HYY A;  4LWI A;  2FWY A;  2QG0 A;  4MPN A;  2XHT A;  2YE2 A;  4FCR A;  4CWN A;  2VCJ A;  4DZY A;  4E01 A;  1UYI A;  4I5S A;  4NH8 A;  2CH4 A;  3K97 A;  4XIR A;  4JQL A;  3SL2 A;  4KFG A;  3LMM A;  3VHD A;  2XDL A;  2YK9 A;  2YKB A;  4GFN A;  2BU2 A;  2YEF A;  2XK2 A;  1AMW A;  1Z5B A;  4BIZ A;  1ZXM A;  4V26 A;  2YKC A;  5BOC A;  2IWU A;  2YK2 A;  5M4N A;  2XX4 A;  1UYH A;  1Z5A A;  4W7T A;  2BT0 A;  4URL A;  2C2A A;  4EFU A;  4K4O A;  1GKZ A;  2YEA A;  2IOQ A;  3R4M A;  1GKX A;  3H4L A;  3TZ2 A;  1U0Z A;  2YKI A;  1BKN A;  3A0T A;  3FT8 A;  2Q2E B;  5FWK A;  4XKK A;  4MOT A;  4GT8 A;  4AWP A;  3GIE A;  4CE1 A;  4KQV A;  5FNC A;  1I59 A;  4EMV A;  4WUB A;  4URO A;  2BU7 A;  4LWG A;  4BQG A;  4BIU A;  1UYK A;  4L93 A;  2YI0 A;  2YE4 A;  1L0O A;  4LP0 A;  3HYZ A;  4LWE A;  5CTX A;  4PL9 A;  5FND A;  4XIT A;  1I58 A;  4P7A A;  5F3K A;  2FTK A;  3OW6 A;  3A0W A;  2IOP A;  2H55 A;  3BMY A;  2BZ5 A;  5D6P A;  3HZ5 A;  2WEQ A;  1US7 A;  1QYE A;  1YC3 A;  2K5B A;  1YSZ A;  4R3M A;  2HCH A;  3B26 A;  1Y4U A;  3LPS A;  2ZKJ A;  4L94 A;  4GQT A;  4MPE A;  3R91 A;  3T1K A;  4XCJ A;  2WI1 A;  4HXZ A;  1H7S A;  4JAU A;  2WEP A;  3CGZ A;  5D7R A;  4BQJ A;  4MP2 A;  2XDX A;  2IOR A;  4ASB A;  4BAE A;  4XTJ A;  1UYD A;  2E0A A;  2WI2 A;  3PEH A;  5CF0 A;  1YES A;  4MP7 A;  4FCP A;  1UY7 A;  2YEG A;  1BXD A;  5M4M A;  3B25 A;  5M4E A;  1UYL A;  1YC4 A;  1B63 A;  2YEE A;  4CWR A;  1TC6 A;  3T2S A;  2ZDY A;  4EM7 A;  4LWF A;  4ZKI A;  1AH8 A;  4V25 A;  4PU9 A;  2QF6 A;  4U7N A;  1AM1 A;  5M4H A;  4BXI A;  2ZBK B;  2Q8I A;  1ZXN A;  2BU8 A;  4HXW A;  4XIP A;  2FYP A;  4MB9 A;  2XD6 A;  3KE6 A;  4CWO A;  2WI3 A;  4XCL A;  3R92 A;  4AWO A;  2YKE A;  3U67 A;  3S5T A;  2C1I A;  4HYM A;  5CTY A;  3B24 A;  4ASF A;  3HEK A;  4I3H A;  3RLR A;  1QZR A;  2WI6 A;  3HZ1 A;  2ZDX A;  1B3Q A;  1TC0 A;  2XAB A;  3EKO A;  3PEJ A;  1A4H A;  3TTZ A;  4L8Z A;  1KIJ A;  2HG1 A;  3INW A;  3B28 A;  1ZWH A;  2WI5 A;  2XX2 A;  2CCU A;  3TZ4 A;  1I5B A;  3JZ3 A;  4LPB A;  2GFD A;  2Q8F A;  4JAV A;  2JJC A;  4KTN A;  4HY6 A;  4QPK A;  5IDM A;  2WI4 A;  4EGI A;  2YE8 A;  2YKJ A;  1Y4S A;  2QFO A;  2UWD A;  1YC1 A;  5D7C A;  3OPD A;  4YKR A;  3FT5 A;  4XC0 A;  5CTW A;  4YKY A;  4KP4 A;  5J6A A;  3TZ5 A;  2EXL A;  1H7U A;  3TZ0 A;  3EKR A;  2YEJ A;  4H81 A;  3D36 A;  1S14 A;  3OMU A;  4CWP A;  1I5D A;  3A0Y A;  5BOD A;  4XKA A;  3EHJ A;  4HZ5 A;  2WI7 A;  4WUD A;  4HZ0 A;  1NHH A;  3CYG A;  1YER A;  3OWB A;  2FWZ A;  4XKO A;  4CWT A;  4O0B A;  4YKQ A;  1F51 A;  2XHX A;  3RLQ A;  2YE3 A;  2XDS A;  4O09 A;  2AKP A;  3ZKB A;  4NH7 A;  3DGE A;  1EA6 A;  4KSG A;  4FCQ A;  2YI6 A;  1UY9 A;  4GEE A;  4R1F A;  4L91 A;  3LNU A;  1THN A;  2YEC A;  2H8M A;  3G75 A;  3R4O A;  3D0B A;  1PVG A;  3EHG A;  1YT0 A;  4CWF A;  3U2K A;  1MX0 A;  1UYM A;  3C11 A;  5D7D A;  1Y8N A;  3G7E A;  2YE9 A;  3INX A;  2QG2 A;  3VHA A;  2XJX A;  2YJW A;  2XDK A;  4EEH A;  2FXS A;  4O05 A;  4PRX A;  1B62 A;  1QY8 A;  2WER A;  3IED A;  3EHF A;  4E72 A;  1YET A;  2O1W A;  3T0Z A;  4Q20 A;  3BM9 A;  3HHU A;  1AJ6 A;  1EI1 A;  2CGF A;  3GIG A;  5M4P A;  5L3J A;  2XHR A;  3H80 A;  4B6C A;  3Q5J A;  2Q8H A;  5F5R A;  1NHJ A;  2VCI A;  1UYE A;  4YKZ A;  2YE5 A;  2ESA A;  2BYH A;  3FV5 A;  3Q5K A;  3Q5L A;  4YKX A;  4GGL A;  4NH9 A;  3NMQ A;  2XJG A;  4H85 A;  4URN A;  1NHI A;  1Y8O A;  4MPC A;  5CTU A;  2YEI A;  1BGQ A;  2PNR A;  3CWV A;  2GQP A;  2XCM A;  2O1V A;  4U7O A;  3R4N A;  1TID A;  4KSH A;  2O1U A;  4DUH A;  1UYG A;  3R4P A;  4FMT A;  5IN9 A;  1YSR A;  1ID0 A;  1R62 A;  4URM A;  2YED A;  5GGZ A;  1Y8P A;  4FPP A;  3QDD A;  2HHI A;  2CG9 A;  1UY6 A;  3VAD A;  3U2D A;  4P8O A;  4U93 A;  2YE6 A;  1TH8 A;  3T0H A;  1YT2 A;  1MU5 A;  2HKJ A;  3O2F A;  1UYF A;  3B27 A;  2BTZ A;  1UY8 A;  1UYC A;  2YEB A;  3WHA A;  1JM6 A;  4YKU A;  5M4K A;  3VHC A;  1Z5C A;  1IXM A;  1I5C A;  4WUC A;  2YEH A;  2BRE A;  3ZXO A;  4XIQ A;  2VWC A;  1YS3 A;  2JKI A;  3A0R A;  1AH6 A; 
#chains in the Genus database with same CATH homology
 3OWD A;  1YT1 A;  4CE2 A;  4PRV A;  1TBW A;  5IDJ A;  4XE2 A;  2BU5 A;  4CWQ A;  4CWS A;  3D2R A;  3RLP A;  1S16 A;  2YE7 A;  1TIL A;  4AWQ A;  4ZVI A;  5D6Q A;  3CGY A;  4CE3 A;  2BU6 A;  4YKT A;  4E02 A;  2CCT A;  4XD8 A;  3RKZ A;  3K98 A;  2YI7 A;  4HYP A;  4ASA A;  4EGH A;  3GIF A;  2YI5 A;  4AS9 A;  5J71 A;  4EGK A;  4L90 A;  2BSM A;  1KZN A;  3G7B A;  5CPH A;  4XDM A;  1OSF A;  3T10 A;  4H7Q A;  2IWS A;  2BYI A;  2YGF A;  2YJX A;  2VW5 A;  3K60 A;  2IWX A;  3O0I A;  3QTF A;  5FNF A;  3A0Z A;  3MNR P;  1I5A A;  2CCS A;  4EFT A;  1Z59 A;  3EHH A;  4O07 A;  2Q8G A;  2YGE A;  4X9L A;  3TUH A;  4R3A A;  4GCZ A;  2XDU A;  1U2O A;  3GIG B;  1GJV A;  3ZKD A;  4E00 A;  3A0X A;  2XJJ A;  1BYQ A;  1ZW9 A;  2BRC A;  3K99 A;  4MBC A;  3C0E A;  2YGA A;  4HY1 A;  5C93 A;  4O04 A;  4YKW A;  4B7P A;  4JAS A;  4LWH A;  2XX5 A;  3O6O A;  3ZM7 A;  3CRK A;  4ASG A;  3ZXQ A;  3CRL A;  4QPJ A;  3WQ9 A;  3HYY A;  4LWI A;  2FWY A;  2QG0 A;  4MPN A;  2XHT A;  2YE2 A;  4FCR A;  4CWN A;  2VCJ A;  4DZY A;  4E01 A;  1UYI A;  4I5S A;  4NH8 A;  2CH4 A;  3K97 A;  4XIR A;  4JQL A;  3SL2 A;  4KFG A;  3VHD A;  2XDL A;  2YK9 A;  2YKB A;  4GFN A;  2BU2 A;  2YEF A;  2XK2 A;  1AMW A;  1Z5B A;  4BIZ A;  1ZXM A;  4V26 A;  2YKC A;  5BOC A;  2IWU A;  2YK2 A;  5M4N A;  2XX4 A;  1UYH A;  1Z5A A;  4W7T A;  2BT0 A;  4URL A;  2C2A A;  4EFU A;  4K4O A;  1GKZ A;  2YEA A;  2IOQ A;  3R4M A;  1GKX A;  3H4L A;  3TZ2 A;  1U0Z A;  2YKI A;  1BKN A;  3A0T A;  3FT8 A;  2Q2E B;  5FWK A;  4XKK A;  4MOT A;  4GT8 A;  4AWP A;  3GIE A;  4CE1 A;  4KQV A;  5FNC A;  1I59 A;  4EMV A;  4WUB A;  4URO A;  2BU7 A;  4LWG A;  4BQG A;  4BIU A;  1UYK A;  4L93 A;  2YI0 A;  2YE4 A;  1L0O A;  4LP0 A;  3HYZ A;  4LWE A;  5CTX A;  4PL9 A;  5FND A;  4XIT A;  1I58 A;  4P7A A;  5F3K A;  3OW6 A;  3A0W A;  2IOP A;  2H55 A;  3BMY A;  2BZ5 A;  5D6P A;  3HZ5 A;  2WEQ A;  1US7 A;  1QYE A;  1YC3 A;  2K5B A;  1YSZ A;  4R3M A;  2HCH A;  3B26 A;  1Y4U A;  3LPS A;  2ZKJ A;  4L94 A;  4GQT A;  4MPE A;  3R91 A;  3T1K A;  4XCJ A;  2WI1 A;  4HXZ A;  1H7S A;  4JAU A;  2WEP A;  3CGZ A;  5D7R A;  4BQJ A;  4MP2 A;  2XDX A;  2IOR A;  4ASB A;  4BAE A;  4XTJ A;  1UYD A;  2E0A A;  2WI2 A;  3PEH A;  5CF0 A;  1YES A;  4MP7 A;  4FCP A;  1UY7 A;  2YEG A;  1BXD A;  5M4M A;  3B25 A;  5M4E A;  1UYL A;  1YC4 A;  1B63 A;  2YEE A;  4CWR A;  1TC6 A;  3T2S A;  2ZDY A;  4EM7 A;  4LWF A;  4ZKI A;  1AH8 A;  4V25 A;  4PU9 A;  2QF6 A;  4U7N A;  1AM1 A;  5M4H A;  4BXI A;  2ZBK B;  2Q8I A;  1ZXN A;  2BU8 A;  4HXW A;  4XIP A;  2FYP A;  4MB9 A;  2XD6 A;  3KE6 A;  4CWO A;  2WI3 A;  4XCL A;  3R92 A;  4AWO A;  2YKE A;  3U67 A;  4HYM A;  5CTY A;  3B24 A;  4ASF A;  3HEK A;  4I3H A;  3RLR A;  1QZR A;  2WI6 A;  3HZ1 A;  2ZDX A;  1B3Q A;  1TC0 A;  2XAB A;  3EKO A;  3PEJ A;  1A4H A;  3TTZ A;  4L8Z A;  1KIJ A;  2HG1 A;  3INW A;  3B28 A;  1ZWH A;  2WI5 A;  2XX2 A;  2CCU A;  3TZ4 A;  1I5B A;  3JZ3 A;  4LPB A;  2GFD A;  2Q8F A;  4JAV A;  2JJC A;  4KTN A;  4HY6 A;  4QPK A;  5IDM A;  2WI4 A;  4EGI A;  2YE8 A;  2YKJ A;  1Y4S A;  2QFO A;  2UWD A;  1YC1 A;  5D7C A;  3OPD A;  4YKR A;  3FT5 A;  4XC0 A;  5CTW A;  4YKY A;  4KP4 A;  5J6A A;  3TZ5 A;  2EXL A;  1H7U A;  3TZ0 A;  3EKR A;  2YEJ A;  4H81 A;  3D36 A;  1S14 A;  3OMU A;  4CWP A;  1I5D A;  3A0Y A;  5BOD A;  4XKA A;  3EHJ A;  4HZ5 A;  2WI7 A;  4WUD A;  4HZ0 A;  1NHH A;  1YER A;  3OWB A;  2FWZ A;  4XKO A;  4CWT A;  4O0B A;  4YKQ A;  2XHX A;  3RLQ A;  2YE3 A;  2XDS A;  4O09 A;  2AKP A;  3ZKB A;  4NH7 A;  3DGE A;  1EA6 A;  4KSG A;  4FCQ A;  2YI6 A;  1UY9 A;  4GEE A;  4R1F A;  4L91 A;  3LNU A;  1THN A;  2YEC A;  2H8M A;  3G75 A;  3R4O A;  3D0B A;  1PVG A;  3EHG A;  1YT0 A;  4CWF A;  3U2K A;  1MX0 A;  1UYM A;  3C11 A;  5D7D A;  1Y8N A;  3G7E A;  2YE9 A;  3INX A;  2QG2 A;  3VHA A;  2XJX A;  2YJW A;  2XDK A;  4EEH A;  2FXS A;  4O05 A;  4PRX A;  1B62 A;  1QY8 A;  2WER A;  3IED A;  3EHF A;  1YET A;  2O1W A;  3T0Z A;  4Q20 A;  3BM9 A;  3HHU A;  1AJ6 A;  1EI1 A;  2CGF A;  3GIG A;  5M4P A;  5L3J A;  2XHR A;  3H80 A;  4B6C A;  3Q5J A;  2Q8H A;  5F5R A;  1NHJ A;  2VCI A;  1UYE A;  4YKZ A;  2YE5 A;  2ESA A;  2BYH A;  3FV5 A;  3Q5K A;  3Q5L A;  4YKX A;  4GGL A;  4NH9 A;  3NMQ A;  2XJG A;  4H85 A;  4URN A;  1NHI A;  1Y8O A;  4MPC A;  5CTU A;  2YEI A;  1BGQ A;  2PNR A;  3CWV A;  2GQP A;  2XCM A;  2O1V A;  4U7O A;  3R4N A;  1TID A;  4KSH A;  2O1U A;  4DUH A;  1UYG A;  3R4P A;  4FMT A;  5IN9 A;  1YSR A;  1ID0 A;  1R62 A;  4URM A;  2YED A;  5GGZ A;  1Y8P A;  4FPP A;  3QDD A;  2CG9 A;  1UY6 A;  3VAD A;  3U2D A;  4P8O A;  4U93 A;  2YE6 A;  1TH8 A;  3T0H A;  1YT2 A;  1MU5 A;  2HKJ A;  3O2F A;  1UYF A;  3B27 A;  2BTZ A;  1UY8 A;  1UYC A;  2YEB A;  3WHA A;  1JM6 A;  4YKU A;  5M4K A;  3VHC A;  1Z5C A;  4WUC A;  1I5C A;  3ZXO A;  2YEH A;  2BRE A;  4XIQ A;  2VWC A;  1YS3 A;  2JKI A;  3A0R A;  1AH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...