4GFRA

Crystal structure of the liganded chitin oligasaccharide binding protein
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
529
structure length
529
Chain Sequence
RSELTIVPDFYPTMVRNFNPYLATNLRTTTDFIYEPLVVFNEMKGNTPVFRLAESYKMADDLMSVTFDIRKGVKWSDGEAFTADDVVYSFGLLKAKPELDQRGINKWVTSVEKVDEYKVRFRLSEANSNVPYEISLIPIVAEHVWKDVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQLLGKIVNSELDWTSSFVPDIDRTYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKKEALDNVDFRRAFSMALDRQTIIDIAFYGSGTVNDFASGLGYAFEAWSDEATHKKYKGFNTYDVEGSKKLLAKAGFKDVNGDGFVETPSGKSFELLIQSPNGWTDFNNTVQLAVEQLQEVGIKAKARTPEFAVYNQAMLEGTYDVAYTNYFHGADPFTYWNSGYNSALQSGDGMPRFAMHYFTDKKLDGLLDSFYKTADKNEQLAIAHGIQKIIAENQVTIPVMSGAWMYQYNTTRFTGWWSEENPKGRPSVWAGIPERLLHVLDLKPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chitin catabolic cascade in the marine bacterium Vibrio cholerae: properties, structure and functions of a periplasmic chitooligosaccharide binding protein (CBP)
rcsb
molecule keywords Peptide ABC transporter, periplasmic peptide-binding protein
molecule tags Signaling protein
source organism Vibrio cholerae o1 biovar el tor
total genus 176
structure length 529
sequence length 529
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4gfrA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gfrA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 4gfrA02
2DSFA 2H99A 5TP9B 2RKMA 5H8HA 4Z7EA 1MS7A 3U8QA 4AQ4A 1H45A 1JNFA 2E1SA 2XXYA 2F36A 3MC2A 2Q8JA 4OEUA 3N6UA 3CR9A 1Y4CA 4KHZE 3VXCA 4KYSA 3TELA 3K01A 5L9OA 3UN6A 1XVYA 2QMXA 1ATGA 1MPCA 3TAJA 4C0RA 1FTKA 1H76A 2V25A 2XXTA 4YU0A 2Y7IA 3KG2A 3TEPA 3MPKA 3G3FA 4ZECA 4NF8B 4C1UA 3PUWE 4Q5TA 1TXFA 2XD3A 3G3GA 1AOVA 4GVOA 4NF5A 4RK9A 5J1DA 4I1DA 3ZS6A 2DE4A 3KFMA 3LSLA 1SVXB 3VLWA 3VFJA 4NTLA 1MQHA 1WDNA 4OQOA 1ELJA 2UVHA 3PU5A 3LR1A 4R75A 2DP8A 1JEVA 4XIGQ 3RN8A 1ZTYA 1A7LA 4U23A 1P1QA 4YICA 4WKMA 4ZEKA 4R73A 4LQ2A 3T9XB 2ZYMA 1IXIA 4R9FA 4F3BA 1O64A 2O1MA 2HEUA 2H9BA 1NNTA 3CVGA 1M5DA 5L9MA 4DDDA 3TODA 3CSBA 5CBSA 1FW0A 1UIVA 3DP8A 2VHAA 3U93A 2HAVA 4QFPA 2HZKA 1QVSA 4I62A 5I59A 2ZNUA 4H8IA 4C1TA 1FQAA 3MZ1A 3H06B 3N94A 4O3AA 2Y7PA 4H1XA 1MH3A 3S2VA 1ZMGA 4ZZEA 4KYEA 5A5XA 1IEJA 2ONKE 3HHFA 4E0XA 1P1UA 3FJ7A 1F9BA 3FXQA 3HV1A 4KFQA 1OVTA 4MFIA 1DMBA 2OLBA 4RK2A 1SW4A 1ZLQA 2RF1A 4F31B 5TU0A 1FQCA 3VLUA 2DXRA 4WXJA 2Q2AA 4EUOA 2ONSA 4OVJA 3CFXA 2O68A 1AL3A 3WAFA 4PFTA 1URGA 2DWJA 3FASA 3O6PA 4QSCA 1NKXA 3G3KA 1MQJA 4HW8A 2DWAA 2DVCA 1FTJA 2REJA 1A8FA 3FVGA 4PQJA 2A5TB 3F11A 1LBBA 2IEEA 4Z0IA 1NH7A 1NFTA 1B0LA 5DT6A 1JEUA 4N6PA 3V5AA 2H5YA 4GF8A 4OEVA 3BFUA 2V3QA 5ICQA 1II5A 5IKBA 2NVUB 1B40A 1O7TA 2F35A 3T66A 3C35A 4FEDA 1R1NA 2DVZA 3FVKA 2I49A 5M2VA 4FE8A 5FHOA 3FZVA 3WAEA 4AB5A 1KWHA 3ZSFA 3ECRA 2B4LA 4IO5A 2F7CA 1OIBA 2I4CA 2ZMBA 4R6YA 4EF1A 3GZGA 4XKNA 4YZZA 3K1PA 3EHTA 3FJMA 4IB2A 1MQGA 4M1VA 1OQHA 4ZE8A 4H67A 4GLIA 1TFDA 1JETA 4OFOA 1MXZA 3CRBA 2AL4A 3MZBA 4N07A 3TQLA 4R74A 5I2KA 2Q89A 4GRKA 2F7AA 1GGGA 4FAJA 3B6WA 3IR1A 2LAOA 2I6EA 2D5WA 2F78A 1PBQA 5ICTA 4U2RA 1YTVA 3VVEA 3AXFA 1TT1A 4F19A 2GH9A 3C32A 3OO9A 1AMFA 4GD5A 1Q35A 5DVFA 5I56B 2DE3A 1MM6A 3FXRA 4THIA 1B3GA 4GOTA 3V83A 3VLVA 2UVIA 5KCJB 2ABHA 3MQ9A 1USYE 3KBRA 4X1BA 4ESXA 3KGCA 2RC7A 3TCFA 2Q88A 4F18A 5DVIA 1SI1A 3R7XA 5CMKA 3IB2A 1IIWA 5DEXA 4MLVA 5JK4A 4QFLA 3HHGA 1QKAA 2Q9TA 4KD5A 2PT1A 5H8NB 3T9UA 2RC9A 3TUSA 1A40A 3FVOA 4JB7A 4KPTA 5H8HB 1S7YA 1Z7ME 5JEIA 3Q26A 4PFYA 4NF4B 4YMBA 5EHMA 5CMBA 3IOTA 1P1OA 1B58A 3DRHA 3D4GA 3TTKA 4EXLA 3M3KA 3DP6A 3PPNA 5FHMA 2ZNSA 1I69A 3K00A 2VD2A 3CFLA 3RT6B 2XXIA 3KSXA 3DP4A 3OSQA 2GHAA 4R72A 1OLCA 3C33A 3CIJA 1B32A 3SEYA 2VGQA 1D4NA 3PAMA 2QPQA 2I48A 1S50A 2KLFA 3C4MA 2UXAA 4U4SA 2DWIA 3OO6A 2R6GE 3RTWB 1POTA 4ESWA 4POXA 3IAZA 2V93A 1R9QA 1UTHA 1BIYA 2OK2A 1M5EA 2XHDA 5HPQA 4H6DA 3EHSA 3TYHA 1AIVA 3A3CA 3IORA 3EN3A 4JDFA 3R26A 3RQTA 4GL8A 5AE4A 1JQFA 1SD3A 1P1NA 2GHBA 4H5FA 1PEBA 2QS2A 1MPBA 4RPNA 3S4UA 3I6VA 1Y1MA 3VE1B 2X7QA 1N7XA 2Y84A 5AA2D 4HS7A 3FATA 1QUIA 1XVXA 5CRYA 3QUJA 1Y3NA 3QAXA 3U92A 2DOJA 5I59B 3FIRA 3PMVA 3OMBA 3M8UA 4ISUA 4RNSA 3HO7A 3IOUA 2QJEA 4TLLB 4KQPA 1DSNA 3OXNA 3LVUA 1FTLA 3MPLA 1JW5A 5KZTA 2ZYKA 1MXXA 2RINA 1FQBA 4WEDA 4NEDA 3CI8A 1N84A 5A5XB 3OEMA 4Q8RA 2XXVA 3FGSA 4KI0E 3E13X 2F7BA 5HM4B 2WKYA 1B7ZA 4OWDA 5TPAB 4AB6A 1Y20A 4U22A 3LUYA 5I58A 1RYOA 3FTOA 3PPRA 3FXUA 1TWYA 3GXAA 4GIZA 3KOTA 2I0BA 3SDFA 1H44A 1B05A 2XXRA 2DYXA 3PUXE 5CC2A 4OTEA 2XX8A 3LC8A 4F1YA 3DM0A 2GRVA 1I6BA 4OXVA 4ELQA 1XHYA 1QUKA 1WVJA 3EQ1A 4DCXA 3TTRA 2RCBA 4F1UA 1US5A 3QXMA 4JXIA 2NWJA 1EZOA 1MQIA 4MLQA 1M5BA 4QF9A 1UTBA 1JVYA 1P99A 1B2HA 2F8DA 5EYFA 3VVFA 5AA1A 3RYAA 3Q27A 3DRGA 1N04A 3H6UA 3UGWA 2P2AA 4WEPA 4DXCA 2FNCA 3PMXA 3JV9A 2ANJA 1MQDA 4NF8A 4G68A 1NNPA 1IXCA 2QS3A 1MXWA 4PP0A 4ONYA 1D3KA 3PMWA 1B46A 3PD9A 3B6TA 3H6VA 3KN3A 2QS4A 4XKQA 1XC1A 5DYHA 3VV5A 2XX7A 4RXLA 3LSXA 1B4ZA 4F39A 4DIGA 3H4ZA 2Z8DA 4NF6A 4G8HA 5ITOA 4JSDA 2Z22A 1M5CA 4GXSB 1ANFA 3TCGA 3TTLA 5CMMA 3T9VA 5I57A 4RYAA 3MP8A 4QHQA 1P1WA 5ELVA 3O29A 3RTFB 3FVNA 4NWCA 3OEKA 4FATA 4X48A 1LAFE 3H3GA 4TQUQ 4PETA 5AA4A 1B0HA 3OENA 1UQWA 1QUJA 4DCYA 1LFIA 3K1NA 3O28A 2ZNTA 4BDMA 1VFEA 3QSLA 3K6UA 4BDRA 1VR5A 1URSA 5I2KB 2QL3A 2F97A 1N0TA 3FJGA 1VE4A 4BLAA 3KSJA 1FTOA 3E4RA 3PV0E 1B51A 4PFUA 4LZ7A 4XTCQ 1B1HA 4IY5A 4EF2A 1N3XA 4ZEBA 3FD3A 2UVGA 1EZPA 3BBRA 4OESA 4JWXA 4U1OA 1ZJLA 4NMYA 1Y4TA 4TOZA 3U72A 2Y7RA 5DTBA 3PUYE 2Q2CA 2B65A 3TDJA 4XKRA 3QYTA 3FV2A 1B5JA 3G3HA 3M3LA 4JSOA 2CZLA 3IX1A 4G2ZA 4UA8A 1US4A 4HCWA 4MBPA 4MF3A 1LSTA 4O3BA 3K6VA 4GQOA 4BDOA 1SQYA 1PB8A 3UP9A 4H8JA 4GWOA 3OO8A 4QSEA 1A55A 3IJOB 4QSDA 5DVJA 5DEXB 3R6UA 4YB6A 1B3EA 1NH8A 2PT2A 3U1OA 2F5XA 1IXGA 3KN7A 4LUBA 5JTYA 4G4PA 4F3SA 1YAEA 2HXWA 1PB9A 4LQ5A 2Z8EA 3OD7A 3CG1A 3MP1A 1EZ9A 2DS9A 5H8FA 4U1ZA 3O66A 3EPEA 2XD2A 3I5OA 1USYH 3MAMA 5I2NB 4OYVA 4ND9A 5AA3A 2OWSA 1A99A 2HQ0A 4QFOA 3ONMA 3C9HA 4R6KA 1MY3A 2O7IA 1B7HA 1D9VA 2H98A 4X1DA 3H7MA 2Z8FA 2XXQA 3UK4A 2G29A 1QJMA 3PD8A 2R71A 5CI5A 3IB1A 2HAUA 5BUUA 3HSTA 3TTMA 5EHSA 1UTHB 4ZEDA 2RC8A 1LBCA 2I0CA 3JZJA 3PUVE 3D4CA 2OBGA 3B7DA 5I84A 2V84A 4LONB 5H8QA 1NL5A 2VD3A 3PPOA 3SEUA 4G8NA 1B3LA 1B9JA 1B3FA 4Q30B 4O3CA 2VP1A 4YKJA 2HCAA 4R2BA 4QRZA 3T22A 4QFNA 1MDP1 1LAGE 2F34A 5KDTA 1B5IA 5K2XA 1LB8A 4H5GA 3DELB 4OENA 3LSFB 3FUZA 3CFZA 4E0WA 4DXBA 1RKMA 1D9YA 3G3JA 3PPQA 1R9LA 2DQVA 3DRKA 2Y7KA 4LZ8A 1Y9UA 3KZGA 3I3VA 1OQGA 2REGA 5AA2A 1MM7A 1SW2A 1HSJA 4PE5B 4G77A 2BJJX 3H6TA 4HCYA 4NF5B 2O1LA 1CB6A 4F3GA 4RY1A 3O2AA 3T96B 1OVBA 3O97A 4OMBA 1B4HA 4GFRA 3ODBA 2FYIA 3HN0A 4ZZAA 3DLNA 1BKAA 3K6WA 4NE4A 3UORA 3E3KA 4YKPA 1FTMA 1LCTA 4P0GA 5CBRA 1POY1 2B3BA 4ECFA 1MDQA 4LP2B 4MH5A 2B3FA 2V3UA 4IO6A 4UACA 3DRIA 1NMUA 2H4IA 3IOVA 4Q0CA 2YPNA 4NF4A 5FTHA 1WODA 2O51A 1XS5A 2VOZA 3S9MC 4IO3A 4RPOA 2CMOA 4H0WA 3N5LA 4JBZA 3IK6B 3MWBA 4XKPA 1UTBB 2OJTA 4ZEFA 4F1VA 3P7IA 3G3IA 1LFHA 3W9VA 4EQ9A 4YAHX 3M3FA 4FJPA 2XXXA 3GLBA 5L9SA 1GVCA 1B52A 4G68B 4FORA 3KJ7A 2DE2A 1FQDA 2HFBA 1SI0A 1J1NA 4OZ9A 1LGBC 4RJZA 3MZ9A 2YJPA 1Y3QA 2Y7WA 2WOKA 3GBBA 4BDLA 4L17A 2F6PA 4POWA 1NNFA 1MXYA 4FIMA 1IXHA 3ZKLA 1YCJA 1BP5A 3MVYA 1H43A 4K3FA 4NF6B 4YKIA 5TP9A 4EQ7A 4KCDA 3E9XA 2QRYA 1QULA 5I57B 3CHGA 3OOAA 5IAIA 1T0KA 1XT8A 3QK6A 3V89B 2D21A 2OCUA 2NUVA 1SBPA 1Y1ZA 4LVQA 2WOLA 1Z7NE 5F1QA 5BWJA 2HZLA 5AA4B 1SYHA 3SEXA 1SW5A 2X26A 4I9DA 1RYXA 4M4GA 4F22A 3SETA 3OSRA 4F2OA 4OHNA 1DTGA 1ZIUA 3RT8A 1MY4A 3MP6A 3S9LC 3L6HA 3SERA 1URDA 4OFLA 4DXUA 3T93B 2XXHA 4IO2A 2V3TA 4GL0A 2NXOA 3SKPA 3Q28A 4U21A 2XXWA 4ELOA 3G7WA 3N6TA 5B7DA 2W7YA 3EF7A 4I8CA 4X9TA 3KEIA 2ZXTA 2PVUA 1B1XA 3ILUB 3K4UA 5B70A 3LBSA 3C31A 1A8EA 3C34A 3KN8A 4IY6A 1JVXA 4FEBA 4LA9A 4N13A 1Y3PA 3S9EA 1FQEA 5TPAA 2OWTA 3O9PA 3TTNA 3L6GA 1MRPA 3QIMA 4P0IA 1H3DA 1GR2A 2E0SA 1PB7A 2D3IA 2F6GA 3DRFA 3MW0A 2AL5A 1JW4A 4GXAA 2G93A 3PUZE 2X7PA 3IO4A 2ESNA 2UYFA 4YKKA 5F7VA 1GTKA 2THIA 3DRJA 2IA4A 3MVXA 1ZKBA 1VFDA 5JTYB 3MBPA 3MJNA 2QS1A 1QW0A 1I6QA 4TLMB 2O7UA 3LSWA 3RPWA 3IO6A 4HTGA 1LCFA 3RYBA 3T9HB 3RNNA 5ISUA 2PYYA 3TMGA 1IZ1A 1DPEA 1JW1A 5H8FB 1L5TA 1I6AA 1GV8A 1R6ZA 1S9TA 3IB0A 2XX9A 2AIXA 4YMAA 3H6WA 3B6QA 4FECA 2UYEA 1XOCA 2NOOA 2O84X 1DOTA 1MXUA 3C36A 4F2QA 1PC3A 2O6AA 3RLFE 3PGFA 1LFGA 4LATA 1DTZA 4ZDMA 3K2DA 4ZS9A 1SW1A 2I4BA 4ELPA 3TZAA 1HSEA 4QFKA 4YB7A 5FHNA 2XXPA 5ITPA 1YPNA 3RY3A 3VXBA 5H8SA 4IGRA 1EU8A 2I3WA 3TCHA 2R9JA 3TKDA 5H8QB 1B6HA 4ZE9A 1VSOA 2PX1A 2A5TA 4NWDA 3GBAA 1OLAA 4OFJA 3IJXB 1LB9A 2I58A 3IOWA 3K02A 3Q25A 2ZYNA 4OETA 3W15C 3SESA 1IITA 4DLDA 4DZ1A 4IGTA 4KYDA 4U4XA 4F29A 4KR5A 2DWHA 3A09A 5KDTB 3HPIA 3MUQA 3RGYA 2O69A 2QMWA 3IL1B 4R2FA 2XXUA 1MY0A 2I3VA 1MPDA 3K1MA 1LAHE 3QUFA 3SEVA 1O63A 1N7WA 3ILTB 2B4MA 4IO4A 4LZ5A 3MVWA 3PPPA 1IUDA 4YB5A 2P1SA 5AA2B 4KCCA 3V8XB 1B5HA 3USDA 3A3UA 2ZYOA 1B7UA 4EDPA 2YLNA 1FQFA 3OO7A 1UIUA 3W9WA 2H25A 3K6XA 3BKIB 3TPAA 1MY2A 2QSXA 1M5FA 4OERA 1A54A 1MH4A 4G8MA 3S9NC 1NNKA 3TFLA 3VVDA 4G68C 1Q1KA 1ZBMA 4P11A 4H65A 1MY1A 4EQBA 5CM6A 2UVJA 4ZEIA 4JWOA 1BTJA 1MXVA 4BDNA 1BLFA 2ONRA 4BDQA 1N76A 5K2YA 2M8CA 1OMPA 4IO7A 3SEWA 1QKBA 2FA7A 1CE2A 4EXKA 1TFAA 4F3PA 1ZU0A 3HCQA 4R9GA 3THIA 2RCAA 1EH3A 3O6HA 1IQ7A 4ELRA 3BFTA 4PFWA 4DE8A 2WOPA 5CMCA 2PBWA 3CSGA 2ALUA 2DXYA 2AYSA 3U94A 5I56A 1LAXA 5I2NA 3K0VA 1PBPA 3RUMA 5LOMA 3VDFA 3JYRA 1HSLA 2Z23A 3TQWA 1PDAA 3KOSA 3OELA 4JWYA 3CG3A 5KCJA 1SDXA 4XXUA 4RA1A 1SYIA 5HBCA 3O6GA 5L8DA 2P0SA 3FV1A 3N26A 1LLSA 3H03A 2A5SA 3ZKKA 3UA8A 1B3HA 1N3WA 3O6IA 2GFEA 2PMSA 5FTIA 3UIFA 1AH5A 4R6HA 3MVZA 5I58B 2OZZA 3KJTA 1DPPA 5H8NA 1MG1A 3EHUA 1FCKA 3Q29A
chains in the Genus database with same CATH superfamily
2DSFA 3RYDA 2H99A 5TP9B 2RKMA 5H8HA 4Z7EA 1MS7A 4GBWA 3U8QA 4AQ4A 1NV4A 1H45A 1JNFA 1FPLA 2E1SA 2XXYA 2F36A 1SPIA 3MC2A 2Q8JA 4OEUA 3N6UA 3CR9A 3SZPA 1Y4CA 1XI6A 4KHZE 3VXCA 4KYSA 3TELA 4PE3A 3K01A 5L9OA 3UN6A 1XVYA 2QMXA 1ATGA 1MPCA 3TAJA 4C0RA 1FTKA 1H76A 2V25A 2XXTA 4YU0A 2Y7IA 3KG2A 3TEPA 4PAKA 3MPKA 3G3FA 4P1EA 4ZECA 4NF8B 4C1UA 2XWIA 3PUWE 4Q5TA 4O94A 1TXFA 2XD3A 3G3GA 1AOVA 4GVOA 4NF5A 4RK9A 5J1DA 4PFBA 4I1DA 3ZS6A 2DE4A 3KFMA 3LSLA 1SVXB 3VLWA 3VFJA 4NTLA 4NF0A 1MQHA 1WDNA 4OQOA 1ELJA 2UVHA 3PU5A 3LR1A 4R75A 4GWZA 2DP8A 1JEVA 4H46A 4XIGQ 3RN8A 3EKIA 1ZTYA 1A7LA 4U23A 1P1QA 4YICA 4WKMA 4ZEKA 4R73A 4LQ2A 3T9XB 2ZYMA 1IXIA 1NV0A 4PTKA 4R9FA 4F3BA 1O64A 3QMFA 4GWYA 2O1MA 2HEUA 4O8MA 2H9BA 1FBFA 1NNTA 3CVGA 4MNPA 1M5DA 5L9MA 4DDDA 3TODA 3CSBA 5CBSA 1FW0A 2ZZWA 1UIVA 3DP8A 2VHAA 3U93A 2HAVA 4QBAA 4QFPA 2HZKA 1NUYA 1QVSA 4I62A 5I59A 2ZNUA 4H8IA 4C1TA 1FQAA 2L5VA 3MZ1A 3H06B 3N94A 4O3AA 2OX3A 2Y7PA 4H1XA 1YXIA 1MH3A 3S2VA 2Y5KA 1ZMGA 4ZZEA 4KYEA 5A5XA 1IEJA 2ONKE 3HHFA 4E0XA 1P1UA 3FJ7A 1F9BA 3FXQA 3HV1A 4KFQA 1NV1A 1OVTA 1LBZA 4MFIA 1DMBA 2OLBA 4RK2A 1SW4A 1ZLQA 2RF1A 4F31B 5TU0A 1FQCA 1FPKA 3VLUA 1Q9DA 2DXRA 4WXJA 2Q2AA 2PFZA 4EUOA 2ONSA 4OVJA 3CFXA 2O68A 1IMCA 1AL3A 3WAFA 4PFTA 1URGA 1KA1A 5ET7A 1FBEA 2DWJA 3FASA 3O6PA 4QSCA 1NKXA 3G3KA 1MQJA 4HW8A 1INPA 2DWAA 2DVCA 2QVVA 1FTJA 2REJA 1A8FA 3FVGA 4PQJA 2A5TB 3F11A 1LBBA 2IEEA 4Z0IA 1NH7A 1NFTA 1FTAA 1B0LA 5DT6A 1JEUA 4NQ8A 4N6PA 3V5AA 2H5YA 4GF8A 4OEVA 1IMAA 3BFUA 4X04A 2V3QA 5ICQA 1RDZA 1II5A 1LBYA 5IKBA 2NVUB 4MX6A 1B40A 1O7TA 2F35A 3T66A 3C35A 2KR0A 4FEDA 1R1NA 4MIJA 2DVZA 3FVKA 4N17A 2I49A 5M2VA 4FE8A 5FHOA 3FZVA 3WAEA 5IM2A 4AB5A 1KWHA 3ZSFA 3ECRA 3E79A 2B4LA 5EQ9A 4IO5A 4NGUA 3RPLB 2F7CA 1OIBA 2I4CA 5LTCA 2ZMBA 4MHFA 4R6YA 1FBGA 5IZ3B 4EF1A 3GZGA 4XKNA 3U65A 4YZZA 1NV2A 1K9ZA 4MMPA 3K1PA 3EHTA 3FJMA 4IB2A 1MQGA 4M1VA 1OQHA 4ZE8A 4JVIA 4H67A 2FHYA 4GLIA 1TFDA 1JETA 4OFOA 1MXZA 3CRBA 2AL4A 3MZBA 4N07A 3TQLA 4R74A 5I2KA 3IFCA 2Q89A 4GRKA 2F7AA 1GGGA 4FAJA 1IMDA 3B6WA 3IR1A 2LAOA 2I6EA 2D5WA 2F78A 1PBQA 5ICTA 4U2RA 1FSAA 1YTVA 3VVEA 3AXFA 4MAGA 1TT1A 4F19A 2GH9A 3C32A 3OO9A 2CZIA 1AMFA 2VT5A 4GD5A 1Q35A 4NG7A 5DVFA 5I56B 2DE3A 1IMEA 1MM6A 3FXRA 4THIA 1B3GA 4GOTA 3V83A 3VLVA 2UVIA 5KCJB 2ABHA 4X8RA 1IMFA 3MQ9A 2XWKA 1USYE 3KBRA 4X1BA 4ESXA 3KGCA 2RC7A 3TCFA 2DDKA 2Q88A 4F18A 5DVIA 1SI1A 3R7XA 5CMKA 3IB2A 1IIWA 5DEXA 4OVRA 4MLVA 5JK4A 4QFLA 3HHGA 1JP4A 1QKAA 2Q9TA 4KD5A 2PT1A 5H8NB 4OVTA 3T9UA 2RC9A 4MNIA 2WBDA 3TUSA 1A40A 3FVOA 4JB7A 4KPTA 5H8HB 1S7YA 1Z7ME 5JEIA 3Q26A 4PFYA 4NF4B 4I3YA 4YMBA 5EHMA 5CMBA 2HPGA 3IOTA 1P1OA 1B58A 3DRHA 2Q74A 3D4GA 3TTKA 4EXLA 3M3KA 1NI9A 1D9QA 3DP6A 4GWWA 3GYYA 3PPNA 5FHMA 2ZNSA 1I69A 3K00A 2VD2A 3CFLA 3RT6B 2XXIA 2CEXA 3KSXA 1K9YA 4PF8A 3DP4A 3OSQA 2GHAA 4QXDA 4R72A 1OLCA 3C33A 3CIJA 1B32A 3SEYA 2VGQA 2QVRA 1D4NA 3PAMA 4OVSA 2QPQA 2I48A 1S50A 2KLFA 3LUZA 3C4MA 2UXAA 3B50A 4U4SA 2DWIA 3OO6A 2P3VA 2R6GE 3RTWB 1POTA 4ESWA 4POXA 3IAZA 2V93A 1R9QA 1UTHA 1BIYA 2OK2A 1M5EA 4P8BA 2XHDA 3HFUA 5IZ1A 5HPQA 4H6DA 3EHSA 3TYHA 1AIVA 3A3CA 4OANA 3IORA 3EN3A 4JDFA 3R26A 5F24A 3RQTA 4GL8A 5AE4A 1JQFA 1SD3A 1QGXA 3B8BA 1P1NA 2GHBA 4PF6A 4MNCA 4H5FA 1PEBA 2QS2A 1MPBA 4RPNA 3S4UA 3I6VA 1Y1MA 3VE1B 2X7QA 1N7XA 2Y84A 5AA2D 4HS7A 3FATA 1QUIA 4HE1A 4G61A 1XVXA 5CRYA 3QUJA 1Y3NA 3QAXA 3U92A 1LBWA 4P1LA 2DOJA 4PFIA 5I59B 2CEYA 3FIRA 2FBPA 3PMVA 3OMBA 2FIEA 3M8UA 4ISUA 4RNSA 3HO7A 3IOUA 2QJEA 4TLLB 4KQPA 1DSNA 3OXNA 4DI3D 3LVUA 4N8YA 1FTLA 3MPLA 1JW5A 5KZTA 1FBHA 2ZYKA 1MXXA 2RINA 1FQBA 1FPDA 4WEDA 4NEDA 3CI8A 1N84A 4H45A 5A5XB 2R8TA 3OEMA 4Q8RA 2XXVA 3FGSA 4KI0E 3E13X 2F7BA 5HM4B 2WKYA 1B7ZA 2P3NA 4OWDA 2XWVA 5TPAB 4AB6A 1Y20A 5ET5A 4AS4A 2PFYA 4U22A 3LUYA 5I58A 3D1RA 1RYOA 3FTOA 5IGAA 3PPRA 3FXUA 1TWYA 2QVUA 3GXAA 4GIZA 3KOTA 2I0BA 3SDFA 1H44A 3T1BA 3T0JA 1B05A 2XXRA 2DYXA 5EQ7A 3PUXE 5CC2A 4XFEA 4GBVA 5EQAA 4OTEA 2XX8A 3LC8A 4F1YA 3DM0A 4N4UA 2GRVA 1I6BA 4FBPA 4OXVA 1FBCA 4ELQA 1XHYA 1QUKA 1WVJA 3EQ1A 4DCXA 3TTRA 2RCBA 4F1UA 1US5A 3QXMA 4JXIA 3KBZA 2NWJA 1EZOA 4PBHA 1MQIA 4MLQA 1M5BA 3FBPA 4QF9A 4JVDA 1UTBA 1JVYA 1BK4A 1P99A 1B2HA 4GWXA 2F8DA 5EYFA 3VVFA 5AA1A 3RYAA 3Q27A 3DRGA 1N04A 3H6UA 3UGWA 2P2AA 4WEPA 4DXCA 2FNCA 3PMXA 3JV9A 2ANJA 2GQ1A 1RDYA 1MQDA 4NF8A 4G68A 1NNPA 1IXCA 2QS3A 1NV5A 1MXWA 4PP0A 4ONYA 1D3KA 3PMWA 1B46A 3PD9A 3B6TA 3H6VA 3KN3A 2QS4A 4XKQA 1XC1A 5DYHA 3VV5A 2XX7A 4RXLA 3LSXA 1B4ZA 1FRPA 4F39A 4DIGA 3H4ZA 2VPOA 2Z8DA 4NF6A 4G8HA 5ITOA 4PC9A 4JSDA 2Z22A 1M5CA 4GXSB 1ANFA 3TCGA 3TTLA 5CMMA 3T9VA 5I57A 4RYAA 3MP8A 4QHQA 1P1WA 5ELVA 3O29A 3RTFB 3FVNA 5EYHA 4NAPA 4NWCA 3OEKA 4FATA 4X48A 1LAFE 4I40A 3H3GA 4HXVA 4TQUQ 3KC1A 4PETA 5AA4A 1B0HA 3OENA 4GWSA 1UQWA 1QUJA 4DCYA 4IR8A 1LFIA 1NV7A 3K1NA 3O28A 2ZNTA 4BDMA 1VFEA 3QSLA 3K6UA 4BDRA 1VR5A 1URSA 5I2KB 2QL3A 2XA5A 2F97A 4GX6A 4N6KA 1N0TA 3FJGA 1VE4A 4BLAA 3KSJA 1FTOA 3E4RA 3PV0E 1B51A 4PFUA 4LZ7A 4XTCQ 1B1HA 4IY5A 4EF2A 1N3XA 4ZEBA 3FD3A 2UVGA 1EZPA 3BBRA 4OESA 1DK4A 4JWXA 4U1OA 1ZJLA 4NMYA 1Y4TA 4N15A 4TOZA 3U72A 2Y7RA 5DTBA 3PUYE 2Q2CA 3A29A 2B65A 3TDJA 1FBDA 4XKRA 3QYTA 3FV2A 1B5JA 3G3HA 3M3LA 4JSOA 2CZLA 4PAFA 3IX1A 4G2ZA 4UA8A 1US4A 4HCWA 4MBPA 4MF3A 5DW8A 1LSTA 1FJ9A 3MSTA 4NHBA 4O3BA 3K6VA 4GQOA 4BDOA 1IMBA 1SQYA 1PB8A 3UP9A 4H8JA 4GWOA 3OO8A 4QSEA 1A55A 3IJOB 4QSDA 5DVJA 5DEXB 3R6UA 4YB6A 1B3EA 1NH8A 2PT2A 2WYKA 3U1OA 2F5XA 1IXGA 3KN7A 4LUBA 5EYGA 5JTYA 4G4PA 4F3SA 1YAEA 2HXWA 1PB9A 4LQ5A 2Z8EA 3OD7A 3CG1A 3MP1A 1EZ9A 2DS9A 5H8FA 4U1ZA 3O66A 3EPEA 2XD2A 1RDXA 3I5OA 1USYH 2F3BA 3MAMA 4GWUA 5I2NB 4OYVA 4ND9A 5AA3A 2OWSA 1A99A 2HQ0A 4QFOA 3ONMA 3C9HA 4R6KA 1MY3A 2O7IA 1B7HA 1D9VA 2H98A 4X1DA 3H7MA 2Z8FA 4MJOA 5I3SA 2XXQA 3UK4A 2G29A 1QJMA 1G0IA 3PD8A 1YYZA 2R71A 5CI5A 4P47A 3IB1A 2HAUA 5BUUA 1VDWA 5IZ3A 3HSTA 3TTMA 5EHSA 1UTHB 4ZEDA 2RC8A 1YZ0A 1LBCA 2I0CA 3JZJA 3PUVE 3D4CA 2OBGA 3B7DA 4PDDA 2HHMA 5I84A 2V84A 4LONB 5H8QA 1NL5A 2VD3A 4NN3A 1DBZA 3PPOA 3SEUA 4G8NA 1B3LA 4P9KA 1B9JA 1B3FA 4Q30B 4O3CA 2VP1A 2VPNA 2ZZVA 4YKJA 5I5PA 2HCAA 4R2BA 4QRZA 3T22A 4QFNA 1MDP1 1LAGE 2F34A 3LV0A 5KDTA 1B5IA 5K2XA 4JVCA 1LB8A 4H5GA 3DELB 4OENA 3LSFB 3FUZA 3CFZA 4E0WA 4DXBA 1RKMA 1D9YA 3G3JA 3MYUA 3PPQA 2QFLA 1R9LA 2DQVA 3DRKA 2Y7KA 4LZ8A 1Y9UA 3KZGA 3BIGA 3I3VA 1OQGA 2REGA 5AA2A 2Q8MA 1MM7A 1SW2A 1HSJA 4PE5B 4G77A 2BJJX 3H6TA 4HCYA 4NF5B 2O1LA 1CB6A 4F3GA 4RY1A 3O2AA 3T96B 1OVBA 4HE2A 3O97A 4OMBA 1B4HA 4GFRA 3ODBA 2FYIA 3HN0A 4ZZAA 4P56A 4OVPA 3DLNA 1BKAA 1NUWA 3K6WA 4NE4A 4HE0A 3UORA 1NV3A 3E3KA 4YKPA 1FTMA 1LCTA 4P0GA 5CBRA 1POY1 4PDHA 2B3BA 3E78A 4ECFA 1MDQA 4LP2B 4MH5A 2B3FA 2PCRA 2FIXA 2V3UA 4P3LA 4KXPA 4IO6A 4UACA 3DRIA 1CNQA 1NMUA 2H4IA 1EYJA 3IOVA 4Q0CA 2YPNA 4NF4A 5FTHA 4O7IA 1WODA 2O51A 1XS5A 5A5LA 2VOZA 3S9MC 4IO3A 4RPOA 2CMOA 4H0WA 3N5LA 4JBZA 3IK6B 3MWBA 4XKPA 4I3EA 1UTBB 2OJTA 4N91A 4ZEFA 4F1VA 5ET6A 3P7IA 3G3IA 1LFHA 3W9VA 4GX4A 4EQ9A 3IFAA 4YAHX 3M3FA 4FJPA 2XXXA 3GLBA 5L9SA 5LDZA 1GVCA 1B52A 4G68B 4FORA 3KJ7A 4N8GA 2DE2A 1FQDA 2HFBA 1SI0A 1J1NA 4OZ9A 1LGBC 4RJZA 2CZKA 3MZ9A 2YJPA 1Y3QA 2Y7WA 2WOKA 3GBBA 4BDLA 4L17A 2F6PA 4POWA 1NNFA 1MXYA 4FIMA 1IXHA 3ZKLA 1YCJA 1BP5A 3MVYA 1H43A 4K3FA 4NF6B 4YKIA 5TP9A 4EQ7A 4KCDA 3E9XA 3KC0A 2QRYA 1QULA 5I57B 3CHGA 3OOAA 5IAIA 1T0KA 2WYPA 1XT8A 3QK6A 3V89B 2D21A 2OCUA 2NUVA 1SBPA 1Y1ZA 4LVQA 2WOLA 5J16A 1Z7NE 5F1QA 5BWJA 2HZLA 5AA4B 2KQZA 1SYHA 3SEXA 1NV6A 1SW5A 2X26A 4I9DA 1RYXA 4M4GA 1FBPA 4F22A 3SETA 3OSRA 4F2OA 4OHNA 2FVZA 1DTGA 1ZIUA 1FPJA 3RT8A 1MY4A 3MP6A 3S9LC 2ZZXA 3L6HA 3SERA 1URDA 4OFLA 4DXUA 3T93B 3ISPA 2XXHA 4IO2A 2V3TA 4GL0A 2NXOA 3SKPA 3Q28A 4U21A 2XXWA 4ELOA 3G7WA 3N6TA 2WX9A 5B7DA 4PAIA 2W7YA 3EF7A 4I8CA 4X9TA 2WEFA 3KEIA 2ZXTA 2PVUA 1B1XA 2WBBA 3ILUB 3K4UA 5B70A 3LBSA 3C31A 1A8EA 3C34A 3KN8A 4IY6A 1JVXA 4FEBA 4LA9A 4N13A 1Y3PA 3S9EA 1FQEA 5TPAA 2OWTA 3O9PA 3TTNA 3L6GA 1MRPA 1AWBA 3QIMA 3ROJA 4P0IA 1H3DA 4N6DA 1GR2A 2E0SA 2XXKA 1PB7A 2D3IA 2F6GA 3DRFA 3MW0A 2AL5A 1JW4A 4GXAA 2G93A 3PUZE 2X7PA 5ET8A 3IO4A 2ESNA 2UYFA 5ESYA 4YKKA 5F7VA 1GTKA 2THIA 2MKZA 3DRJA 2IA4A 3MVXA 1ZKBA 1VFDA 5JTYB 2CZHA 1DCUA 3MBPA 3MJNA 2QS1A 1QW0A 1I6QA 4TLMB 4DI4B 2O7UA 4XEQA 3LSWA 3RPWA 4O7MA 3IO6A 4HTGA 1LCFA 3RYBA 3T9HB 4UABA 3RNNA 5FBPA 5ISUA 2PYYA 3TMGA 1IZ1A 1FPIA 1DPEA 1JW1A 5H8FB 4OVQA 1L5TA 1I6AA 1GV8A 1R6ZA 1S9TA 3IB0A 2XX9A 2AIXA 4GX3A 1FPFA 5IZZA 4YMAA 3H6WA 3B6QA 4FECA 2UYEA 1XOCA 2NOOA 2O84X 4PGPA 1DOTA 1MXUA 3C36A 4F2QA 1PC3A 2O6AA 3RLFE 3PGFA 1LFGA 4LATA 1DTZA 2BJIA 1LBXA 3K2DA 4ZDMA 4ZS9A 1SW1A 2I4BA 4ELPA 3TZAA 1HSEA 4QFKA 3FXBA 4YB7A 5FHNA 2XXPA 5ITPA 1YPNA 3RY3A 3VXBA 5H8SA 2HXRA 3NOHA 5EQ8A 4IGRA 1EU8A 4MEVA 2I3WA 3TCHA 2R9JA 3TKDA 5H8QB 1B6HA 4ZE9A 1VSOA 2PX1A 2A5TA 4NWDA 3GBAA 1OLAA 4OFJA 3IJXB 1LB9A 2I58A 3IOWA 3K02A 3Q25A 2ZYNA 3PTYA 4OETA 3W15C 3SESA 1IITA 4DLDA 1NUZA 4IGTA 4KYDA 4DZ1A 4U4XA 1KZ8A 4F29A 4KR5A 2DWHA 2F3DA 3A09A 5KDTB 4PBQA 3HPIA 3MUQA 2JJKA 3RGYA 2O69A 2QMWA 3IL1B 4R2FA 2XXUA 4PCDA 1MY0A 2I3VA 1MPDA 3K1MA 1LAHE 3QUFA 3SEVA 1O63A 1N7WA 3ILTB 2B4MA 1LBVA 4IO4A 4LZ5A 3MVWA 1FPGA 3PPPA 1IUDA 4YB5A 2P1SA 5AA2B 4KCCA 3V8XB 1B5HA 5T3JA 3USDA 3A3UA 3RPLA 2ZYOA 1B7UA 4EDPA 2YLNA 1FQFA 3OO7A 1UIUA 3W9WA 2H25A 3K6XA 3BKIB 3TPAA 1MY2A 2V4CA 2QSXA 1M5FA 4OERA 1A54A 1FPBA 1MH4A 4G8MA 3S9NC 4NX1A 1NNKA 3TFLA 3VVDA 1EYKA 4G68C 1Q1KA 1ZBMA 4P11A 4H65A 1MY1A 1FJ6A 4EQBA 5CM6A 2UVJA 4ZEIA 4JWOA 1BTJA 1MXVA 1G0HA 4BDNA 1BLFA 1NUXA 2ONRA 4BDQA 1N76A 5K2YA 2M8CA 1OMPA 5I7IA 4IO7A 4PFRA 3SEWA 1QKBA 2FA7A 1CE2A 4EXKA 1TFAA 4F3PA 1ZU0A 3HCQA 4LN5A 4OA4A 4R9GA 3THIA 2RCAA 1EH3A 3O6HA 1IQ7A 4ELRA 4PGNA 3BFTA 4PFWA 4DE8A 4MCOA 2WOPA 5CMCA 2PBWA 3CSGA 2ALUA 2DXYA 2AYSA 2Y5LA 3U94A 5I56A 1LAXA 5I2NA 3K0VA 1PBPA 3RUMA 5LOMA 3VDFA 1FPEA 3JYRA 1HSLA 2Z23A 4XF5A 3TQWA 1PDAA 3KOSA 3OELA 4JWYA 3CG3A 4AS5A 5KCJA 1SDXA 4XXUA 4RA1A 1SYIA 5HBCA 3O6GA 5L8DA 1KA0A 2XWOA 2P0SA 3FV1A 3N26A 1LLSA 3H03A 2A5SA 3ZKKA 3UA8A 1B3HA 3BIHA 2OWZA 4N81A 1N3WA 3O6IA 2GFEA 2PMSA 5FTIA 3UIFA 1AH5A 4R6HA 1EYIA 1LEVA 3MVZA 5I58B 2OZZA 3KJTA 1DPPA 5H8NA 1MG1A 3EHUA 1FCKA 3Q29A
chains in the Genus database with same CATH topology
2DSFA 2H99A 5TP9B 2RKMA 5H8HA 4Z7EA 1MS7A 3U8QA 4AQ4A 1H45A 1JNFA 2E1SA 2XXYA 2F36A 3MC2A 2Q8JA 4OEUA 3N6UA 3CR9A 1Y4CA 4KHZE 3VXCA 4KYSA 3TELA 3K01A 5L9OA 3UN6A 1XVYA 2QMXA 1ATGA 1MPCA 3TAJA 4C0RA 1FTKA 1H76A 2V25A 2XXTA 4YU0A 2Y7IA 3KG2A 3TEPA 3MPKA 3G3FA 4ZECA 4NF8B 4C1UA 3PUWE 4Q5TA 1TXFA 2XD3A 3G3GA 1AOVA 4GVOA 4NF5A 4RK9A 5J1DA 4I1DA 3ZS6A 2DE4A 3KFMA 3LSLA 1SVXB 3VLWA 3VFJA 4NTLA 1MQHA 1WDNA 4OQOA 1ELJA 2UVHA 3PU5A 3LR1A 4R75A 2DP8A 1JEVA 4XIGQ 3RN8A 1ZTYA 1A7LA 4U23A 1P1QA 4YICA 4WKMA 4ZEKA 4R73A 4LQ2A 3T9XB 2ZYMA 1IXIA 4R9FA 4F3BA 1O64A 2O1MA 2HEUA 2H9BA 1NNTA 3CVGA 1M5DA 5L9MA 4DDDA 3TODA 3CSBA 5CBSA 1FW0A 1UIVA 3DP8A 2VHAA 3U93A 2HAVA 4QFPA 2HZKA 1QVSA 4I62A 5I59A 2ZNUA 4H8IA 4C1TA 1FQAA 3MZ1A 3H06B 3N94A 4O3AA 2Y7PA 4H1XA 1MH3A 3S2VA 1ZMGA 4ZZEA 4KYEA 5A5XA 1IEJA 2ONKE 3HHFA 4E0XA 1P1UA 3FJ7A 1F9BA 3FXQA 3HV1A 4KFQA 1OVTA 4MFIA 1DMBA 2OLBA 4RK2A 1SW4A 1ZLQA 2RF1A 4F31B 5TU0A 1FQCA 3VLUA 2DXRA 4WXJA 2Q2AA 4EUOA 2ONSA 4OVJA 3CFXA 2O68A 1AL3A 3WAFA 4PFTA 1URGA 2DWJA 3FASA 3O6PA 4QSCA 1NKXA 3G3KA 1MQJA 4HW8A 2DWAA 2DVCA 1FTJA 2REJA 1A8FA 3FVGA 4PQJA 2A5TB 3F11A 1LBBA 2IEEA 4Z0IA 1NH7A 1NFTA 1B0LA 5DT6A 1JEUA 4N6PA 3V5AA 2H5YA 4GF8A 4OEVA 3BFUA 2V3QA 5ICQA 1II5A 5IKBA 2NVUB 1B40A 1O7TA 2F35A 3T66A 3C35A 4FEDA 1R1NA 2DVZA 3FVKA 2I49A 5M2VA 4FE8A 5FHOA 3FZVA 3WAEA 4AB5A 1KWHA 3ZSFA 3ECRA 2B4LA 4IO5A 2F7CA 1OIBA 2I4CA 2ZMBA 4R6YA 4EF1A 3GZGA 4XKNA 4YZZA 3K1PA 3EHTA 3FJMA 4IB2A 1MQGA 4M1VA 1OQHA 4ZE8A 4H67A 4GLIA 1TFDA 1JETA 4OFOA 1MXZA 3CRBA 2AL4A 3MZBA 4N07A 3TQLA 4R74A 5I2KA 2Q89A 4GRKA 2F7AA 1GGGA 4FAJA 3B6WA 3IR1A 2LAOA 2I6EA 2D5WA 2F78A 1PBQA 5ICTA 4U2RA 1YTVA 3VVEA 3AXFA 1TT1A 4F19A 2GH9A 3C32A 3OO9A 1AMFA 4GD5A 1Q35A 5DVFA 5I56B 2DE3A 1MM6A 3FXRA 4THIA 1B3GA 4GOTA 3V83A 3VLVA 2UVIA 5KCJB 2ABHA 3MQ9A 1USYE 3KBRA 4X1BA 4ESXA 3KGCA 2RC7A 3TCFA 2Q88A 4F18A 5DVIA 1SI1A 3R7XA 5CMKA 3IB2A 1IIWA 5DEXA 4MLVA 5JK4A 4QFLA 3HHGA 1QKAA 2Q9TA 4KD5A 2PT1A 5H8NB 3T9UA 2RC9A 3TUSA 1A40A 3FVOA 4JB7A 4KPTA 5H8HB 1S7YA 1Z7ME 5JEIA 3Q26A 4PFYA 4NF4B 4YMBA 5EHMA 5CMBA 3IOTA 1P1OA 1B58A 3DRHA 3D4GA 3TTKA 4EXLA 3M3KA 3DP6A 3PPNA 5FHMA 2ZNSA 1I69A 3K00A 2VD2A 3CFLA 3RT6B 2XXIA 3KSXA 3DP4A 3OSQA 2GHAA 4R72A 1OLCA 3C33A 3CIJA 1B32A 3SEYA 2VGQA 1D4NA 3PAMA 2QPQA 2I48A 1S50A 2KLFA 3C4MA 2UXAA 4U4SA 2DWIA 3OO6A 2R6GE 3RTWB 1POTA 4ESWA 4POXA 3IAZA 2V93A 1R9QA 1UTHA 1BIYA 2OK2A 1M5EA 2XHDA 5HPQA 4H6DA 3EHSA 3TYHA 1AIVA 3A3CA 3IORA 3EN3A 4JDFA 3R26A 3RQTA 4GL8A 5AE4A 1JQFA 1SD3A 1P1NA 2GHBA 4H5FA 1PEBA 2QS2A 1MPBA 4RPNA 3S4UA 3I6VA 1Y1MA 3VE1B 2X7QA 1N7XA 2Y84A 5AA2D 4HS7A 3FATA 1QUIA 1XVXA 5CRYA 3QUJA 1Y3NA 3QAXA 3U92A 2DOJA 5I59B 3FIRA 3PMVA 3OMBA 3M8UA 4ISUA 4RNSA 3HO7A 3IOUA 2QJEA 4TLLB 4KQPA 1DSNA 3OXNA 3LVUA 1FTLA 3MPLA 1JW5A 5KZTA 2ZYKA 1MXXA 2RINA 1FQBA 4WEDA 4NEDA 3CI8A 1N84A 5A5XB 3OEMA 4Q8RA 2XXVA 3FGSA 4KI0E 3E13X 2F7BA 5HM4B 2WKYA 1B7ZA 4OWDA 5TPAB 4AB6A 1Y20A 4U22A 3LUYA 5I58A 1RYOA 3FTOA 3PPRA 3FXUA 1TWYA 3GXAA 4GIZA 3KOTA 2I0BA 3SDFA 1H44A 1B05A 2XXRA 2DYXA 3PUXE 5CC2A 4OTEA 2XX8A 3LC8A 4F1YA 3DM0A 2GRVA 1I6BA 4OXVA 4ELQA 1XHYA 1QUKA 1WVJA 3EQ1A 4DCXA 3TTRA 2RCBA 4F1UA 1US5A 3QXMA 4JXIA 2NWJA 1EZOA 1MQIA 4MLQA 1M5BA 4QF9A 1UTBA 1JVYA 1P99A 1B2HA 2F8DA 5EYFA 3VVFA 5AA1A 3RYAA 3Q27A 3DRGA 1N04A 3H6UA 3UGWA 2P2AA 4WEPA 4DXCA 2FNCA 3PMXA 3JV9A 2ANJA 1MQDA 4NF8A 4G68A 1NNPA 1IXCA 2QS3A 1MXWA 4PP0A 4ONYA 1D3KA 3PMWA 1B46A 3PD9A 3B6TA 3H6VA 3KN3A 2QS4A 4XKQA 1XC1A 5DYHA 3VV5A 2XX7A 4RXLA 3LSXA 1B4ZA 4F39A 4DIGA 3H4ZA 2Z8DA 4NF6A 4G8HA 5ITOA 4JSDA 2Z22A 1M5CA 4GXSB 1ANFA 3TCGA 3TTLA 5CMMA 3T9VA 5I57A 4RYAA 3MP8A 4QHQA 1P1WA 5ELVA 3O29A 3RTFB 3FVNA 4NWCA 3OEKA 4FATA 4X48A 1LAFE 3H3GA 4TQUQ 4PETA 5AA4A 1B0HA 3OENA 1UQWA 1QUJA 4DCYA 1LFIA 3K1NA 3O28A 2ZNTA 4BDMA 1VFEA 3QSLA 3K6UA 4BDRA 1VR5A 1URSA 5I2KB 2QL3A 2F97A 1N0TA 3FJGA 1VE4A 4BLAA 3KSJA 1FTOA 3E4RA 3PV0E 1B51A 4PFUA 4LZ7A 4XTCQ 1B1HA 4IY5A 4EF2A 1N3XA 4ZEBA 3FD3A 2UVGA 1EZPA 3BBRA 4OESA 4JWXA 4U1OA 1ZJLA 4NMYA 1Y4TA 4TOZA 3U72A 2Y7RA 5DTBA 3PUYE 2Q2CA 2B65A 3TDJA 4XKRA 3QYTA 3FV2A 1B5JA 3G3HA 3M3LA 4JSOA 2CZLA 3IX1A 4G2ZA 4UA8A 1US4A 4HCWA 4MBPA 4MF3A 1LSTA 4O3BA 3K6VA 4GQOA 4BDOA 1SQYA 1PB8A 3UP9A 4H8JA 4GWOA 3OO8A 4QSEA 1A55A 3IJOB 4QSDA 5DVJA 5DEXB 3R6UA 4YB6A 1B3EA 1NH8A 2PT2A 3U1OA 2F5XA 1IXGA 3KN7A 4LUBA 5JTYA 4G4PA 4F3SA 1YAEA 2HXWA 1PB9A 4LQ5A 2Z8EA 3OD7A 3CG1A 3MP1A 1EZ9A 2DS9A 5H8FA 4U1ZA 3O66A 3EPEA 2XD2A 3I5OA 1USYH 3MAMA 5I2NB 4OYVA 4ND9A 5AA3A 2OWSA 1A99A 2HQ0A 4QFOA 3ONMA 3C9HA 4R6KA 1MY3A 2O7IA 1B7HA 1D9VA 2H98A 4X1DA 3H7MA 2Z8FA 2XXQA 3UK4A 2G29A 1QJMA 3PD8A 2R71A 5CI5A 3IB1A 2HAUA 5BUUA 3HSTA 3TTMA 5EHSA 1UTHB 4ZEDA 2RC8A 1LBCA 2I0CA 3JZJA 3PUVE 3D4CA 2OBGA 3B7DA 5I84A 2V84A 4LONB 5H8QA 1NL5A 2VD3A 3PPOA 3SEUA 4G8NA 1B3LA 1B9JA 1B3FA 4Q30B 4O3CA 2VP1A 4YKJA 2HCAA 4R2BA 4QRZA 3T22A 4QFNA 1MDP1 1LAGE 2F34A 5KDTA 1B5IA 5K2XA 1LB8A 4H5GA 3DELB 4OENA 3LSFB 3FUZA 3CFZA 4E0WA 4DXBA 1RKMA 1D9YA 3G3JA 3PPQA 1R9LA 2DQVA 3DRKA 2Y7KA 4LZ8A 1Y9UA 3KZGA 3I3VA 1OQGA 2REGA 5AA2A 1MM7A 1SW2A 1HSJA 4PE5B 4G77A 2BJJX 3H6TA 4HCYA 4NF5B 2O1LA 1CB6A 4F3GA 4RY1A 3O2AA 3T96B 1OVBA 3O97A 4OMBA 1B4HA 4GFRA 3ODBA 2FYIA 3HN0A 4ZZAA 3DLNA 1BKAA 3K6WA 4NE4A 3UORA 3E3KA 4YKPA 1FTMA 1LCTA 4P0GA 5CBRA 1POY1 2B3BA 4ECFA 1MDQA 4LP2B 4MH5A 2B3FA 2V3UA 4IO6A 4UACA 3DRIA 1NMUA 2H4IA 3IOVA 4Q0CA 2YPNA 4NF4A 5FTHA 1WODA 2O51A 1XS5A 2VOZA 3S9MC 4IO3A 4RPOA 2CMOA 4H0WA 3N5LA 4JBZA 3IK6B 3MWBA 4XKPA 1UTBB 2OJTA 4ZEFA 4F1VA 3P7IA 3G3IA 1LFHA 3W9VA 4EQ9A 4YAHX 3M3FA 4FJPA 2XXXA 3GLBA 5L9SA 1GVCA 1B52A 4G68B 4FORA 3KJ7A 2DE2A 1FQDA 2HFBA 1SI0A 1J1NA 4OZ9A 1LGBC 4RJZA 3MZ9A 2YJPA 1Y3QA 2Y7WA 2WOKA 3GBBA 4BDLA 4L17A 2F6PA 4POWA 1NNFA 1MXYA 4FIMA 1IXHA 3ZKLA 1YCJA 1BP5A 3MVYA 1H43A 4K3FA 4NF6B 4YKIA 5TP9A 4EQ7A 4KCDA 3E9XA 2QRYA 1QULA 5I57B 3CHGA 3OOAA 5IAIA 1T0KA 1XT8A 3QK6A 3V89B 2D21A 2OCUA 2NUVA 1SBPA 1Y1ZA 4LVQA 2WOLA 1Z7NE 5F1QA 5BWJA 2HZLA 5AA4B 1SYHA 3SEXA 1SW5A 2X26A 4I9DA 1RYXA 4M4GA 4F22A 3SETA 3OSRA 4F2OA 4OHNA 1DTGA 1ZIUA 3RT8A 1MY4A 3MP6A 3S9LC 3L6HA 3SERA 1URDA 4OFLA 4DXUA 3T93B 2XXHA 4IO2A 2V3TA 4GL0A 2NXOA 3SKPA 3Q28A 4U21A 2XXWA 4ELOA 3G7WA 3N6TA 5B7DA 2W7YA 3EF7A 4I8CA 4X9TA 3KEIA 2ZXTA 2PVUA 1B1XA 3ILUB 3K4UA 5B70A 3LBSA 3C31A 1A8EA 3C34A 3KN8A 4IY6A 1JVXA 4FEBA 4LA9A 4N13A 1Y3PA 3S9EA 1FQEA 5TPAA 2OWTA 3O9PA 3TTNA 3L6GA 1MRPA 3QIMA 4P0IA 1H3DA 1GR2A 2E0SA 1PB7A 2D3IA 2F6GA 3DRFA 3MW0A 2AL5A 1JW4A 4GXAA 2G93A 3PUZE 2X7PA 3IO4A 2ESNA 2UYFA 4YKKA 5F7VA 1GTKA 2THIA 3DRJA 2IA4A 3MVXA 1ZKBA 1VFDA 5JTYB 3MBPA 3MJNA 2QS1A 1QW0A 1I6QA 4TLMB 2O7UA 3LSWA 3RPWA 3IO6A 4HTGA 1LCFA 3RYBA 3T9HB 3RNNA 5ISUA 2PYYA 3TMGA 1IZ1A 1DPEA 1JW1A 5H8FB 1L5TA 1I6AA 1GV8A 1R6ZA 1S9TA 3IB0A 2XX9A 2AIXA 4YMAA 3H6WA 3B6QA 4FECA 2UYEA 1XOCA 2NOOA 2O84X 1DOTA 1MXUA 3C36A 4F2QA 1PC3A 2O6AA 3RLFE 3PGFA 1LFGA 4LATA 1DTZA 4ZDMA 3K2DA 4ZS9A 1SW1A 2I4BA 4ELPA 3TZAA 1HSEA 4QFKA 4YB7A 5FHNA 2XXPA 5ITPA 1YPNA 3RY3A 3VXBA 5H8SA 4IGRA 1EU8A 2I3WA 3TCHA 2R9JA 3TKDA 5H8QB 1B6HA 4ZE9A 1VSOA 2PX1A 2A5TA 4NWDA 3GBAA 1OLAA 4OFJA 3IJXB 1LB9A 2I58A 3IOWA 3K02A 3Q25A 2ZYNA 4OETA 3W15C 3SESA 1IITA 4DLDA 4DZ1A 4IGTA 4KYDA 4U4XA 4F29A 4KR5A 2DWHA 3A09A 5KDTB 3HPIA 3MUQA 3RGYA 2O69A 2QMWA 3IL1B 4R2FA 2XXUA 1MY0A 2I3VA 1MPDA 3K1MA 1LAHE 3QUFA 3SEVA 1O63A 1N7WA 3ILTB 2B4MA 4IO4A 4LZ5A 3MVWA 3PPPA 1IUDA 4YB5A 2P1SA 5AA2B 4KCCA 3V8XB 1B5HA 3USDA 3A3UA 2ZYOA 1B7UA 4EDPA 2YLNA 1FQFA 3OO7A 1UIUA 3W9WA 2H25A 3K6XA 3BKIB 3TPAA 1MY2A 2QSXA 1M5FA 4OERA 1A54A 1MH4A 4G8MA 3S9NC 1NNKA 3TFLA 3VVDA 4G68C 1Q1KA 1ZBMA 4P11A 4H65A 1MY1A 4EQBA 5CM6A 2UVJA 4ZEIA 4JWOA 1BTJA 1MXVA 4BDNA 1BLFA 2ONRA 4BDQA 1N76A 5K2YA 2M8CA 1OMPA 4IO7A 3SEWA 1QKBA 2FA7A 1CE2A 4EXKA 1TFAA 4F3PA 1ZU0A 3HCQA 4R9GA 3THIA 2RCAA 1EH3A 3O6HA 1IQ7A 4ELRA 3BFTA 4PFWA 4DE8A 2WOPA 5CMCA 2PBWA 3CSGA 2ALUA 2DXYA 2AYSA 3U94A 5I56A 1LAXA 5I2NA 3K0VA 1PBPA 3RUMA 5LOMA 3VDFA 3JYRA 1HSLA 2Z23A 3TQWA 1PDAA 3KOSA 3OELA 4JWYA 3CG3A 5KCJA 1SDXA 4XXUA 4RA1A 1SYIA 5HBCA 3O6GA 5L8DA 2P0SA 3FV1A 3N26A 1LLSA 3H03A 2A5SA 3ZKKA 3UA8A 1B3HA 1N3WA 3O6IA 2GFEA 2PMSA 5FTIA 3UIFA 1AH5A 4R6HA 3MVZA 5I58B 2OZZA 3KJTA 1DPPA 5H8NA 1MG1A 3EHUA 1FCKA 3Q29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSF A;  2H99 A;  5TP9 B;  2RKM A;  5H8H A;  4Z7E A;  1MS7 A;  3U8Q A;  4AQ4 A;  1H45 A;  1JNF A;  2E1S A;  2XXY A;  2F36 A;  3MC2 A;  2Q8J A;  4OEU A;  3N6U A;  3CR9 A;  1Y4C A;  4KHZ E;  3VXC A;  4KYS A;  3TEL A;  3K01 A;  5L9O A;  3UN6 A;  1XVY A;  2QMX A;  1ATG A;  1MPC A;  3TAJ A;  4C0R A;  1FTK A;  1H76 A;  2V25 A;  2XXT A;  4YU0 A;  2Y7I A;  3KG2 A;  3TEP A;  3MPK A;  3G3F A;  4ZEC A;  4NF8 B;  4C1U A;  3PUW E;  4Q5T A;  1TXF A;  2XD3 A;  3G3G A;  1AOV A;  4GVO A;  4NF5 A;  4RK9 A;  5J1D A;  4I1D A;  3ZS6 A;  2DE4 A;  3KFM A;  3LSL A;  1SVX B;  3VLW A;  3VFJ A;  4NTL A;  1MQH A;  1WDN A;  4OQO A;  1ELJ A;  2UVH A;  3PU5 A;  3LR1 A;  4R75 A;  2DP8 A;  1JEV A;  4XIG Q;  3RN8 A;  1ZTY A;  1A7L A;  4U23 A;  1P1Q A;  4YIC A;  4WKM A;  4ZEK A;  4R73 A;  4LQ2 A;  3T9X B;  2ZYM A;  1IXI A;  4R9F A;  4F3B A;  1O64 A;  2O1M A;  2HEU A;  2H9B A;  1NNT A;  3CVG A;  1M5D A;  5L9M A;  4DDD A;  3TOD A;  3CSB A;  5CBS A;  1FW0 A;  1UIV A;  3DP8 A;  2VHA A;  3U93 A;  2HAV A;  4QFP A;  2HZK A;  1QVS A;  4I62 A;  5I59 A;  2ZNU A;  4H8I A;  4C1T A;  1FQA A;  3MZ1 A;  3H06 B;  3N94 A;  4O3A A;  2Y7P A;  4H1X A;  1MH3 A;  3S2V A;  1ZMG A;  4ZZE A;  4KYE A;  5A5X A;  1IEJ A;  2ONK E;  3HHF A;  4E0X A;  1P1U A;  3FJ7 A;  1F9B A;  3FXQ A;  3HV1 A;  4KFQ A;  1OVT A;  4MFI A;  1DMB A;  2OLB A;  4RK2 A;  1SW4 A;  1ZLQ A;  2RF1 A;  4F31 B;  5TU0 A;  1FQC A;  3VLU A;  2DXR A;  4WXJ A;  2Q2A A;  4EUO A;  2ONS A;  4OVJ A;  3CFX A;  2O68 A;  1AL3 A;  3WAF A;  4PFT A;  1URG A;  2DWJ A;  3FAS A;  3O6P A;  4QSC A;  1NKX A;  3G3K A;  1MQJ A;  4HW8 A;  2DWA A;  2DVC A;  1FTJ A;  2REJ A;  1A8F A;  3FVG A;  4PQJ A;  2A5T B;  3F11 A;  1LBB A;  2IEE A;  4Z0I A;  1NH7 A;  1NFT A;  1B0L A;  5DT6 A;  1JEU A;  4N6P A;  3V5A A;  2H5Y A;  4GF8 A;  4OEV A;  3BFU A;  2V3Q A;  5ICQ A;  1II5 A;  5IKB A;  2NVU B;  1B40 A;  1O7T A;  2F35 A;  3T66 A;  3C35 A;  4FED A;  1R1N A;  2DVZ A;  3FVK A;  2I49 A;  5M2V A;  4FE8 A;  5FHO A;  3FZV A;  3WAE A;  4AB5 A;  1KWH A;  3ZSF A;  3ECR A;  2B4L A;  4IO5 A;  2F7C A;  1OIB A;  2I4C A;  2ZMB A;  4R6Y A;  4EF1 A;  3GZG A;  4XKN A;  4YZZ A;  3K1P A;  3EHT A;  3FJM A;  4IB2 A;  1MQG A;  4M1V A;  1OQH A;  4ZE8 A;  4H67 A;  4GLI A;  1TFD A;  1JET A;  4OFO A;  1MXZ A;  3CRB A;  2AL4 A;  3MZB A;  4N07 A;  3TQL A;  4R74 A;  5I2K A;  2Q89 A;  4GRK A;  2F7A A;  1GGG A;  4FAJ A;  3B6W A;  3IR1 A;  2LAO A;  2I6E A;  2D5W A;  2F78 A;  1PBQ A;  5ICT A;  4U2R A;  1YTV A;  3VVE A;  3AXF A;  1TT1 A;  4F19 A;  2GH9 A;  3C32 A;  3OO9 A;  1AMF A;  4GD5 A;  1Q35 A;  5DVF A;  5I56 B;  2DE3 A;  1MM6 A;  3FXR A;  4THI A;  1B3G A;  4GOT A;  3V83 A;  3VLV A;  2UVI A;  5KCJ B;  2ABH A;  3MQ9 A;  1USY E;  3KBR A;  4X1B A;  4ESX A;  3KGC A;  2RC7 A;  3TCF A;  2Q88 A;  4F18 A;  5DVI A;  1SI1 A;  3R7X A;  5CMK A;  3IB2 A;  1IIW A;  5DEX A;  4MLV A;  5JK4 A;  4QFL A;  3HHG A;  1QKA A;  2Q9T A;  4KD5 A;  2PT1 A;  5H8N B;  3T9U A;  2RC9 A;  3TUS A;  1A40 A;  3FVO A;  4JB7 A;  4KPT A;  5H8H B;  1S7Y A;  1Z7M E;  5JEI A;  3Q26 A;  4PFY A;  4NF4 B;  4YMB A;  5EHM A;  5CMB A;  3IOT A;  1P1O A;  1B58 A;  3DRH A;  3D4G A;  3TTK A;  4EXL A;  3M3K A;  3DP6 A;  3PPN A;  5FHM A;  2ZNS A;  1I69 A;  3K00 A;  2VD2 A;  3CFL A;  3RT6 B;  2XXI A;  3KSX A;  3DP4 A;  3OSQ A;  2GHA A;  4R72 A;  1OLC A;  3C33 A;  3CIJ A;  1B32 A;  3SEY A;  2VGQ A;  1D4N A;  3PAM A;  2QPQ A;  2I48 A;  1S50 A;  2KLF A;  3C4M A;  2UXA A;  4U4S A;  2DWI A;  3OO6 A;  2R6G E;  3RTW B;  1POT A;  4ESW A;  4POX A;  3IAZ A;  2V93 A;  1R9Q A;  1UTH A;  1BIY A;  2OK2 A;  1M5E A;  2XHD A;  5HPQ A;  4H6D A;  3EHS A;  3TYH A;  1AIV A;  3A3C A;  3IOR A;  3EN3 A;  4JDF A;  3R26 A;  3RQT A;  4GL8 A;  5AE4 A;  1JQF A;  1SD3 A;  1P1N A;  2GHB A;  4H5F A;  1PEB A;  2QS2 A;  1MPB A;  4RPN A;  3S4U A;  3I6V A;  1Y1M A;  3VE1 B;  2X7Q A;  1N7X A;  2Y84 A;  5AA2 D;  4HS7 A;  3FAT A;  1QUI A;  1XVX A;  5CRY A;  3QUJ A;  1Y3N A;  3QAX A;  3U92 A;  2DOJ A;  5I59 B;  3FIR A;  3PMV A;  3OMB A;  3M8U A;  4ISU A;  4RNS A;  3HO7 A;  3IOU A;  2QJE A;  4TLL B;  4KQP A;  1DSN A;  3OXN A;  3LVU A;  1FTL A;  3MPL A;  1JW5 A;  5KZT A;  2ZYK A;  1MXX A;  2RIN A;  1FQB A;  4WED A;  4NED A;  3CI8 A;  1N84 A;  5A5X B;  3OEM A;  4Q8R A;  2XXV A;  3FGS A;  4KI0 E;  3E13 X;  2F7B A;  5HM4 B;  2WKY A;  1B7Z A;  4OWD A;  5TPA B;  4AB6 A;  1Y20 A;  4U22 A;  3LUY A;  5I58 A;  1RYO A;  3FTO A;  3PPR A;  3FXU A;  1TWY A;  3GXA A;  4GIZ A;  3KOT A;  2I0B A;  3SDF A;  1H44 A;  1B05 A;  2XXR A;  2DYX A;  3PUX E;  5CC2 A;  4OTE A;  2XX8 A;  3LC8 A;  4F1Y A;  3DM0 A;  2GRV A;  1I6B A;  4OXV A;  4ELQ A;  1XHY A;  1QUK A;  1WVJ A;  3EQ1 A;  4DCX A;  3TTR A;  2RCB A;  4F1U A;  1US5 A;  3QXM A;  4JXI A;  2NWJ A;  1EZO A;  1MQI A;  4MLQ A;  1M5B A;  4QF9 A;  1UTB A;  1JVY A;  1P99 A;  1B2H A;  2F8D A;  5EYF A;  3VVF A;  5AA1 A;  3RYA A;  3Q27 A;  3DRG A;  1N04 A;  3H6U A;  3UGW A;  2P2A A;  4WEP A;  4DXC A;  2FNC A;  3PMX A;  3JV9 A;  2ANJ A;  1MQD A;  4NF8 A;  4G68 A;  1NNP A;  1IXC A;  2QS3 A;  1MXW A;  4PP0 A;  4ONY A;  1D3K A;  3PMW A;  1B46 A;  3PD9 A;  3B6T A;  3H6V A;  3KN3 A;  2QS4 A;  4XKQ A;  1XC1 A;  5DYH A;  3VV5 A;  2XX7 A;  4RXL A;  3LSX A;  1B4Z A;  4F39 A;  4DIG A;  3H4Z A;  2Z8D A;  4NF6 A;  4G8H A;  5ITO A;  4JSD A;  2Z22 A;  1M5C A;  4GXS B;  1ANF A;  3TCG A;  3TTL A;  5CMM A;  3T9V A;  5I57 A;  4RYA A;  3MP8 A;  4QHQ A;  1P1W A;  5ELV A;  3O29 A;  3RTF B;  3FVN A;  4NWC A;  3OEK A;  4FAT A;  4X48 A;  1LAF E;  3H3G A;  4TQU Q;  4PET A;  5AA4 A;  1B0H A;  3OEN A;  1UQW A;  1QUJ A;  4DCY A;  1LFI A;  3K1N A;  3O28 A;  2ZNT A;  4BDM A;  1VFE A;  3QSL A;  3K6U A;  4BDR A;  1VR5 A;  1URS A;  5I2K B;  2QL3 A;  2F97 A;  1N0T A;  3FJG A;  1VE4 A;  4BLA A;  3KSJ A;  1FTO A;  3E4R A;  3PV0 E;  1B51 A;  4PFU A;  4LZ7 A;  4XTC Q;  1B1H A;  4IY5 A;  4EF2 A;  1N3X A;  4ZEB A;  3FD3 A;  2UVG A;  1EZP A;  3BBR A;  4OES A;  4JWX A;  4U1O A;  1ZJL A;  4NMY A;  1Y4T A;  4TOZ A;  3U72 A;  2Y7R A;  5DTB A;  3PUY E;  2Q2C A;  2B65 A;  3TDJ A;  4XKR A;  3QYT A;  3FV2 A;  1B5J A;  3G3H A;  3M3L A;  4JSO A;  2CZL A;  3IX1 A;  4G2Z A;  4UA8 A;  1US4 A;  4HCW A;  4MBP A;  4MF3 A;  1LST A;  4O3B A;  3K6V A;  4GQO A;  4BDO A;  1SQY A;  1PB8 A;  3UP9 A;  4H8J A;  4GWO A;  3OO8 A;  4QSE A;  1A55 A;  3IJO B;  4QSD A;  5DVJ A;  5DEX B;  3R6U A;  4YB6 A;  1B3E A;  1NH8 A;  2PT2 A;  3U1O A;  2F5X A;  1IXG A;  3KN7 A;  4LUB A;  5JTY A;  4G4P A;  4F3S A;  1YAE A;  2HXW A;  1PB9 A;  4LQ5 A;  2Z8E A;  3OD7 A;  3CG1 A;  3MP1 A;  1EZ9 A;  2DS9 A;  5H8F A;  4U1Z A;  3O66 A;  3EPE A;  2XD2 A;  3I5O A;  1USY H;  3MAM A;  5I2N B;  4OYV A;  4ND9 A;  5AA3 A;  2OWS A;  1A99 A;  2HQ0 A;  4QFO A;  3ONM A;  3C9H A;  4R6K A;  1MY3 A;  2O7I A;  1B7H A;  1D9V A;  2H98 A;  4X1D A;  3H7M A;  2Z8F A;  2XXQ A;  3UK4 A;  2G29 A;  1QJM A;  3PD8 A;  2R71 A;  5CI5 A;  3IB1 A;  2HAU A;  5BUU A;  3HST A;  3TTM A;  5EHS A;  1UTH B;  4ZED A;  2RC8 A;  1LBC A;  2I0C A;  3JZJ A;  3PUV E;  3D4C A;  2OBG A;  3B7D A;  5I84 A;  2V84 A;  4LON B;  5H8Q A;  1NL5 A;  2VD3 A;  3PPO A;  3SEU A;  4G8N A;  1B3L A;  1B9J A;  1B3F A;  4Q30 B;  4O3C A;  2VP1 A;  4YKJ A;  2HCA A;  4R2B A;  4QRZ A;  3T22 A;  4QFN A;  1MDP 1;  1LAG E;  2F34 A;  5KDT A;  1B5I A;  5K2X A;  1LB8 A;  4H5G A;  3DEL B;  4OEN A;  3LSF B;  3FUZ A;  3CFZ A;  4E0W A;  4DXB A;  1RKM A;  1D9Y A;  3G3J A;  3PPQ A;  1R9L A;  2DQV A;  3DRK A;  2Y7K A;  4LZ8 A;  1Y9U A;  3KZG A;  3I3V A;  1OQG A;  2REG A;  5AA2 A;  1MM7 A;  1SW2 A;  1HSJ A;  4PE5 B;  4G77 A;  2BJJ X;  3H6T A;  4HCY A;  4NF5 B;  2O1L A;  1CB6 A;  4F3G A;  4RY1 A;  3O2A A;  3T96 B;  1OVB A;  3O97 A;  4OMB A;  1B4H A;  4GFR A;  3ODB A;  2FYI A;  3HN0 A;  4ZZA A;  3DLN A;  1BKA A;  3K6W A;  4NE4 A;  3UOR A;  3E3K A;  4YKP A;  1FTM A;  1LCT A;  4P0G A;  5CBR A;  1POY 1;  2B3B A;  4ECF A;  1MDQ A;  4LP2 B;  4MH5 A;  2B3F A;  2V3U A;  4IO6 A;  4UAC A;  3DRI A;  1NMU A;  2H4I A;  3IOV A;  4Q0C A;  2YPN A;  4NF4 A;  5FTH A;  1WOD A;  2O51 A;  1XS5 A;  2VOZ A;  3S9M C;  4IO3 A;  4RPO A;  2CMO A;  4H0W A;  3N5L A;  4JBZ A;  3IK6 B;  3MWB A;  4XKP A;  1UTB B;  2OJT A;  4ZEF A;  4F1V A;  3P7I A;  3G3I A;  1LFH A;  3W9V A;  4EQ9 A;  4YAH X;  3M3F A;  4FJP A;  2XXX A;  3GLB A;  5L9S A;  1GVC A;  1B52 A;  4G68 B;  4FOR A;  3KJ7 A;  2DE2 A;  1FQD A;  2HFB A;  1SI0 A;  1J1N A;  4OZ9 A;  1LGB C;  4RJZ A;  3MZ9 A;  2YJP A;  1Y3Q A;  2Y7W A;  2WOK A;  3GBB A;  4BDL A;  4L17 A;  2F6P A;  4POW A;  1NNF A;  1MXY A;  4FIM A;  1IXH A;  3ZKL A;  1YCJ A;  1BP5 A;  3MVY A;  1H43 A;  4K3F A;  4NF6 B;  4YKI A;  5TP9 A;  4EQ7 A;  4KCD A;  3E9X A;  2QRY A;  1QUL A;  5I57 B;  3CHG A;  3OOA A;  5IAI A;  1T0K A;  1XT8 A;  3QK6 A;  3V89 B;  2D21 A;  2OCU A;  2NUV A;  1SBP A;  1Y1Z A;  4LVQ A;  2WOL A;  1Z7N E;  5F1Q A;  5BWJ A;  2HZL A;  5AA4 B;  1SYH A;  3SEX A;  1SW5 A;  2X26 A;  4I9D A;  1RYX A;  4M4G A;  4F22 A;  3SET A;  3OSR A;  4F2O A;  4OHN A;  1DTG A;  1ZIU A;  3RT8 A;  1MY4 A;  3MP6 A;  3S9L C;  3L6H A;  3SER A;  1URD A;  4OFL A;  4DXU A;  3T93 B;  2XXH A;  4IO2 A;  2V3T A;  4GL0 A;  2NXO A;  3SKP A;  3Q28 A;  4U21 A;  2XXW A;  4ELO A;  3G7W A;  3N6T A;  5B7D A;  2W7Y A;  3EF7 A;  4I8C A;  4X9T A;  3KEI A;  2ZXT A;  2PVU A;  1B1X A;  3ILU B;  3K4U A;  5B70 A;  3LBS A;  3C31 A;  1A8E A;  3C34 A;  3KN8 A;  4IY6 A;  1JVX A;  4FEB A;  4LA9 A;  4N13 A;  1Y3P A;  3S9E A;  1FQE A;  5TPA A;  2OWT A;  3O9P A;  3TTN A;  3L6G A;  1MRP A;  3QIM A;  4P0I A;  1H3D A;  1GR2 A;  2E0S A;  1PB7 A;  2D3I A;  2F6G A;  3DRF A;  3MW0 A;  2AL5 A;  1JW4 A;  4GXA A;  2G93 A;  3PUZ E;  2X7P A;  3IO4 A;  2ESN A;  2UYF A;  4YKK A;  5F7V A;  1GTK A;  2THI A;  3DRJ A;  2IA4 A;  3MVX A;  1ZKB A;  1VFD A;  5JTY B;  3MBP A;  3MJN A;  2QS1 A;  1QW0 A;  1I6Q A;  4TLM B;  2O7U A;  3LSW A;  3RPW A;  3IO6 A;  4HTG A;  1LCF A;  3RYB A;  3T9H B;  3RNN A;  5ISU A;  2PYY A;  3TMG A;  1IZ1 A;  1DPE A;  1JW1 A;  5H8F B;  1L5T A;  1I6A A;  1GV8 A;  1R6Z A;  1S9T A;  3IB0 A;  2XX9 A;  2AIX A;  4YMA A;  3H6W A;  3B6Q A;  4FEC A;  2UYE A;  1XOC A;  2NOO A;  2O84 X;  1DOT A;  1MXU A;  3C36 A;  4F2Q A;  1PC3 A;  2O6A A;  3RLF E;  3PGF A;  1LFG A;  4LAT A;  1DTZ A;  4ZDM A;  3K2D A;  4ZS9 A;  1SW1 A;  2I4B A;  4ELP A;  3TZA A;  1HSE A;  4QFK A;  4YB7 A;  5FHN A;  2XXP A;  5ITP A;  1YPN A;  3RY3 A;  3VXB A;  5H8S A;  4IGR A;  1EU8 A;  2I3W A;  3TCH A;  2R9J A;  3TKD A;  5H8Q B;  1B6H A;  4ZE9 A;  1VSO A;  2PX1 A;  2A5T A;  4NWD A;  3GBA A;  1OLA A;  4OFJ A;  3IJX B;  1LB9 A;  2I58 A;  3IOW A;  3K02 A;  3Q25 A;  2ZYN A;  4OET A;  3W15 C;  3SES A;  1IIT A;  4DLD A;  4DZ1 A;  4IGT A;  4KYD A;  4U4X A;  4F29 A;  4KR5 A;  2DWH A;  3A09 A;  5KDT B;  3HPI A;  3MUQ A;  3RGY A;  2O69 A;  2QMW A;  3IL1 B;  4R2F A;  2XXU A;  1MY0 A;  2I3V A;  1MPD A;  3K1M A;  1LAH E;  3QUF A;  3SEV A;  1O63 A;  1N7W A;  3ILT B;  2B4M A;  4IO4 A;  4LZ5 A;  3MVW A;  3PPP A;  1IUD A;  4YB5 A;  2P1S A;  5AA2 B;  4KCC A;  3V8X B;  1B5H A;  3USD A;  3A3U A;  2ZYO A;  1B7U A;  4EDP A;  2YLN A;  1FQF A;  3OO7 A;  1UIU A;  3W9W A;  2H25 A;  3K6X A;  3BKI B;  3TPA A;  1MY2 A;  2QSX A;  1M5F A;  4OER A;  1A54 A;  1MH4 A;  4G8M A;  3S9N C;  1NNK A;  3TFL A;  3VVD A;  4G68 C;  1Q1K A;  1ZBM A;  4P11 A;  4H65 A;  1MY1 A;  4EQB A;  5CM6 A;  2UVJ A;  4ZEI A;  4JWO A;  1BTJ A;  1MXV A;  4BDN A;  1BLF A;  2ONR A;  4BDQ A;  1N76 A;  5K2Y A;  2M8C A;  1OMP A;  4IO7 A;  3SEW A;  1QKB A;  2FA7 A;  1CE2 A;  4EXK A;  1TFA A;  4F3P A;  1ZU0 A;  3HCQ A;  4R9G A;  3THI A;  2RCA A;  1EH3 A;  3O6H A;  1IQ7 A;  4ELR A;  3BFT A;  4PFW A;  4DE8 A;  2WOP A;  5CMC A;  2PBW A;  3CSG A;  2ALU A;  2DXY A;  2AYS A;  3U94 A;  5I56 A;  1LAX A;  5I2N A;  3K0V A;  1PBP A;  3RUM A;  5LOM A;  3VDF A;  3JYR A;  1HSL A;  2Z23 A;  3TQW A;  1PDA A;  3KOS A;  3OEL A;  4JWY A;  3CG3 A;  5KCJ A;  1SDX A;  4XXU A;  4RA1 A;  1SYI A;  5HBC A;  3O6G A;  5L8D A;  2P0S A;  3FV1 A;  3N26 A;  1LLS A;  3H03 A;  2A5S A;  3ZKK A;  3UA8 A;  1B3H A;  1N3W A;  3O6I A;  2GFE A;  2PMS A;  5FTI A;  3UIF A;  1AH5 A;  4R6H A;  3MVZ A;  5I58 B;  2OZZ A;  3KJT A;  1DPP A;  5H8N A;  1MG1 A;  3EHU A;  1FCK A;  3Q29 A; 
#chains in the Genus database with same CATH topology
 2DSF A;  3RYD A;  2H99 A;  5TP9 B;  2RKM A;  5H8H A;  4Z7E A;  1MS7 A;  4GBW A;  3U8Q A;  4AQ4 A;  1NV4 A;  1H45 A;  1JNF A;  1FPL A;  2E1S A;  2XXY A;  2F36 A;  1SPI A;  3MC2 A;  2Q8J A;  4OEU A;  3N6U A;  3CR9 A;  3SZP A;  1Y4C A;  1XI6 A;  4KHZ E;  3VXC A;  4KYS A;  3TEL A;  4PE3 A;  3K01 A;  5L9O A;  3UN6 A;  1XVY A;  2QMX A;  1ATG A;  1MPC A;  3TAJ A;  4C0R A;  1FTK A;  1H76 A;  2V25 A;  2XXT A;  4YU0 A;  2Y7I A;  3KG2 A;  3TEP A;  4PAK A;  3MPK A;  3G3F A;  4P1E A;  4ZEC A;  4NF8 B;  4C1U A;  2XWI A;  3PUW E;  4Q5T A;  4O94 A;  1TXF A;  2XD3 A;  3G3G A;  1AOV A;  4GVO A;  4NF5 A;  4RK9 A;  5J1D A;  4PFB A;  4I1D A;  3ZS6 A;  2DE4 A;  3KFM A;  3LSL A;  1SVX B;  3VLW A;  3VFJ A;  4NTL A;  4NF0 A;  1MQH A;  1WDN A;  4OQO A;  1ELJ A;  2UVH A;  3PU5 A;  3LR1 A;  4R75 A;  4GWZ A;  2DP8 A;  1JEV A;  4H46 A;  4XIG Q;  3RN8 A;  3EKI A;  1ZTY A;  1A7L A;  4U23 A;  1P1Q A;  4YIC A;  4WKM A;  4ZEK A;  4R73 A;  4LQ2 A;  3T9X B;  2ZYM A;  1IXI A;  1NV0 A;  4PTK A;  4R9F A;  4F3B A;  1O64 A;  3QMF A;  4GWY A;  2O1M A;  2HEU A;  4O8M A;  2H9B A;  1FBF A;  1NNT A;  3CVG A;  4MNP A;  1M5D A;  5L9M A;  4DDD A;  3TOD A;  3CSB A;  5CBS A;  1FW0 A;  2ZZW A;  1UIV A;  3DP8 A;  2VHA A;  3U93 A;  2HAV A;  4QBA A;  4QFP A;  2HZK A;  1NUY A;  1QVS A;  4I62 A;  5I59 A;  2ZNU A;  4H8I A;  4C1T A;  1FQA A;  2L5V A;  3MZ1 A;  3H06 B;  3N94 A;  4O3A A;  2OX3 A;  2Y7P A;  4H1X A;  1YXI A;  1MH3 A;  3S2V A;  2Y5K A;  1ZMG A;  4ZZE A;  4KYE A;  5A5X A;  1IEJ A;  2ONK E;  3HHF A;  4E0X A;  1P1U A;  3FJ7 A;  1F9B A;  3FXQ A;  3HV1 A;  4KFQ A;  1NV1 A;  1OVT A;  1LBZ A;  4MFI A;  1DMB A;  2OLB A;  4RK2 A;  1SW4 A;  1ZLQ A;  2RF1 A;  4F31 B;  5TU0 A;  1FQC A;  1FPK A;  3VLU A;  1Q9D A;  2DXR A;  4WXJ A;  2Q2A A;  2PFZ A;  4EUO A;  2ONS A;  4OVJ A;  3CFX A;  2O68 A;  1IMC A;  1AL3 A;  3WAF A;  4PFT A;  1URG A;  1KA1 A;  5ET7 A;  1FBE A;  2DWJ A;  3FAS A;  3O6P A;  4QSC A;  1NKX A;  3G3K A;  1MQJ A;  4HW8 A;  1INP A;  2DWA A;  2DVC A;  2QVV A;  1FTJ A;  2REJ A;  1A8F A;  3FVG A;  4PQJ A;  2A5T B;  3F11 A;  1LBB A;  2IEE A;  4Z0I A;  1NH7 A;  1NFT A;  1FTA A;  1B0L A;  5DT6 A;  1JEU A;  4NQ8 A;  4N6P A;  3V5A A;  2H5Y A;  4GF8 A;  4OEV A;  1IMA A;  3BFU A;  4X04 A;  2V3Q A;  5ICQ A;  1RDZ A;  1II5 A;  1LBY A;  5IKB A;  2NVU B;  4MX6 A;  1B40 A;  1O7T A;  2F35 A;  3T66 A;  3C35 A;  2KR0 A;  4FED A;  1R1N A;  4MIJ A;  2DVZ A;  3FVK A;  4N17 A;  2I49 A;  5M2V A;  4FE8 A;  5FHO A;  3FZV A;  3WAE A;  5IM2 A;  4AB5 A;  1KWH A;  3ZSF A;  3ECR A;  3E79 A;  2B4L A;  5EQ9 A;  4IO5 A;  4NGU A;  3RPL B;  2F7C A;  1OIB A;  2I4C A;  5LTC A;  2ZMB A;  4MHF A;  4R6Y A;  1FBG A;  5IZ3 B;  4EF1 A;  3GZG A;  4XKN A;  3U65 A;  4YZZ A;  1NV2 A;  1K9Z A;  4MMP A;  3K1P A;  3EHT A;  3FJM A;  4IB2 A;  1MQG A;  4M1V A;  1OQH A;  4ZE8 A;  4JVI A;  4H67 A;  2FHY A;  4GLI A;  1TFD A;  1JET A;  4OFO A;  1MXZ A;  3CRB A;  2AL4 A;  3MZB A;  4N07 A;  3TQL A;  4R74 A;  5I2K A;  3IFC A;  2Q89 A;  4GRK A;  2F7A A;  1GGG A;  4FAJ A;  1IMD A;  3B6W A;  3IR1 A;  2LAO A;  2I6E A;  2D5W A;  2F78 A;  1PBQ A;  5ICT A;  4U2R A;  1FSA A;  1YTV A;  3VVE A;  3AXF A;  4MAG A;  1TT1 A;  4F19 A;  2GH9 A;  3C32 A;  3OO9 A;  2CZI A;  1AMF A;  2VT5 A;  4GD5 A;  1Q35 A;  4NG7 A;  5DVF A;  5I56 B;  2DE3 A;  1IME A;  1MM6 A;  3FXR A;  4THI A;  1B3G A;  4GOT A;  3V83 A;  3VLV A;  2UVI A;  5KCJ B;  2ABH A;  4X8R A;  1IMF A;  3MQ9 A;  2XWK A;  1USY E;  3KBR A;  4X1B A;  4ESX A;  3KGC A;  2RC7 A;  3TCF A;  2DDK A;  2Q88 A;  4F18 A;  5DVI A;  1SI1 A;  3R7X A;  5CMK A;  3IB2 A;  1IIW A;  5DEX A;  4OVR A;  4MLV A;  5JK4 A;  4QFL A;  3HHG A;  1JP4 A;  1QKA A;  2Q9T A;  4KD5 A;  2PT1 A;  5H8N B;  4OVT A;  3T9U A;  2RC9 A;  4MNI A;  2WBD A;  3TUS A;  1A40 A;  3FVO A;  4JB7 A;  4KPT A;  5H8H B;  1S7Y A;  1Z7M E;  5JEI A;  3Q26 A;  4PFY A;  4NF4 B;  4I3Y A;  4YMB A;  5EHM A;  5CMB A;  2HPG A;  3IOT A;  1P1O A;  1B58 A;  3DRH A;  2Q74 A;  3D4G A;  3TTK A;  4EXL A;  3M3K A;  1NI9 A;  1D9Q A;  3DP6 A;  4GWW A;  3GYY A;  3PPN A;  5FHM A;  2ZNS A;  1I69 A;  3K00 A;  2VD2 A;  3CFL A;  3RT6 B;  2XXI A;  2CEX A;  3KSX A;  1K9Y A;  4PF8 A;  3DP4 A;  3OSQ A;  2GHA A;  4QXD A;  4R72 A;  1OLC A;  3C33 A;  3CIJ A;  1B32 A;  3SEY A;  2VGQ A;  2QVR A;  1D4N A;  3PAM A;  4OVS A;  2QPQ A;  2I48 A;  1S50 A;  2KLF A;  3LUZ A;  3C4M A;  2UXA A;  3B50 A;  4U4S A;  2DWI A;  3OO6 A;  2P3V A;  2R6G E;  3RTW B;  1POT A;  4ESW A;  4POX A;  3IAZ A;  2V93 A;  1R9Q A;  1UTH A;  1BIY A;  2OK2 A;  1M5E A;  4P8B A;  2XHD A;  3HFU A;  5IZ1 A;  5HPQ A;  4H6D A;  3EHS A;  3TYH A;  1AIV A;  3A3C A;  4OAN A;  3IOR A;  3EN3 A;  4JDF A;  3R26 A;  5F24 A;  3RQT A;  4GL8 A;  5AE4 A;  1JQF A;  1SD3 A;  1QGX A;  3B8B A;  1P1N A;  2GHB A;  4PF6 A;  4MNC A;  4H5F A;  1PEB A;  2QS2 A;  1MPB A;  4RPN A;  3S4U A;  3I6V A;  1Y1M A;  3VE1 B;  2X7Q A;  1N7X A;  2Y84 A;  5AA2 D;  4HS7 A;  3FAT A;  1QUI A;  4HE1 A;  4G61 A;  1XVX A;  5CRY A;  3QUJ A;  1Y3N A;  3QAX A;  3U92 A;  1LBW A;  4P1L A;  2DOJ A;  4PFI A;  5I59 B;  2CEY A;  3FIR A;  2FBP A;  3PMV A;  3OMB A;  2FIE A;  3M8U A;  4ISU A;  4RNS A;  3HO7 A;  3IOU A;  2QJE A;  4TLL B;  4KQP A;  1DSN A;  3OXN A;  4DI3 D;  3LVU A;  4N8Y A;  1FTL A;  3MPL A;  1JW5 A;  5KZT A;  1FBH A;  2ZYK A;  1MXX A;  2RIN A;  1FQB A;  1FPD A;  4WED A;  4NED A;  3CI8 A;  1N84 A;  4H45 A;  5A5X B;  2R8T A;  3OEM A;  4Q8R A;  2XXV A;  3FGS A;  4KI0 E;  3E13 X;  2F7B A;  5HM4 B;  2WKY A;  1B7Z A;  2P3N A;  4OWD A;  2XWV A;  5TPA B;  4AB6 A;  1Y20 A;  5ET5 A;  4AS4 A;  2PFY A;  4U22 A;  3LUY A;  5I58 A;  3D1R A;  1RYO A;  3FTO A;  5IGA A;  3PPR A;  3FXU A;  1TWY A;  2QVU A;  3GXA A;  4GIZ A;  3KOT A;  2I0B A;  3SDF A;  1H44 A;  3T1B A;  3T0J A;  1B05 A;  2XXR A;  2DYX A;  5EQ7 A;  3PUX E;  5CC2 A;  4XFE A;  4GBV A;  5EQA A;  4OTE A;  2XX8 A;  3LC8 A;  4F1Y A;  3DM0 A;  4N4U A;  2GRV A;  1I6B A;  4FBP A;  4OXV A;  1FBC A;  4ELQ A;  1XHY A;  1QUK A;  1WVJ A;  3EQ1 A;  4DCX A;  3TTR A;  2RCB A;  4F1U A;  1US5 A;  3QXM A;  4JXI A;  3KBZ A;  2NWJ A;  1EZO A;  4PBH A;  1MQI A;  4MLQ A;  1M5B A;  3FBP A;  4QF9 A;  4JVD A;  1UTB A;  1JVY A;  1BK4 A;  1P99 A;  1B2H A;  4GWX A;  2F8D A;  5EYF A;  3VVF A;  5AA1 A;  3RYA A;  3Q27 A;  3DRG A;  1N04 A;  3H6U A;  3UGW A;  2P2A A;  4WEP A;  4DXC A;  2FNC A;  3PMX A;  3JV9 A;  2ANJ A;  2GQ1 A;  1RDY A;  1MQD A;  4NF8 A;  4G68 A;  1NNP A;  1IXC A;  2QS3 A;  1NV5 A;  1MXW A;  4PP0 A;  4ONY A;  1D3K A;  3PMW A;  1B46 A;  3PD9 A;  3B6T A;  3H6V A;  3KN3 A;  2QS4 A;  4XKQ A;  1XC1 A;  5DYH A;  3VV5 A;  2XX7 A;  4RXL A;  3LSX A;  1B4Z A;  1FRP A;  4F39 A;  4DIG A;  3H4Z A;  2VPO A;  2Z8D A;  4NF6 A;  4G8H A;  5ITO A;  4PC9 A;  4JSD A;  2Z22 A;  1M5C A;  4GXS B;  1ANF A;  3TCG A;  3TTL A;  5CMM A;  3T9V A;  5I57 A;  4RYA A;  3MP8 A;  4QHQ A;  1P1W A;  5ELV A;  3O29 A;  3RTF B;  3FVN A;  5EYH A;  4NAP A;  4NWC A;  3OEK A;  4FAT A;  4X48 A;  1LAF E;  4I40 A;  3H3G A;  4HXV A;  4TQU Q;  3KC1 A;  4PET A;  5AA4 A;  1B0H A;  3OEN A;  4GWS A;  1UQW A;  1QUJ A;  4DCY A;  4IR8 A;  1LFI A;  1NV7 A;  3K1N A;  3O28 A;  2ZNT A;  4BDM A;  1VFE A;  3QSL A;  3K6U A;  4BDR A;  1VR5 A;  1URS A;  5I2K B;  2QL3 A;  2XA5 A;  2F97 A;  4GX6 A;  4N6K A;  1N0T A;  3FJG A;  1VE4 A;  4BLA A;  3KSJ A;  1FTO A;  3E4R A;  3PV0 E;  1B51 A;  4PFU A;  4LZ7 A;  4XTC Q;  1B1H A;  4IY5 A;  4EF2 A;  1N3X A;  4ZEB A;  3FD3 A;  2UVG A;  1EZP A;  3BBR A;  4OES A;  1DK4 A;  4JWX A;  4U1O A;  1ZJL A;  4NMY A;  1Y4T A;  4N15 A;  4TOZ A;  3U72 A;  2Y7R A;  5DTB A;  3PUY E;  2Q2C A;  3A29 A;  2B65 A;  3TDJ A;  1FBD A;  4XKR A;  3QYT A;  3FV2 A;  1B5J A;  3G3H A;  3M3L A;  4JSO A;  2CZL A;  4PAF A;  3IX1 A;  4G2Z A;  4UA8 A;  1US4 A;  4HCW A;  4MBP A;  4MF3 A;  5DW8 A;  1LST A;  1FJ9 A;  3MST A;  4NHB A;  4O3B A;  3K6V A;  4GQO A;  4BDO A;  1IMB A;  1SQY A;  1PB8 A;  3UP9 A;  4H8J A;  4GWO A;  3OO8 A;  4QSE A;  1A55 A;  3IJO B;  4QSD A;  5DVJ A;  5DEX B;  3R6U A;  4YB6 A;  1B3E A;  1NH8 A;  2PT2 A;  2WYK A;  3U1O A;  2F5X A;  1IXG A;  3KN7 A;  4LUB A;  5EYG A;  5JTY A;  4G4P A;  4F3S A;  1YAE A;  2HXW A;  1PB9 A;  4LQ5 A;  2Z8E A;  3OD7 A;  3CG1 A;  3MP1 A;  1EZ9 A;  2DS9 A;  5H8F A;  4U1Z A;  3O66 A;  3EPE A;  2XD2 A;  1RDX A;  3I5O A;  1USY H;  2F3B A;  3MAM A;  4GWU A;  5I2N B;  4OYV A;  4ND9 A;  5AA3 A;  2OWS A;  1A99 A;  2HQ0 A;  4QFO A;  3ONM A;  3C9H A;  4R6K A;  1MY3 A;  2O7I A;  1B7H A;  1D9V A;  2H98 A;  4X1D A;  3H7M A;  2Z8F A;  4MJO A;  5I3S A;  2XXQ A;  3UK4 A;  2G29 A;  1QJM A;  1G0I A;  3PD8 A;  1YYZ A;  2R71 A;  5CI5 A;  4P47 A;  3IB1 A;  2HAU A;  5BUU A;  1VDW A;  5IZ3 A;  3HST A;  3TTM A;  5EHS A;  1UTH B;  4ZED A;  2RC8 A;  1YZ0 A;  1LBC A;  2I0C A;  3JZJ A;  3PUV E;  3D4C A;  2OBG A;  3B7D A;  4PDD A;  2HHM A;  5I84 A;  2V84 A;  4LON B;  5H8Q A;  1NL5 A;  2VD3 A;  4NN3 A;  1DBZ A;  3PPO A;  3SEU A;  4G8N A;  1B3L A;  4P9K A;  1B9J A;  1B3F A;  4Q30 B;  4O3C A;  2VP1 A;  2VPN A;  2ZZV A;  4YKJ A;  5I5P A;  2HCA A;  4R2B A;  4QRZ A;  3T22 A;  4QFN A;  1MDP 1;  1LAG E;  2F34 A;  3LV0 A;  5KDT A;  1B5I A;  5K2X A;  4JVC A;  1LB8 A;  4H5G A;  3DEL B;  4OEN A;  3LSF B;  3FUZ A;  3CFZ A;  4E0W A;  4DXB A;  1RKM A;  1D9Y A;  3G3J A;  3MYU A;  3PPQ A;  2QFL A;  1R9L A;  2DQV A;  3DRK A;  2Y7K A;  4LZ8 A;  1Y9U A;  3KZG A;  3BIG A;  3I3V A;  1OQG A;  2REG A;  5AA2 A;  2Q8M A;  1MM7 A;  1SW2 A;  1HSJ A;  4PE5 B;  4G77 A;  2BJJ X;  3H6T A;  4HCY A;  4NF5 B;  2O1L A;  1CB6 A;  4F3G A;  4RY1 A;  3O2A A;  3T96 B;  1OVB A;  4HE2 A;  3O97 A;  4OMB A;  1B4H A;  4GFR A;  3ODB A;  2FYI A;  3HN0 A;  4ZZA A;  4P56 A;  4OVP A;  3DLN A;  1BKA A;  1NUW A;  3K6W A;  4NE4 A;  4HE0 A;  3UOR A;  1NV3 A;  3E3K A;  4YKP A;  1FTM A;  1LCT A;  4P0G A;  5CBR A;  1POY 1;  4PDH A;  2B3B A;  3E78 A;  4ECF A;  1MDQ A;  4LP2 B;  4MH5 A;  2B3F A;  2PCR A;  2FIX A;  2V3U A;  4P3L A;  4KXP A;  4IO6 A;  4UAC A;  3DRI A;  1CNQ A;  1NMU A;  2H4I A;  1EYJ A;  3IOV A;  4Q0C A;  2YPN A;  4NF4 A;  5FTH A;  4O7I A;  1WOD A;  2O51 A;  1XS5 A;  5A5L A;  2VOZ A;  3S9M C;  4IO3 A;  4RPO A;  2CMO A;  4H0W A;  3N5L A;  4JBZ A;  3IK6 B;  3MWB A;  4XKP A;  4I3E A;  1UTB B;  2OJT A;  4N91 A;  4ZEF A;  4F1V A;  5ET6 A;  3P7I A;  3G3I A;  1LFH A;  3W9V A;  4GX4 A;  4EQ9 A;  3IFA A;  4YAH X;  3M3F A;  4FJP A;  2XXX A;  3GLB A;  5L9S A;  5LDZ A;  1GVC A;  1B52 A;  4G68 B;  4FOR A;  3KJ7 A;  4N8G A;  2DE2 A;  1FQD A;  2HFB A;  1SI0 A;  1J1N A;  4OZ9 A;  1LGB C;  4RJZ A;  2CZK A;  3MZ9 A;  2YJP A;  1Y3Q A;  2Y7W A;  2WOK A;  3GBB A;  4BDL A;  4L17 A;  2F6P A;  4POW A;  1NNF A;  1MXY A;  4FIM A;  1IXH A;  3ZKL A;  1YCJ A;  1BP5 A;  3MVY A;  1H43 A;  4K3F A;  4NF6 B;  4YKI A;  5TP9 A;  4EQ7 A;  4KCD A;  3E9X A;  3KC0 A;  2QRY A;  1QUL A;  5I57 B;  3CHG A;  3OOA A;  5IAI A;  1T0K A;  2WYP A;  1XT8 A;  3QK6 A;  3V89 B;  2D21 A;  2OCU A;  2NUV A;  1SBP A;  1Y1Z A;  4LVQ A;  2WOL A;  5J16 A;  1Z7N E;  5F1Q A;  5BWJ A;  2HZL A;  5AA4 B;  2KQZ A;  1SYH A;  3SEX A;  1NV6 A;  1SW5 A;  2X26 A;  4I9D A;  1RYX A;  4M4G A;  1FBP A;  4F22 A;  3SET A;  3OSR A;  4F2O A;  4OHN A;  2FVZ A;  1DTG A;  1ZIU A;  1FPJ A;  3RT8 A;  1MY4 A;  3MP6 A;  3S9L C;  2ZZX A;  3L6H A;  3SER A;  1URD A;  4OFL A;  4DXU A;  3T93 B;  3ISP A;  2XXH A;  4IO2 A;  2V3T A;  4GL0 A;  2NXO A;  3SKP A;  3Q28 A;  4U21 A;  2XXW A;  4ELO A;  3G7W A;  3N6T A;  2WX9 A;  5B7D A;  4PAI A;  2W7Y A;  3EF7 A;  4I8C A;  4X9T A;  2WEF A;  3KEI A;  2ZXT A;  2PVU A;  1B1X A;  2WBB A;  3ILU B;  3K4U A;  5B70 A;  3LBS A;  3C31 A;  1A8E A;  3C34 A;  3KN8 A;  4IY6 A;  1JVX A;  4FEB A;  4LA9 A;  4N13 A;  1Y3P A;  3S9E A;  1FQE A;  5TPA A;  2OWT A;  3O9P A;  3TTN A;  3L6G A;  1MRP A;  1AWB A;  3QIM A;  3ROJ A;  4P0I A;  1H3D A;  4N6D A;  1GR2 A;  2E0S A;  2XXK A;  1PB7 A;  2D3I A;  2F6G A;  3DRF A;  3MW0 A;  2AL5 A;  1JW4 A;  4GXA A;  2G93 A;  3PUZ E;  2X7P A;  5ET8 A;  3IO4 A;  2ESN A;  2UYF A;  5ESY A;  4YKK A;  5F7V A;  1GTK A;  2THI A;  2MKZ A;  3DRJ A;  2IA4 A;  3MVX A;  1ZKB A;  1VFD A;  5JTY B;  2CZH A;  1DCU A;  3MBP A;  3MJN A;  2QS1 A;  1QW0 A;  1I6Q A;  4TLM B;  4DI4 B;  2O7U A;  4XEQ A;  3LSW A;  3RPW A;  4O7M A;  3IO6 A;  4HTG A;  1LCF A;  3RYB A;  3T9H B;  4UAB A;  3RNN A;  5FBP A;  5ISU A;  2PYY A;  3TMG A;  1IZ1 A;  1FPI A;  1DPE A;  1JW1 A;  5H8F B;  4OVQ A;  1L5T A;  1I6A A;  1GV8 A;  1R6Z A;  1S9T A;  3IB0 A;  2XX9 A;  2AIX A;  4GX3 A;  1FPF A;  5IZZ A;  4YMA A;  3H6W A;  3B6Q A;  4FEC A;  2UYE A;  1XOC A;  2NOO A;  2O84 X;  4PGP A;  1DOT A;  1MXU A;  3C36 A;  4F2Q A;  1PC3 A;  2O6A A;  3RLF E;  3PGF A;  1LFG A;  4LAT A;  1DTZ A;  2BJI A;  1LBX A;  3K2D A;  4ZDM A;  4ZS9 A;  1SW1 A;  2I4B A;  4ELP A;  3TZA A;  1HSE A;  4QFK A;  3FXB A;  4YB7 A;  5FHN A;  2XXP A;  5ITP A;  1YPN A;  3RY3 A;  3VXB A;  5H8S A;  2HXR A;  3NOH A;  5EQ8 A;  4IGR A;  1EU8 A;  4MEV A;  2I3W A;  3TCH A;  2R9J A;  3TKD A;  5H8Q B;  1B6H A;  4ZE9 A;  1VSO A;  2PX1 A;  2A5T A;  4NWD A;  3GBA A;  1OLA A;  4OFJ A;  3IJX B;  1LB9 A;  2I58 A;  3IOW A;  3K02 A;  3Q25 A;  2ZYN A;  3PTY A;  4OET A;  3W15 C;  3SES A;  1IIT A;  4DLD A;  1NUZ A;  4IGT A;  4KYD A;  4DZ1 A;  4U4X A;  1KZ8 A;  4F29 A;  4KR5 A;  2DWH A;  2F3D A;  3A09 A;  5KDT B;  4PBQ A;  3HPI A;  3MUQ A;  2JJK A;  3RGY A;  2O69 A;  2QMW A;  3IL1 B;  4R2F A;  2XXU A;  4PCD A;  1MY0 A;  2I3V A;  1MPD A;  3K1M A;  1LAH E;  3QUF A;  3SEV A;  1O63 A;  1N7W A;  3ILT B;  2B4M A;  1LBV A;  4IO4 A;  4LZ5 A;  3MVW A;  1FPG A;  3PPP A;  1IUD A;  4YB5 A;  2P1S A;  5AA2 B;  4KCC A;  3V8X B;  1B5H A;  5T3J A;  3USD A;  3A3U A;  3RPL A;  2ZYO A;  1B7U A;  4EDP A;  2YLN A;  1FQF A;  3OO7 A;  1UIU A;  3W9W A;  2H25 A;  3K6X A;  3BKI B;  3TPA A;  1MY2 A;  2V4C A;  2QSX A;  1M5F A;  4OER A;  1A54 A;  1FPB A;  1MH4 A;  4G8M A;  3S9N C;  4NX1 A;  1NNK A;  3TFL A;  3VVD A;  1EYK A;  4G68 C;  1Q1K A;  1ZBM A;  4P11 A;  4H65 A;  1MY1 A;  1FJ6 A;  4EQB A;  5CM6 A;  2UVJ A;  4ZEI A;  4JWO A;  1BTJ A;  1MXV A;  1G0H A;  4BDN A;  1BLF A;  1NUX A;  2ONR A;  4BDQ A;  1N76 A;  5K2Y A;  2M8C A;  1OMP A;  5I7I A;  4IO7 A;  4PFR A;  3SEW A;  1QKB A;  2FA7 A;  1CE2 A;  4EXK A;  1TFA A;  4F3P A;  1ZU0 A;  3HCQ A;  4LN5 A;  4OA4 A;  4R9G A;  3THI A;  2RCA A;  1EH3 A;  3O6H A;  1IQ7 A;  4ELR A;  4PGN A;  3BFT A;  4PFW A;  4DE8 A;  4MCO A;  2WOP A;  5CMC A;  2PBW A;  3CSG A;  2ALU A;  2DXY A;  2AYS A;  2Y5L A;  3U94 A;  5I56 A;  1LAX A;  5I2N A;  3K0V A;  1PBP A;  3RUM A;  5LOM A;  3VDF A;  1FPE A;  3JYR A;  1HSL A;  2Z23 A;  4XF5 A;  3TQW A;  1PDA A;  3KOS A;  3OEL A;  4JWY A;  3CG3 A;  4AS5 A;  5KCJ A;  1SDX A;  4XXU A;  4RA1 A;  1SYI A;  5HBC A;  3O6G A;  5L8D A;  1KA0 A;  2XWO A;  2P0S A;  3FV1 A;  3N26 A;  1LLS A;  3H03 A;  2A5S A;  3ZKK A;  3UA8 A;  1B3H A;  3BIH A;  2OWZ A;  4N81 A;  1N3W A;  3O6I A;  2GFE A;  2PMS A;  5FTI A;  3UIF A;  1AH5 A;  4R6H A;  1EYI A;  1LEV A;  3MVZ A;  5I58 B;  2OZZ A;  3KJT A;  1DPP A;  5H8N A;  1MG1 A;  3EHU A;  1FCK A;  3Q29 A; 
#chains in the Genus database with same CATH homology
 2DSF A;  2H99 A;  5TP9 B;  2RKM A;  5H8H A;  4Z7E A;  1MS7 A;  3U8Q A;  4AQ4 A;  1H45 A;  1JNF A;  2E1S A;  2XXY A;  2F36 A;  3MC2 A;  2Q8J A;  4OEU A;  3N6U A;  3CR9 A;  1Y4C A;  4KHZ E;  3VXC A;  4KYS A;  3TEL A;  3K01 A;  5L9O A;  3UN6 A;  1XVY A;  2QMX A;  1ATG A;  1MPC A;  3TAJ A;  4C0R A;  1FTK A;  1H76 A;  2V25 A;  2XXT A;  4YU0 A;  2Y7I A;  3KG2 A;  3TEP A;  3MPK A;  3G3F A;  4ZEC A;  4NF8 B;  4C1U A;  3PUW E;  4Q5T A;  1TXF A;  2XD3 A;  3G3G A;  1AOV A;  4GVO A;  4NF5 A;  4RK9 A;  5J1D A;  4I1D A;  3ZS6 A;  2DE4 A;  3KFM A;  3LSL A;  1SVX B;  3VLW A;  3VFJ A;  4NTL A;  1MQH A;  1WDN A;  4OQO A;  1ELJ A;  2UVH A;  3PU5 A;  3LR1 A;  4R75 A;  2DP8 A;  1JEV A;  4XIG Q;  3RN8 A;  1ZTY A;  1A7L A;  4U23 A;  1P1Q A;  4YIC A;  4WKM A;  4ZEK A;  4R73 A;  4LQ2 A;  3T9X B;  2ZYM A;  1IXI A;  4R9F A;  4F3B A;  1O64 A;  2O1M A;  2HEU A;  2H9B A;  1NNT A;  3CVG A;  1M5D A;  5L9M A;  4DDD A;  3TOD A;  3CSB A;  5CBS A;  1FW0 A;  1UIV A;  3DP8 A;  2VHA A;  3U93 A;  2HAV A;  4QFP A;  2HZK A;  1QVS A;  4I62 A;  5I59 A;  2ZNU A;  4H8I A;  4C1T A;  1FQA A;  3MZ1 A;  3H06 B;  3N94 A;  4O3A A;  2Y7P A;  4H1X A;  1MH3 A;  3S2V A;  1ZMG A;  4ZZE A;  4KYE A;  5A5X A;  1IEJ A;  2ONK E;  3HHF A;  4E0X A;  1P1U A;  3FJ7 A;  1F9B A;  3FXQ A;  3HV1 A;  4KFQ A;  1OVT A;  4MFI A;  1DMB A;  2OLB A;  4RK2 A;  1SW4 A;  1ZLQ A;  2RF1 A;  4F31 B;  5TU0 A;  1FQC A;  3VLU A;  2DXR A;  4WXJ A;  2Q2A A;  4EUO A;  2ONS A;  4OVJ A;  3CFX A;  2O68 A;  1AL3 A;  3WAF A;  4PFT A;  1URG A;  2DWJ A;  3FAS A;  3O6P A;  4QSC A;  1NKX A;  3G3K A;  1MQJ A;  4HW8 A;  2DWA A;  2DVC A;  1FTJ A;  2REJ A;  1A8F A;  3FVG A;  4PQJ A;  2A5T B;  3F11 A;  1LBB A;  2IEE A;  4Z0I A;  1NH7 A;  1NFT A;  1B0L A;  5DT6 A;  1JEU A;  4N6P A;  3V5A A;  2H5Y A;  4GF8 A;  4OEV A;  3BFU A;  2V3Q A;  5ICQ A;  1II5 A;  5IKB A;  2NVU B;  1B40 A;  1O7T A;  2F35 A;  3T66 A;  3C35 A;  4FED A;  1R1N A;  2DVZ A;  3FVK A;  2I49 A;  5M2V A;  4FE8 A;  5FHO A;  3FZV A;  3WAE A;  4AB5 A;  1KWH A;  3ZSF A;  3ECR A;  2B4L A;  4IO5 A;  2F7C A;  1OIB A;  2I4C A;  2ZMB A;  4R6Y A;  4EF1 A;  3GZG A;  4XKN A;  4YZZ A;  3K1P A;  3EHT A;  3FJM A;  4IB2 A;  1MQG A;  4M1V A;  1OQH A;  4ZE8 A;  4H67 A;  4GLI A;  1TFD A;  1JET A;  4OFO A;  1MXZ A;  3CRB A;  2AL4 A;  3MZB A;  4N07 A;  3TQL A;  4R74 A;  5I2K A;  2Q89 A;  4GRK A;  2F7A A;  1GGG A;  4FAJ A;  3B6W A;  3IR1 A;  2LAO A;  2I6E A;  2D5W A;  2F78 A;  1PBQ A;  5ICT A;  4U2R A;  1YTV A;  3VVE A;  3AXF A;  1TT1 A;  4F19 A;  2GH9 A;  3C32 A;  3OO9 A;  1AMF A;  4GD5 A;  1Q35 A;  5DVF A;  5I56 B;  2DE3 A;  1MM6 A;  3FXR A;  4THI A;  1B3G A;  4GOT A;  3V83 A;  3VLV A;  2UVI A;  5KCJ B;  2ABH A;  3MQ9 A;  1USY E;  3KBR A;  4X1B A;  4ESX A;  3KGC A;  2RC7 A;  3TCF A;  2Q88 A;  4F18 A;  5DVI A;  1SI1 A;  3R7X A;  5CMK A;  3IB2 A;  1IIW A;  5DEX A;  4MLV A;  5JK4 A;  4QFL A;  3HHG A;  1QKA A;  2Q9T A;  4KD5 A;  2PT1 A;  5H8N B;  3T9U A;  2RC9 A;  3TUS A;  1A40 A;  3FVO A;  4JB7 A;  4KPT A;  5H8H B;  1S7Y A;  1Z7M E;  5JEI A;  3Q26 A;  4PFY A;  4NF4 B;  4YMB A;  5EHM A;  5CMB A;  3IOT A;  1P1O A;  1B58 A;  3DRH A;  3D4G A;  3TTK A;  4EXL A;  3M3K A;  3DP6 A;  3PPN A;  5FHM A;  2ZNS A;  1I69 A;  3K00 A;  2VD2 A;  3CFL A;  3RT6 B;  2XXI A;  3KSX A;  3DP4 A;  3OSQ A;  2GHA A;  4R72 A;  1OLC A;  3C33 A;  3CIJ A;  1B32 A;  3SEY A;  2VGQ A;  1D4N A;  3PAM A;  2QPQ A;  2I48 A;  1S50 A;  2KLF A;  3C4M A;  2UXA A;  4U4S A;  2DWI A;  3OO6 A;  2R6G E;  3RTW B;  1POT A;  4ESW A;  4POX A;  3IAZ A;  2V93 A;  1R9Q A;  1UTH A;  1BIY A;  2OK2 A;  1M5E A;  2XHD A;  5HPQ A;  4H6D A;  3EHS A;  3TYH A;  1AIV A;  3A3C A;  3IOR A;  3EN3 A;  4JDF A;  3R26 A;  3RQT A;  4GL8 A;  5AE4 A;  1JQF A;  1SD3 A;  1P1N A;  2GHB A;  4H5F A;  1PEB A;  2QS2 A;  1MPB A;  4RPN A;  3S4U A;  3I6V A;  1Y1M A;  3VE1 B;  2X7Q A;  1N7X A;  2Y84 A;  5AA2 D;  4HS7 A;  3FAT A;  1QUI A;  1XVX A;  5CRY A;  3QUJ A;  1Y3N A;  3QAX A;  3U92 A;  2DOJ A;  5I59 B;  3FIR A;  3PMV A;  3OMB A;  3M8U A;  4ISU A;  4RNS A;  3HO7 A;  3IOU A;  2QJE A;  4TLL B;  4KQP A;  1DSN A;  3OXN A;  3LVU A;  1FTL A;  3MPL A;  1JW5 A;  5KZT A;  2ZYK A;  1MXX A;  2RIN A;  1FQB A;  4WED A;  4NED A;  3CI8 A;  1N84 A;  5A5X B;  3OEM A;  4Q8R A;  2XXV A;  3FGS A;  4KI0 E;  3E13 X;  2F7B A;  5HM4 B;  2WKY A;  1B7Z A;  4OWD A;  5TPA B;  4AB6 A;  1Y20 A;  4U22 A;  3LUY A;  5I58 A;  1RYO A;  3FTO A;  3PPR A;  3FXU A;  1TWY A;  3GXA A;  4GIZ A;  3KOT A;  2I0B A;  3SDF A;  1H44 A;  1B05 A;  2XXR A;  2DYX A;  3PUX E;  5CC2 A;  4OTE A;  2XX8 A;  3LC8 A;  4F1Y A;  3DM0 A;  2GRV A;  1I6B A;  4OXV A;  4ELQ A;  1XHY A;  1QUK A;  1WVJ A;  3EQ1 A;  4DCX A;  3TTR A;  2RCB A;  4F1U A;  1US5 A;  3QXM A;  4JXI A;  2NWJ A;  1EZO A;  1MQI A;  4MLQ A;  1M5B A;  4QF9 A;  1UTB A;  1JVY A;  1P99 A;  1B2H A;  2F8D A;  5EYF A;  3VVF A;  5AA1 A;  3RYA A;  3Q27 A;  3DRG A;  1N04 A;  3H6U A;  3UGW A;  2P2A A;  4WEP A;  4DXC A;  2FNC A;  3PMX A;  3JV9 A;  2ANJ A;  1MQD A;  4NF8 A;  4G68 A;  1NNP A;  1IXC A;  2QS3 A;  1MXW A;  4PP0 A;  4ONY A;  1D3K A;  3PMW A;  1B46 A;  3PD9 A;  3B6T A;  3H6V A;  3KN3 A;  2QS4 A;  4XKQ A;  1XC1 A;  5DYH A;  3VV5 A;  2XX7 A;  4RXL A;  3LSX A;  1B4Z A;  4F39 A;  4DIG A;  3H4Z A;  2Z8D A;  4NF6 A;  4G8H A;  5ITO A;  4JSD A;  2Z22 A;  1M5C A;  4GXS B;  1ANF A;  3TCG A;  3TTL A;  5CMM A;  3T9V A;  5I57 A;  4RYA A;  3MP8 A;  4QHQ A;  1P1W A;  5ELV A;  3O29 A;  3RTF B;  3FVN A;  4NWC A;  3OEK A;  4FAT A;  4X48 A;  1LAF E;  3H3G A;  4TQU Q;  4PET A;  5AA4 A;  1B0H A;  3OEN A;  1UQW A;  1QUJ A;  4DCY A;  1LFI A;  3K1N A;  3O28 A;  2ZNT A;  4BDM A;  1VFE A;  3QSL A;  3K6U A;  4BDR A;  1VR5 A;  1URS A;  5I2K B;  2QL3 A;  2F97 A;  1N0T A;  3FJG A;  1VE4 A;  4BLA A;  3KSJ A;  1FTO A;  3E4R A;  3PV0 E;  1B51 A;  4PFU A;  4LZ7 A;  4XTC Q;  1B1H A;  4IY5 A;  4EF2 A;  1N3X A;  4ZEB A;  3FD3 A;  2UVG A;  1EZP A;  3BBR A;  4OES A;  4JWX A;  4U1O A;  1ZJL A;  4NMY A;  1Y4T A;  4TOZ A;  3U72 A;  2Y7R A;  5DTB A;  3PUY E;  2Q2C A;  2B65 A;  3TDJ A;  4XKR A;  3QYT A;  3FV2 A;  1B5J A;  3G3H A;  3M3L A;  4JSO A;  2CZL A;  3IX1 A;  4G2Z A;  4UA8 A;  1US4 A;  4HCW A;  4MBP A;  4MF3 A;  1LST A;  4O3B A;  3K6V A;  4GQO A;  4BDO A;  1SQY A;  1PB8 A;  3UP9 A;  4H8J A;  4GWO A;  3OO8 A;  4QSE A;  1A55 A;  3IJO B;  4QSD A;  5DVJ A;  5DEX B;  3R6U A;  4YB6 A;  1B3E A;  1NH8 A;  2PT2 A;  3U1O A;  2F5X A;  1IXG A;  3KN7 A;  4LUB A;  5JTY A;  4G4P A;  4F3S A;  1YAE A;  2HXW A;  1PB9 A;  4LQ5 A;  2Z8E A;  3OD7 A;  3CG1 A;  3MP1 A;  1EZ9 A;  2DS9 A;  5H8F A;  4U1Z A;  3O66 A;  3EPE A;  2XD2 A;  3I5O A;  1USY H;  3MAM A;  5I2N B;  4OYV A;  4ND9 A;  5AA3 A;  2OWS A;  1A99 A;  2HQ0 A;  4QFO A;  3ONM A;  3C9H A;  4R6K A;  1MY3 A;  2O7I A;  1B7H A;  1D9V A;  2H98 A;  4X1D A;  3H7M A;  2Z8F A;  2XXQ A;  3UK4 A;  2G29 A;  1QJM A;  3PD8 A;  2R71 A;  5CI5 A;  3IB1 A;  2HAU A;  5BUU A;  3HST A;  3TTM A;  5EHS A;  1UTH B;  4ZED A;  2RC8 A;  1LBC A;  2I0C A;  3JZJ A;  3PUV E;  3D4C A;  2OBG A;  3B7D A;  5I84 A;  2V84 A;  4LON B;  5H8Q A;  1NL5 A;  2VD3 A;  3PPO A;  3SEU A;  4G8N A;  1B3L A;  1B9J A;  1B3F A;  4Q30 B;  4O3C A;  2VP1 A;  4YKJ A;  2HCA A;  4R2B A;  4QRZ A;  3T22 A;  4QFN A;  1MDP 1;  1LAG E;  2F34 A;  5KDT A;  1B5I A;  5K2X A;  1LB8 A;  4H5G A;  3DEL B;  4OEN A;  3LSF B;  3FUZ A;  3CFZ A;  4E0W A;  4DXB A;  1RKM A;  1D9Y A;  3G3J A;  3PPQ A;  1R9L A;  2DQV A;  3DRK A;  2Y7K A;  4LZ8 A;  1Y9U A;  3KZG A;  3I3V A;  1OQG A;  2REG A;  5AA2 A;  1MM7 A;  1SW2 A;  1HSJ A;  4PE5 B;  4G77 A;  2BJJ X;  3H6T A;  4HCY A;  4NF5 B;  2O1L A;  1CB6 A;  4F3G A;  4RY1 A;  3O2A A;  3T96 B;  1OVB A;  3O97 A;  4OMB A;  1B4H A;  4GFR A;  3ODB A;  2FYI A;  3HN0 A;  4ZZA A;  3DLN A;  1BKA A;  3K6W A;  4NE4 A;  3UOR A;  3E3K A;  4YKP A;  1FTM A;  1LCT A;  4P0G A;  5CBR A;  1POY 1;  2B3B A;  4ECF A;  1MDQ A;  4LP2 B;  4MH5 A;  2B3F A;  2V3U A;  4IO6 A;  4UAC A;  3DRI A;  1NMU A;  2H4I A;  3IOV A;  4Q0C A;  2YPN A;  4NF4 A;  5FTH A;  1WOD A;  2O51 A;  1XS5 A;  2VOZ A;  3S9M C;  4IO3 A;  4RPO A;  2CMO A;  4H0W A;  3N5L A;  4JBZ A;  3IK6 B;  3MWB A;  4XKP A;  1UTB B;  2OJT A;  4ZEF A;  4F1V A;  3P7I A;  3G3I A;  1LFH A;  3W9V A;  4EQ9 A;  4YAH X;  3M3F A;  4FJP A;  2XXX A;  3GLB A;  5L9S A;  1GVC A;  1B52 A;  4G68 B;  4FOR A;  3KJ7 A;  2DE2 A;  1FQD A;  2HFB A;  1SI0 A;  1J1N A;  4OZ9 A;  1LGB C;  4RJZ A;  3MZ9 A;  2YJP A;  1Y3Q A;  2Y7W A;  2WOK A;  3GBB A;  4BDL A;  4L17 A;  2F6P A;  4POW A;  1NNF A;  1MXY A;  4FIM A;  1IXH A;  3ZKL A;  1YCJ A;  1BP5 A;  3MVY A;  1H43 A;  4K3F A;  4NF6 B;  4YKI A;  5TP9 A;  4EQ7 A;  4KCD A;  3E9X A;  2QRY A;  1QUL A;  5I57 B;  3CHG A;  3OOA A;  5IAI A;  1T0K A;  1XT8 A;  3QK6 A;  3V89 B;  2D21 A;  2OCU A;  2NUV A;  1SBP A;  1Y1Z A;  4LVQ A;  2WOL A;  1Z7N E;  5F1Q A;  5BWJ A;  2HZL A;  5AA4 B;  1SYH A;  3SEX A;  1SW5 A;  2X26 A;  4I9D A;  1RYX A;  4M4G A;  4F22 A;  3SET A;  3OSR A;  4F2O A;  4OHN A;  1DTG A;  1ZIU A;  3RT8 A;  1MY4 A;  3MP6 A;  3S9L C;  3L6H A;  3SER A;  1URD A;  4OFL A;  4DXU A;  3T93 B;  2XXH A;  4IO2 A;  2V3T A;  4GL0 A;  2NXO A;  3SKP A;  3Q28 A;  4U21 A;  2XXW A;  4ELO A;  3G7W A;  3N6T A;  5B7D A;  2W7Y A;  3EF7 A;  4I8C A;  4X9T A;  3KEI A;  2ZXT A;  2PVU A;  1B1X A;  3ILU B;  3K4U A;  5B70 A;  3LBS A;  3C31 A;  1A8E A;  3C34 A;  3KN8 A;  4IY6 A;  1JVX A;  4FEB A;  4LA9 A;  4N13 A;  1Y3P A;  3S9E A;  1FQE A;  5TPA A;  2OWT A;  3O9P A;  3TTN A;  3L6G A;  1MRP A;  3QIM A;  4P0I A;  1H3D A;  1GR2 A;  2E0S A;  1PB7 A;  2D3I A;  2F6G A;  3DRF A;  3MW0 A;  2AL5 A;  1JW4 A;  4GXA A;  2G93 A;  3PUZ E;  2X7P A;  3IO4 A;  2ESN A;  2UYF A;  4YKK A;  5F7V A;  1GTK A;  2THI A;  3DRJ A;  2IA4 A;  3MVX A;  1ZKB A;  1VFD A;  5JTY B;  3MBP A;  3MJN A;  2QS1 A;  1QW0 A;  1I6Q A;  4TLM B;  2O7U A;  3LSW A;  3RPW A;  3IO6 A;  4HTG A;  1LCF A;  3RYB A;  3T9H B;  3RNN A;  5ISU A;  2PYY A;  3TMG A;  1IZ1 A;  1DPE A;  1JW1 A;  5H8F B;  1L5T A;  1I6A A;  1GV8 A;  1R6Z A;  1S9T A;  3IB0 A;  2XX9 A;  2AIX A;  4YMA A;  3H6W A;  3B6Q A;  4FEC A;  2UYE A;  1XOC A;  2NOO A;  2O84 X;  1DOT A;  1MXU A;  3C36 A;  4F2Q A;  1PC3 A;  2O6A A;  3RLF E;  3PGF A;  1LFG A;  4LAT A;  1DTZ A;  4ZDM A;  3K2D A;  4ZS9 A;  1SW1 A;  2I4B A;  4ELP A;  3TZA A;  1HSE A;  4QFK A;  4YB7 A;  5FHN A;  2XXP A;  5ITP A;  1YPN A;  3RY3 A;  3VXB A;  5H8S A;  4IGR A;  1EU8 A;  2I3W A;  3TCH A;  2R9J A;  3TKD A;  5H8Q B;  1B6H A;  4ZE9 A;  1VSO A;  2PX1 A;  2A5T A;  4NWD A;  3GBA A;  1OLA A;  4OFJ A;  3IJX B;  1LB9 A;  2I58 A;  3IOW A;  3K02 A;  3Q25 A;  2ZYN A;  4OET A;  3W15 C;  3SES A;  1IIT A;  4DLD A;  4DZ1 A;  4IGT A;  4KYD A;  4U4X A;  4F29 A;  4KR5 A;  2DWH A;  3A09 A;  5KDT B;  3HPI A;  3MUQ A;  3RGY A;  2O69 A;  2QMW A;  3IL1 B;  4R2F A;  2XXU A;  1MY0 A;  2I3V A;  1MPD A;  3K1M A;  1LAH E;  3QUF A;  3SEV A;  1O63 A;  1N7W A;  3ILT B;  2B4M A;  4IO4 A;  4LZ5 A;  3MVW A;  3PPP A;  1IUD A;  4YB5 A;  2P1S A;  5AA2 B;  4KCC A;  3V8X B;  1B5H A;  3USD A;  3A3U A;  2ZYO A;  1B7U A;  4EDP A;  2YLN A;  1FQF A;  3OO7 A;  1UIU A;  3W9W A;  2H25 A;  3K6X A;  3BKI B;  3TPA A;  1MY2 A;  2QSX A;  1M5F A;  4OER A;  1A54 A;  1MH4 A;  4G8M A;  3S9N C;  1NNK A;  3TFL A;  3VVD A;  4G68 C;  1Q1K A;  1ZBM A;  4P11 A;  4H65 A;  1MY1 A;  4EQB A;  5CM6 A;  2UVJ A;  4ZEI A;  4JWO A;  1BTJ A;  1MXV A;  4BDN A;  1BLF A;  2ONR A;  4BDQ A;  1N76 A;  5K2Y A;  2M8C A;  1OMP A;  4IO7 A;  3SEW A;  1QKB A;  2FA7 A;  1CE2 A;  4EXK A;  1TFA A;  4F3P A;  1ZU0 A;  3HCQ A;  4R9G A;  3THI A;  2RCA A;  1EH3 A;  3O6H A;  1IQ7 A;  4ELR A;  3BFT A;  4PFW A;  4DE8 A;  2WOP A;  5CMC A;  2PBW A;  3CSG A;  2ALU A;  2DXY A;  2AYS A;  3U94 A;  5I56 A;  1LAX A;  5I2N A;  3K0V A;  1PBP A;  3RUM A;  5LOM A;  3VDF A;  3JYR A;  1HSL A;  2Z23 A;  3TQW A;  1PDA A;  3KOS A;  3OEL A;  4JWY A;  3CG3 A;  5KCJ A;  1SDX A;  4XXU A;  4RA1 A;  1SYI A;  5HBC A;  3O6G A;  5L8D A;  2P0S A;  3FV1 A;  3N26 A;  1LLS A;  3H03 A;  2A5S A;  3ZKK A;  3UA8 A;  1B3H A;  1N3W A;  3O6I A;  2GFE A;  2PMS A;  5FTI A;  3UIF A;  1AH5 A;  4R6H A;  3MVZ A;  5I58 B;  2OZZ A;  3KJT A;  1DPP A;  5H8N A;  1MG1 A;  3EHU A;  1FCK A;  3Q29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...