4GH4A

Crystal structure of foot and mouth disease virus a22 serotype
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
210
structure length
191
Chain Sequence
TTTTGESADPVTTTVENYGGETQVQRRQHTDVTFIMDRFVKIQNLNPTHVIDLMQTHQHGLVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTGNPTAYLKAPFTRLALPYTAPHRVLATVYNGTSKYAQLPASFNFGAIQATTIHELLVRMKRAELYCPRPLLAVEVSSQDRHKQKIIAPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein VP1
publication title Perturbations in the surface structure of A22 Iraq foot-and-mouth disease virus accompanying coupled changes in host cell specificity and antigenicity.
pubmed rcsb
molecule tags Virus
total genus 36
structure length 191
sequence length 210
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gh4A00
3VBRC 1OOPA 1NA1B 1A6CA 1RUC3 2RS31 4CDUA 1ND2B 1BBT1 1EAH1 1B35C 1R093 4JGYA 3JD72 3VBSC 1TMF2 3M8LA 2R043 1RHI1 1AYN3 1Z7S1 1AR72 4CDWA 1C8M2 1ZBA2 4Q4V3 4QPIA 1RUF2 1ASJ3 1VRH3 3JD71 1AR63 4RHV3 1R091 1VBA2 4NWWA 5ACA2 4AEDA 1RUE3 1V9U2 2R041 1OHFA 4FTSA 1AL0G 1C8NA 4QPGB 2HWF1 4Q4W3 2X5IB 1AR71 1RUJ1 1RUH2 1RUG1 1VBD3 2PLV3 1PO13 1K5MA 4PDWC 1HRI2 1NCQC 4YVSA 4Q4V1 5AC92 5FMOL 4N53A 1VB4A 1ASJ1 1VRH1 3DPRA 2BFUS 2HWB2 1H8TC 5A33A 5BNPB 5BNOC 1AYM2 1ZBE3 3VDDC 1V9U1 3CJIA 3VBUC 1RUE1 1OOPB 1AR83 2RR13 1NY71 4CDUB 1PO11 1POV1 5CFCA 3ZFFC 5C4WC 1NCRC 4CDQC 1AR92 4RQPB 3ZFGA 2VQ0A 4CEYC 1PO21 5K0UC 4GB33 2RMU2 2WS93 4WM8C 1HRV3 1VBC3 3TN91 1EV12 1RVF3 2HWE2 4JGZA 2RR11 4CDXB 4YVWA 4EJRA 2ZAHA 2WZR1 5C8CC 1QQP2 4GH4C 4AEDB 1R1A3 5BNOA 1CJDA 1RUI2 2RM22 1QJX3 1QJY2 3NAPA 1VBE3 2RMU1 4IV3C 5J96B 1E57A 1HQNA 4YVSB 1EV11 1HRV1 5DDJ1 2BFUL 2RS13 4N53B 1NG0A 4NWVA 1TME1 1MEC3 3DPRB 1QJU2 5A33B 5D8AA 1HXS3 1RUD2 1FOD3 2RS33 5ABJA 5JZGC 5CFDA 1R1A1 1BBT3 1EAH3 1QJY1 5K0UA 4N43C 4CEWC 1VBE1 4WM8A 3ZFEA 1RHI3 1VBB2 5CFCB 4RQPC 3LOBA 1COV2 5FMOS 1AL21 1Z7S3 1QJU1 2HWD2 2WLPA 1BEV2 3ZFGB 1MEC1 4GH4A 3VBOB 3JBG2 4IV1B 4RR3C 1HXS1 4Q4Y2 1FOD1 1RMU2 1DDLA 3JD73 1PGW2 4JGZB 4YVWB 2MEV1 1PVC1 1POV0 1OPOA 3J8F2 1QJZA 5L7OB 2HWF3 1X33A 4BCUA 1AR73 1RUJ3 1RUG3 3VBFC 1C8M3 1ZBA3 2ZZQA 1WCDJ 3NAPB 1ND3C 1R082 5JZGA 3HAGA 1FMD2 4Y5Z0 3VBHA 5C9AA 1GFF2 1TMF1 2QQPA 1W39A 1V9U3 5FOJB 2WFF2 4FTBA 5ABJB 1AYN2 5BNNA 5CFDB 1POV3 1C8M1 1VAKA 1ZBA1 3VBRA 2RS52 1R081 2ZTNA 1RUF1 1FMD1 3ZFEB 2HWB3 1B35A 5J98B 3VBSA 1VBA1 1AYM3 5ACA1 4WM7B 1PO23 1AR62 4RHV2 1MQTB 2WFF1 4RS5B 4IV1C 3TN93 1NA1C 4FSJA 1RUH1 1AUYA 1ND2C 1HRI1 2RS51 2WZR3 1FPN2 4JGYB 5AC91 1PGL2 2HWB1 1AYM1 2RMU3 1IHMA 4Q4X2 1EV13 4CDWB 5DDJ3 2R062 4QPIB 1AR82 1TME3 4PDWA 3VBHB 1QQP3 1NCQA 1AR91 4QPGC 1RUI3 1H8TA 2X5IC 1QJY3 3VDDA 1D4M2 5BNNB 3VBUA 1K5MB 2HWC2 1NA1A 3VBRB 2R061 2HWE1 2FZ2A 2WS92 1AL23 1VBC2 1QJU3 4LLFA 5BNPC 1B35B 1QQP1 3VBSB 3ZFFA 5C4WA 1NCRA 1RUD3 1VB2A 4RS5C 4RFT0 4CDQA 1OOPC 3CJIB 1RUI1 2RM21 4CDUC 2FZ1A 4CEYA 2MEV3 1PVC3 1VBB3 5A32A 1QJX2 3IDEA 2R072 5C8CA 2RS12 1BMV2 2IZWA 2Y26A 2XBO2 4Q4Y3 1RUD1 4GMP1 4CDXC 2RS32 1TMF3 4IV3A 1BBT2 3J8F3 4PDWB 1NCQB 1VBB1 1X36A 1HX6A 2TBVA 1COV1 1F2NA 4AEDC 1RHI2 2HWD1 1BEV1 5LK7B 1H8TB 1Z7S2 5BNOB 1R083 1PIV2 3JBG1 3VDDB 3JB4C 4Q4Y1 1RUF3 4YVSC 1RMU1 3VBUB 1FMD3 1PGW1 4N53C 1VBA3 1RUC2 5ACA3 4N43A 3DPRC 4CEWA 3J8F1 1R092 2WFF3 2GSYA 3ZFFB 5C4WB 4RQPA 5D8AB 1RB8G 1NCRB 3CJIC 4CDQB 2XPJA 2R042 1RUH3 2HWF2 4Z92B 1HRI3 2RS53 1RUJ2 1PIV1 4CEYB 1RUG2 5AC93 4RR3A 5K0UB 5A32B 5CFCC 4WM8B 4CDXA 4Q4V2 1RUC1 1ASJ2 1VRH2 5GKAC 3ZFGC 2DF7A 5C8CB 3VBOC 3S6PA 4GH4B 2WWSA 1RUE2 1AYN1 3VBFA 1FPN3 4JGZC 4Q4W2 1NY72 3JB8A 4YVWC 1VBD2 2PLV2 1PO12 1ND3A 4IV3B 1AR93 5L7OC 3ZXAC 3FBMA 1AR61 4RHV1 4Q4X3 1PO22 3NAPC 1ZBE2 2R063 2HWE3 4GMP0 3TN92 5JZGB 4Q4W1 2RR12 1FPN1 1VBD1 2PLV1 2BPA2 5C9AB 4N43B 4CEWB 2WZR2 1PGL1 5D8AC 1F8VA 4FTEA 1SMVA 2RM23 5ABJC 1D4M3 5CFDC 2HWC3 3VBOA 4Q4X1 1ZBE1 4IV1A 4RR3B 3ZFEC 4GB32 1ND2A 1AR81 1HRV2 5DDJ2 4Y4YA 1RVF2 4WM7C 1TME2 4SBVA 5L7OA 1MQTC 4GMP3 2BUKA 2BBVA 1D4M1 1R1A2 3VBFB 1CD3G 2HWC1 4JGYC 4GB31 1COV3 1ND3B 1VBE2 2R073 2WS91 1M06G 1VBC1 2HWD3 1BEV3 1RVF1 1AL22 2XBO3 3JBG3 1MEC2 4QPGA 1RMU3 4CDWC 2X5IA 2GH8A 4QPIC 1HXS2 1FOD2 3VBHC 1NOVA 5C9AC 1EAH2 1QJX1 2MEV2 1PVC2 2R071 5BNPA 4WM7A 2RS11 1BMV1 1PIV3 1MQTA 2XBO1 5BNNC 4RS5A 1K5MC
chains in the Genus database with same CATH superfamily
5CKQA 1W2NA 2PA7A 4XTMA 3U78A 3PHMA 4FT8A 5AFEA 4O9GA 1L7RA 2MNGA 1SPPA 1A6CA 4IERA 1RUC3 2RS31 3KV4A 1TNFA 1STMA 4KU7A 2DCTA 3DCQA 3IMNA 4N7IA 3GJBA 3TYJA 4OMCA 5KXEA 5SV5A 1DU3D 3OEBA 4QX3A 1XQNA 1NQDA 2PHLA 3QOPA 2R043 3X29B 4FVVA 1OH3A 1RHI1 2H0VA 4HXCA 2G9GA 3O1PA 4I0AA 3FZ3A 2VZ1A 1Z7S1 1AR72 5GLZA 1GWLA 3MV11 1KEXA 1RL3A 2UYBA 4UW6A 1ZBA2 5LA9A 3I2IA 4K3UA 4QPIA 3LQCA 1RUF2 4QM9A 5FO9B 5JXJA 2WUHA 1ZVFA 4LOTA 1QOTA 1AR63 5F32A 4CXWA 2G9ZA 5C5TA 2QUOA 5DPNA 1ULOA 1WW4A 2YGMA 3NJXA 2CAVA 4AEKA 2YHJA 2GDFA 3ON7A 1V9U2 4EYUA 1OHFA 3DYMA 3MPPG 1C8NA 4FTSA 4QPGB 2HWF1 1O4TA 3MGUA 4ZU4A 1RJ8A 4CSWA 2AZ5A 4PDWC 3AP6A 3GHNA 2XWJB 2NQYA 1UOBA 3TWIA 3FHQA 3SISA 2DWRA 4BMEA 5IK8A 4Q4V1 4LHLA 4YW4A 5KC5A 4TLFA 5A6QA 1VRH1 4FOQA 4OUSA 4P5YA 3ZO0B 1E5SA 1UX7A 2OZ6A 2ARAA 3I7DA 4G9SB 3H42B 4QGLA 5FBZA 3ALQA 5F39A 5A1FA 3I3DA 1MZ5A 1OH4A 2J1EA 3C7FA 3CJIA 2GP5A 1WUVA 1OOPB 4N7UA 3WHUA 1UX6A 2ZGQA 4LBJA 3ZXFA 1PX3A 1C3HA 1HQLA 3MUY1 4GWNA 4B1MA 4DUVA 3TNPB 4JTNA 2JDYA 2YU1A 4F83A 3O1UA 5C4WC 3RZKA 4BQXA 3MW2A 2B4KA 4GKXA 4KQ7A 5A3MA 3NL1A 4RQPB 4XHXA 5BV6A 3S7EA 2CYFA 3GGLA 1KFXL 2VQ0A 3AYAA 3VL8A 4GKYA 5EJ1B 1UMIA 2YDEA 5FZ8A 1WD3A 2AYHA 2ORXA 4GB33 5FP4A 5K8SA 2RMU2 3BTZA 2EIEA 2VMDA 4WBBA 1VBC3 3TN91 3IDCB 3KF3A 3M3OA 2HWE2 5T5JA 3EQEA 1DCSA 3RWNA 4L9BA 1UWWA 1AJKA 1PX4A 5FYUA 3N36A 4EV0A 4O9EA 3G6JB 3NVCA 4QD2A 4NIGA 4BHPA 4P08A 3N9MA 4AEDB 1I1EA 4COYA 4YG0A 5FPUA 3NQHA 1RUI2 2OIIA 4YWAA 5IATA 4YSFA 3T0AA 2YGLA 1BVVA 1QJY2 2EF6A 3NAPA 3O7OA 4IV3C 4QDQA 4QXHA 5APAA 2ZEXA 4Y22A 4FAGA 5FZ4A 5DDJ1 1FATA 2VM9A 5CIRA 1W8OA 1MEC3 2A75A 3DPRB 1QDOA 2QQVA 3K75B 1X8EA 2XQRA 2GNDA 2RG4A 1RUD2 3P5BA 1O7FA 1REDA 2RS33 4LBQD 5JZGC 3K4AA 2DU0A 4QT6A 2D5HA 5CFDA 3H7JA 1SLIA 1NLSA 2BWAA 5A1AA 4HPKB 1OFSA 1WLWA 1UNBA 5GJ6A 5JI9A 4DPNA 5FPBA 3PDQA 1VBE1 4X8PA 3FX3A 1RHI3 2PELA 1OC1A 4D7TA 1VE0A 4AFDA 1GZWB 4WZCA 3POEA 1Z7S3 4CP9A 2HWD2 4AEJA 1BEV2 1JXNA 1DGLA 1S0IA 5FY4A 5C3PA 1W8NA 2OVUA 4NRPA 4DO0A 4CU8A 4HG6B 2PHTA 2C24A 3QH7A 1M4WA 1ZA4A 3FBYA 4X6RB 3RMYA 4HVOA 2ZCWA 4WZFA 5KBFA 5J37A 3SCHA 2CY6A 4OI2A 5J09A 1F5JA 4XF3A 1KFUL 1QJZA 3VKMA 2D3PA 4ASKA 5FJHA 5L9BA 5KXBA 5L7OB 2HWF3 3V56A 4BCUA 3CHXA 4NO4A 3TEZA 4LO4B 5AFBA 4FFIA 3BOPA 1XJAA 2P37A 2IWGB 2D6LX 2PFWA 3VLBB 4MX3A 3ZKUA 4WVMA 2NP0A 1JOPA 2GAUA 1XNKA 3KVBA 4UYBA 5FPZA 2ADDA 4AHWA 2G19A 3OTFA 3VBHA 5C9AA 5CB7A 4QX0A 1JYWA 1XE7A 1AXYA 2JECA 3TNQA 2QQPA 5KHGA 3UYJA 1O91A 1JYIA 4AVTA 4NIDA 1YO8A 4XJWA 5ANQA 1YLLA 3W59A 1J59A 1X50A 1EYBA 2ZX3A 2FDIA 1K42A 1GP5A 2VZSA 3ECQA 3WF1A 2VUJA 2IXLA 2K2SA 4EN6B 4M01A 3R05A 5BNNA 1Q56A 3VD4A 1JN2P 1LEMA 1W3VA 2P6CA 1OD5A 2Y6LA 1ZBA1 3FFQA 1OQDA 4S2HA 3NRUA 2PN5A 4META 3ZIWA 1US2A 4J1XA 2CAUA 1RUF1 1CZVA 2ZJCA 4O65A 4HKWA 5EZWA 4XDOA 5JSPA 2C0ZA 2YY1A 2W94A 2CGPA 4FBFA 4XIKA 3WP3A 2ZPXA 3ZYPA 1HV0A 2BBAA 3UT0A 2XUMA 2JJ6A 3AP5A 1DYKA 3MICA 5FY8A 5K7PA 4LKFA 4FPFA 4EQVA 4MGYE 3TN93 5A70A 2ZX2A 1ST8A 1FYUA 2Q0AA 4QX5A 1AUYA 3BVCA 3SCGA 4LXLA 2OUJA 4MGZE 1J3PA 1JBCA 3D8CA 4KWJA 1W9SA 3SXWA 4D94A 2NPIA 3O1VA 1UY0A 4M3CF 4O7XA 4Z07A 4NAOA 2B7YA 3CO2A 3AMQA 1HB2A 1ZREA 1DGWX 2YUEA 4JHTA 4XACA 1H9WA 1S0EA 3PNAA 4JQTA 3N7LA 4LULA 5A3PA 4CPBD 4S2DA 4YGDA 5FMDA 3THPA 1IHMA 3ZDVA 1WBFA 4XF1A 3VV1A 4AFMA 2VZTA 1NKGA 2JKBA 5DDJ3 1YIPA 4QPIB 2Y8KA 1JZ5A 3OG2A 1WLDA 2OPWA 1CAXA 4LQRA 5ISLA 2GN7A 2ZOEB 4ZZ8A 2WL1A 1HQWA 3KZ4C 3J9SA 2Y0IA 3AKPA 4J25A 1BK0A 4ISQA 2EXHA 1H8TA 2PTMA 4MZUA 5JPMB 5IVBA 3SCFA 2VOWA 2CHHA 4Q29A 2R1DA 1AX1A 1D4M2 4A3ZA 2Q8CA 3VBUA 2HWC2 3POSA 5FZHA 1OLQA 5FQ0B 3WW2A 3K4ZA 2HWE1 1O5UA 4RGAA 4E27A 2DBIA 2WS92 3ZM8A 2AREA 4Z1VA 2EVXA 3K3OA 1SLTA 2XG3A 2FMYA 3VBSB 2LTNA 1NLRA 1W8WA 3ZPOA 1NXD1 4CDQA 4EZ4A 4QKDA 3ZXEA 4AEMA 4ZS3A 2W1WA 3CJIB 4KGQA 3R4SA 1GZCA 4B7KA 4TZDA 1RUI1 4PI2A 2HEWF 4CEYA 2FZ1A 3AP9A 1SLBA 1F31A 5T3NA 2GMPA 3I2KA 1VBB3 4LE3A 4AI3A 1QJX2 3N9QA 1IS4A 1L7LA 3U14A 2JE8A 3LEKA 1J3QA 2R16A 2RE9A 4P00B 4YARA 4HKOA 5IK7A 5KHJA 1VPHA 5GZCA 3OY8A 3I4IA 5DAXA 5C8CA 1LOFC 1PM7A 5I91A 3SITA 4MGQA 2Y26A 2XBO2 5AVAA 5FXVA 1RUD1 5IWFA 3PVEA 4A42A 4R8HA 2V73A 5I0UA 4YPJA 4QMAA 4XE9A 5F5IA 1DF0A 4R4XA 1R64A 2WWJA 4CDXC 5G04L 1W8ZA 5JCTA 2K9ZA 1DBNA 3P3PA 4E4HA 1BBT2 5HCHA 2QQIA 5FMCA 1NCQB 1W3XA 2XJTA 1QKQA 3ZN5A 2QDRA 5HV0A 1YXWA 1CAWB 3W9AA 4NHKA 3UGHA 1OVSA 2BGPA 4CE8A 2HWD1 4IDZA 1BEV1 1UIKA 1W0OA 3N7JA 4LR4A 1S55A 4WV8A 3RZMA 1GMMA 4TXWA 2DTWA 2JG9C 1PIV2 3VDDB 2FDHA 1UF2C 1WGPA 1RUF3 1H4HA 4YVSC 5EQUA 5JIUA 1OD3A 4FP2A 5F9TA 5LZ6A 5FJKA 2VMEA 4AVVA 4N53C 3LEGA 3OBAA 1RUC2 2ZGUA 4RD7A 4DINB 1YCIA 4W4ZA 1BQPA 2ZGRA 2GSYA 2QQUA 3ZFFB 2J1UA 1L3JA 1RB8G 1NCRB 2WA4A 2JG8B 2BTVC 1BZWA 2R042 4LOSA 5JVVA 4Z92B 4LHKA 4BZ4A 4NR1A 1CESA 2AENA 3T4HB 3WDVA 3AKTA 2Q5TA 2VXJA 1NAEA 4RR3A 1YUDA 2DUQA 4QWNA 1JYCA 5CFCC 2ET7A 5KC6A 1GWMA 4QKNA 1Q8VA 3FL7A 1UY2A 5C6CA 2PQQA 2WZPP 1E5RA 1SQ4A 2VU9A 4Y24A 1MS4A 4HMZA 1X82A 4Y3OA 3SLIA 1ONAA 3ZFGC 5I8YA 3LE0A 4MLOA 2QQNA 1HV1A 1IOAA 3VBOC 4K9SA 2R49A 3EXUA 3VZKA 3ABZA 5F2SA 3E6BA 5LY1A 4BIFA 4JC1A 4QKBA 3WF4A 4F8AA 2DVAA 2VG9A 4M0HA 4PIYA 2R30A 5CEHA 4JGZC 4AGGA 4XUNA 4AVCA 1NY72 2SBAA 1Q8PA 4O61A 4OI0A 3O0WA 2PAMA 2QJVA 2VBBA 2XGXA 3MUZ1 4KWLA 2Q1MA 1IKQA 1LKNA 3FHAA 3GF6A 2WYFA 5IVVA 1V6JA 4CCCA 5CISA 3KCXA 1QOOA 5A7WA 5C5UA 4JHZA 3MO4A 2BNMA 3SKVA 1MS1A 4JZRA 2ENRA 2Y33A 3R0RA 2ZGMA 5C71A 3TEWA 2J1SA 4Q27A 4ZY9A 5E88A 3H9AA 1IKPA 4D6SA 5CADA 2VBPA 3THDA 4YGCA 2ZHMA 3ZXKA 2HWE3 1YFWA 1Z0HA 4UBHA 4Q4W1 4LUMA 2E33A 4MH0E 2TUNA 5C9AB 4IE6A 5IVFA 3ZYRA 4XVHA 4CEWB 2WZR2 3CKHA 5DQ0A 3VGIA 3LKJA 3CDZB 1DGRA 1H8VA 3PURA 4P5HA 2YXSA 3GZTB 5ABJC 2RJ2A 1W9WA 2Y60A 3N4MA 4BYYA 2BEOA 1JUIA 3WDWA 1D0GA 3ZXLA 4YW6A 3H7YA 4IV1A 3WUCA 1CPNA 1QMJA 2A6YA 3LPFA 4FQ4A 4GB32 3WSOA 1Q43A 3H3UA 3RFRA 4K20A 4BQ3A 2BNOA 3PVBB 4Y4YA 4CU6A 5EIYB 5LEJA 2DVBA 5IUQA 1V00A 5FUPA 5DUXA 1LECA 1PM4A 1MR5A 1GOGA 2JDMA 4AVSA 1LHUA 4K21A 3MF9A 2BGOA 3NJYA 2WYSA 4DS0A 3VUOA 3H8RA 1QHDA 1D4M1 5C3SA 3VBFB 4D7YA 5I0SA 1YWKA 3OUIA 4GWJA 2HWC1 2UWAA 3GCWA 4YYOA 2VZOA 3MF6A 2VVDA 1FAYA 2E26A 1GOHA 2ES3A 1ND3B 1CIWA 1V6IA 1YEWA 1WA6X 2WS91 1BKZA 3OGSA 1SBDA 2HWD3 4XABA 1BEV3 4C0BA 3G7DA 1B09A 3ZN6B 3B94A 2ATFA 1F35A 2D44A 1MEC2 1LTEA 3KLSA 3RZLA 4QPGA 1W6PB 1GNYA 1G7YA 2YZ4A 3ASIA 5L9VA 2GNBA 2DTYA 1GV9A 1G8WA 1D2SA 1CGPA 4QXKA 1WLTA 4BK5A 4CUGA 4CCOA 2EAKA 3VD3A 2WNUA 1QJX1 3AJYA 4C0HA 1OQEA 4EN7B 5CNAA 1FI2A 4PQQA 2MEV2 2VW2A 3N9NA 4RYDA 4XETA 4CUCA 2WAAA 3DYOA 3GXUA 1CWPA 2PAKA 4MG2A 2DVGA 3BB6A 3SMHA 1W9FA 2XBO1 2VVFA 3MBWA 4RS5A 4CCJA 2DBNA 3MLKA 1VALA 1K5MC 1DQ6A 4NRMA 3VBRC 1OOPA 5FYZA 2VNOA 1NZIA 4HKLA 5FLJA 2ZX1A 3AKSA 5A1LA 1QXJA 1H2MA 3KVAA 4Z82A 1BBT1 1EAH1 2HH9A 1B35C 1U12A 4JGYA 4PT6A 2VMGA 4HSLA 3IDAA 5FZ6A 3M8LA 3BIEA 1LU1A 3I59B 4UFMA 3OGVA 3AYEA 5AVPA 1SDWA 4IGOA 2XOMA 4W6YA 1FV3A 4NROA 2VOVA 4ARYA 3LA3A 5IYYA 3H3ZA 4HLTA 3WUDA 1S2EA 3E1F1 3F2ZA 4CDWA 3WOGA 1PZ8A 3USSA 2BJSA 4CCLA 2D93A 2Z42A 2DU1A 2V5DA 5LK5A 5FP9A 1W04A 1GZTA 3BPZA 4J1WA 4AXOA 1UXZA 2JB8A 3GHMA 3MIBA 3JD71 4H14A 4JAAA 4OI1A 5C3QA 1VBA2 3OY8B 1NT0A 3TB0A 2WR9A 4AEDA 2R041 4UW4A 4NAMA 1ZZCA 2XJRA 4COVA 4Q4W3 1IZ3A 5FP7A 1RUH2 1PO13 4OYUA 4TWTA 1HRI2 2JD9A 3OD0A 3PU3A 3UJOA 1XYOA 4GQ7A 3DYPA 5J36A 5LA0A 4H7MA 2PHXA 1MPXA 1AXKA 5LRRA 2H6CA 5ERLA 3N7MA 4E4ZA 3DPRA 4GA9A 2BFUS 1H2NA 1ENSA 3R4DB 5BNPB 4XJAA 3H1MA 4Q0PA 2LALA 2CGNA 1YQCA 1RC6A 1GP6A 1RIRA 1SFNA 3KD4A 4K6BA 3D0SA 2RR13 4HPKA 1YQ5A 1EUTA 4LBMA 1NY71 4NE9A 4CDUB 2X8KA 3ACFA 5K4LA 1BK1A 3TBDA 2OYZA 1KJLA 3WV6A 1C5HA 2VQTA 2WSUA 4LBOA 3ZXJA 2RDQA 5I93A 4D8MA 2HYXA 1CVNA 5JSRA 1GZWA 3TEXA 1AR92 3HBKA 3CBNA 3T1MA 3UKVA 1SACA 2ARBA 3HNYM 2A3YA 3K77A 1UU4A 4KH9A 1MS5A 3H50A 2VMHA 4YW2A 4M4RA 5F3CA 4BQWA 5K0UC 1NXMA 5GZGA 2WS93 5FZGA 4WM8C 1HRV3 1OF3A 1XU2A 3VHRA 1ENQA 1GWKA 1SZBA 1MS9A 1UOJA 2ZAHA 2WZR1 4R4ZA 4BWOA 1DQ0A 5F6LB 2GALA 3POJA 4ZU7A 3NNFA 3B93A 4XIOA 1NE6A 4EE2A 5FOBB 5IT6A 3KGLA 2VTXJ 1JZ3A 1AX0A 1RXGA 2RV9A 3ILNA 3GZEA 1R1A3 1CJDA 4WVZA 2Y6JA 2CWSA 1QJX3 1UZYA 2C26A 3E5UA 4QX7A 4DB5A 3OGGA 2Y6FA 4L0PA 2LW8A 3LSEA 1EV11 3ZXDA 1JYNA 1OBNA 5FZ0A 5I0TA 1BLZA 1CJPA 1NG0A 3M3IA 5A33B 3WW1A 1OURA 1LR5A 1MZFA 3IT8A 2W3JA 4Y1YA 5FV3A 2B45X 1LGNA 2DUOA 1OVPA 2ZMLA 1OFNA 1NZCA 4I09A 3SKJE 2CU5A 1AVBA 2CDPA 1BBT3 1EAH3 4IXLA 5KHKA 5CA6A 4W6XA 4L2NA 5SV8A 4N43C 1QU0A 2JDHA 2EICA 2OA2A 2O14A 1XNTA 2W47A 1VBB2 4GZ9A 5FKBA 3SQOA 4DRRA 5EWSA 1GKBA 4RQPC 2CWMA 1N1YA 1OSGA 4BLJA 1GICA 4UFHA 2ZEYA 1KQRA 2QDNA 3T1LA 2VZVA 1MEC1 3BGAA 5HCFA 4GD4A 5JOZA 3WF2A 5F37A 1QEXA 4BQ1A 1JOJA 2JX9A 4IV1B 4FOVA 4NN0A 1T6GC 1S0BA 4R9DA 5LASA 1RMU2 1DDLA 1XU1A 3VD5A 3ZMOA 1QJFA 3AL6A 3JD73 5J48A 3J7LA 4KI5M 5TSWA 4M0NA 2VL4A 2VZRA 1W99A 4YVWB 2MEV1 5HXVA 1JZ6A 1VP6A 2VCAA 3FLRA 4IEVA 4UFKA 5T5LA 4PLOA 3M2MA 5A3TA 1UU5A 5JSOA 4QU1A 5FZEA 1OKOA 4LKEA 3GZUC 4B4RA 4ES8A 5LCWL 2CNAA 2WN2A 1LOEA 5F3IA 3J7NA 3B3QE 1SLLA 5JZGA 1LRHA 3AJZA 1Y9QA 3RYKA 2X10A 3WNPA 3POGA 3POIA 4IEZA 1WLCA 4DRVA 2GNTA 1ULCA 1GFF2 4ZXEA 4AW7A 1IPJA 3WX5A 3ZSJA 1GOFA 1W39A 1ZZ8A 3M70A 3Q8FA 5FOJB 2VJXA 4LHSA 3DXUA 3UESA 4LUKA 1OKQA 4QHBA 4FFHA 1QIQA 2VCCA 3N9LA 4Y1UA 2D6OX 5BY5A 5J7MA 2J1AA 2P3YA 1AYN2 3CL1A 1HN1A 1YFXA 1PNGA 3U1XA 3ZMNA 2XWBB 5FQ0A 2WNUB 2GZWA 3IAPA 3ENRA 4XF4A 3SH3A 1P8JA 3WEZA 4CU7A 3ZFEB 5HBAA 2YFZA 5FPVA 3WNXA 4TSVA 3VBSA 1VBA1 4HK9A 1AYM3 1FV2A 1ZNPA 1XSQA 5GZEA 3I2GA 1PK6C 3RNSA 4RHV2 2AH2A 5FZMA 3RZZA 2WFF1 4RS5B 4WVWA 3NO8A 1NA1C 2OS2A 1LOBA 3WINE 4FSJA 1SFYA 2YG0A 2HYKA 5A6XA 1RUH1 5C33A 2Q8DA 1U5YA 1ND2C 3UKNA 3PLQA 1HRI1 2A73B 2WRAA 2WZR3 3I2DA 1ULPA 4JGYB 1Y43B 4AGRA 3EMRA 1U5IA 3C7EA 3MIFA 4M4PA 4RFRB 3FC0A 4A2UA 3MIDA 3P1IA 1CIYA 2YROA 2NYYA 1WCQA 5GM0A 1BCXA 4CRQA 1SCRA 2YYOA 3HD8B 4MHUA 2IXKA 4F3JA 3KT4A 2B46X 1EV13 3PUIA 4CDWB 3PIJA 3LWCA 4KNCA 3SEPA 4BOWA 1AR82 1FNZA 2R1BA 4I0BA 2PHUA 4I0WB 4N9IA 1NCQA 1A8DA 4OVEA 2WBKA 4QU2A 3BPSA 4XXPA 3ZYJB 5B4NA 1CAWA 2JENA 4FPOB 4QDSA 2DCZA 1JODA 1AR91 1W05A 1XNAA 5FY0A 1POQA 4XAAA 2J42A 5A3OA 1G9FA 1UZWA 1SLAA 3UGGA 1J3RA 4R9CA 2X5IC 3GJAA 1UKRA 4FQZA 3EHKA 1PVXA 3VDDA 1G9BA 4LHNA 4AVBA 3DKQA 4INDA 1U5XA 1W6NB 2E7AA 3K4DA 2FZ2A 2EIDA 4EWEA 4S2GA 1UO9A 1LESA 4TLGA 3LEMA 3ZYFA 3DXTA 1VRBA 3L9JT 3CZUA 4QPWA 4XUTA 2XL9A 2XR4A 2W87A 3ZFFA 3L2HA 3MLLA 1RTVA 3JQXA 1HIXA 1NCRA 5EYYA 2Z69A 2JG8A 3I2FA 3AMNA 1WWYA 1WMEA 4HBNA 1GUIA 2X05A 1MZEA 1SCSA 3N3HA 1G9CA 2MEV3 1J1TA 2V5YA 4XDQA 4XUPA 1ZA7A 2ZEWA 1J58A 2ZGTA 2VY0A 3Q9OA 4NHMA 4U36A 5KXDA 1DZTA 2JIGA 1W8HA 3C2UA 3HWJA 3KF5A 4D0QA 1EUUA 5F7UA 2VUDA 2XVLA 2RS12 3FMGA 4FAHA 1IS3A 2OX0A 2P3IA 3ACHA 4GWMA 4Q4Y3 1TG7A 3ST7A 2BU9A 5DZGA 2EA7A 5C3RA 2IXCA 1N3QA 1RINA 4YM3A 1CX1A 3WQ1A 1ULDA 3NNGA 5EV7A 1OMIA 3VZMA 2W92A 1D2QA 2ET1A 3FE5A 4PDWB 4CCMA 1QF3A 1VBB1 1W28A 4PLMA 2F6BA 1HX6A 3WCRA 1UOFA 2GC2A 1VIWB 3POYA 2NMOA 2XVGA 1DGRN 3CJXA 5A80A 4Y33A 5L19A 2WO1A 4EWDA 5EYXA 2DCJA 4XUOA 2A3WA 2P1BA 4K1ZA 4DXRA 4HVQA 1RYYA 3DF0A 1RMU1 4XQWA 1W03A 4ZZ5A 4H3WA 1UL9A 1AX2A 4D6RA 5FYYA 1UPSA 2XJSA 1LENA 1VBA3 3DEMA 4LE4A 4CEWA 1H1IA 3LF7A 2WFF3 3VDCA 3D6EA 5C4WB 3UK9A 3CJIC 2VZ3A 1OXCA 2V72A 1RUH3 3CZJA 2Q8EA 2DVDA 1HRI3 4DEVA 2WNVC 3B9CA 4OI4A 4M3CA 4IGQA 3PVNA 2XH6A 2QQKA 2ERFA 1OA2A 5GLWA 4CDXA 2HEVF 4NPRA 1TQ5A 3OD4A 4B4PA 4XILA 3S57A 2XL7A 3S7IA 1XE8A 2JDPA 3CF6E 1FXZA 3D3AA 3B7MA 5FZFA 3T3YA 3ZR5A 1ODNA 3S6PA 2JIJA 3ORJA 4KWKA 5G05L 1FT9A 2AEZA 1GU3A 2WWSA 3D4KA 4W65A 4BJ0A 4XBLA 1AYN1 2UWCA 3H1YA 3VBFA 2P2KA 5GLVA 4Q4W2 4HONA 5A7NA 1Y9GA 1PO12 1ND3A 3WW3A 4IV3B 3KWVA 1AR93 4C1WA 1GANA 4JDMA 3FBMA 3LDKA 3ZN6A 1LGCA 3LPGA 4MXWB 4MV2A 3WP4A 5FR3A 5GLTA 1PMHX 2FDJA 2TNFA 4WVVA 3BTXA 4RHV1 3OF1A 1DZRA 1W6PA 2FQPA 3WDTA 1C28A 1TE1B 2XLFA 3APBA 2VNGA 3T2PA 1PO22 3NAPC 4KL1A 2OKXA 4OUMA 4MYEA 5JZGB 2XHKA 5IFPA 4OHVA 2RR12 3E6DA 4ITCA 2BPA2 3N9OA 5FZAA 1LB2A 4E4SA 4IEQA 3RYPA 3M3QA 3JU9A 4XFHA 5F5CA 1H6YA 5JR7B 4FTEA 1DIWA 4K8RB 1J1LA 1QNYA 2AUYA 1CR7A 2LS6A 3EBRA 1ACCA 1WA4A 4PJYA 4J6GA 5CFDC 3T2QA 3VBOA 5IVJA 2ZS6B 4R9AA 1ZBE1 4IEYA 5CZKA 4NVPA 4IEWA 2VE1A 4DXZA 4W6WA 4YW7A 2GN3A 3C8XA 1SBEA 3FLPA 1AR81 1HRV2 5DUVA 4XEZA 4NPMA 3C7GA 3CLPA 2ZZJA 4WM7C 5DABA 3I59A 5EPAA 1MQTC 1E5IA 5IW0A 4KG8A 3LIGA 3NW4A 4LA2A 5HCBA 3JQWA 3LSDA 4C8DA 1NE4A 1VAVA 4MSVA 4QAWA 5DXDA 4DNYA 2E51A 2BUKA 2E31A 1UYZA 2BBVA 4I02A 1R1A2 2WO7A 1DZQA 2W1UA 4CUBA 1ZRIA 1Q8QA 1JMUB 5JUVA 4D7SA 1H30A 4B3NA 2YC2A 1JU3A 1M06G 1YQ6A 2Z5WA 2WINB 5JOYA 4IE0A 1ENRA 2XJQA 3AKRA 1AL22 2X09A 4RN5A 4LBLA 4CXXA 5LATA 3M1HA 1RMU3 2P17A 4XCAA 4CYDA 1YYNA 5CKMA 1V70A 2NMNA 4AI9A 4I2OA 5F8PA 3VBHC 1NOVA 2EXJA 3AZVA 5FYBA 5C9AC 1EAH2 2KR2A 4XXAA 3BIWE 4Q5OA 2DV9A 5F5QA 3VZLA 1PVC2 1GR3A 4XFIA 2ZKNA 4L92A 1VJ2A 4XW3A 4DZGA 4XUQA 5LWBA 5BNPA 1SEFA 2BVVA 2RS11 1BVP1 1UPIA 2A5ZA 3BALA 1H0BA 5BNNC 1U0AA 2Z4FA 4LA3A 4RSUA 5FMBA 3UV9A 5J1XA 1JH5A 2FMDA 4AI1A 4JDOA 2RHPA 3U4SA 2QQMA 3WVJA 4CDUA 5FIXA 2BDRA 1AXZA 4MUVA 3TOJA 1N47A 1YHFA 1R093 4PIXA 3JD72 3M4FA 1ZM1A 1TMF2 2XJUA 4X6QB 4HSJA 3PJYA 3PMEA 3T4VA 3C7HA 4XQ4A 1AYN3 3FFZA 4MXVA 2FCTA 2JKXA 5ANNA 3VHPA 4ZPIA 1ENXA 2XJVA 1ODMA 4PI0A 1LODA 1XPWA 5FXZA 5LA1A 4BE3A 4HK8A 4LKSA 4YGEA 2VCBA 2YC4A 4QX1A 4UT5A 3WQ7A 4BQ2A 4DOUA 2VOTA 1ASJ3 1HDKA 5FZCA 4FO9A 1J83A 5LBBA 4L99A 5D21A 4RHV3 2GP3A 5IVCA 3OUHA 4NWWA 5E16A 5FREA 1RUE3 2VW1A 1AZDA 3ZSMA 3NMBA 2VECA 5CKNA 3PU8A 3VDAA 1S0DA 3QCWA 4IEXA 4CCNA 2ZHNA 4Y1ZA 4OHYA 3W20A 1K5MA 2I74A 3AMHA 2WZ8A 4LO7A 2LROA 4A7YA 3PJQA 3ACIA 4YFWA 5FMOL 1QWRA 1O3SA 2GNMA 1A3KA 2GC3A 1W2OA 4HL0A 1H8TC 2WKKA 3DECA 3FWEA 1V6OA 4IW3A 5A33A 1V6LA 3W21A 3ZYHA 5BNOC 1TVGA 3I2OA 2DFCA 1AYM2 1ZBE3 3OPZA 3PIGA 4CA9A 2V4AA 4D69A 1XNBA 3VBUC 1KJRA 3I97A 4E2QA 1G6NA 1AR83 3T09A 1C1LA 1I6XA 1W0PA 4A4AA 2VOKA 1PO11 4AHZA 1OLMA 2Y34A 3RJRA 1VAMA 4YZ3A 3VB9A 1HLCA 4AFCA 4ZXKA 3MIHA 4XJ8A 3ZIXA 4CDQC 1Q3EA 4NHXA 1XBFA 1MACA 1YJLA 2Q8OA 1UZVA 4XZPA 4Q2FA 3OYWA 1UQXA 3HIFA 4YM2A 3SC7X 3JUUA 4NIHA 4CEYC 3OBTA 3VKLA 1QGLA 1PO21 4CCKA 5FP3A 1EPZA 1K12A 4M3CB 3N7KA 4SLIA 2ADEA 4BM8A 1F9KA 3AMMA 2ZEZA 4AZZA 1EV12 2A6XA 2QNKA 2RR11 2J7MA 3A21A 2IXJA 4CDXB 5LBEA 1ULFA 2XVKA 2K46A 2ZMNA 4YVWA 1H1AA 2ZKLA 2A3XA 2D3RA 2QQOA 3OB8A 1R1ZA 4BQ5A 3RI9A 5C8CC 4V2WA 3OBZA 4LPLA 3AXDA 4A6OA 4GH4C 5HPOA 2BNNA 2E9QA 3LAGA 4E2SA 3LEIA 4JKMA 4ASMB 3CQOA 1MS8A 2WSVA 3A0NA 1A34A 3B9IA 2RDSA 2RM22 5FYTA 1W06A 2CV6A 2JICA 3Q8AA 1XOYA 1RUNA 1GQGA 2JG9B 1E57A 1HQNA 4YZ1A 5T55A 4YVSB 4MGKE 2ZAAA 1HRV1 2FCVA 2BFUL 5LW9A 4MOAA 2RS13 4N53B 1UYYA 4XJUA 1D7PM 5M0TA 4QQOA 5LBFA 1O59A 1RGSA 4BIOA 5D8AA 1H4GA 4R52A 4DY5A 3AX4A 4QB6A 2LRPA 1HXS3 2IVJA 3J4UH 1UMZA 4HZFA 1FOD3 4RGKA 3AKQA 1JZ7A 4QQ2A 1GNHA 1H2KA 2HBTA 1R1A1 3MHZA 2R7EB 2RDNA 3A0KA 2JB4A 4UFLA 5K0UA 2C9AA 1RJ7A 3RDIA 2JWPA 1PNFA 1YI9A 4COWA 4ET7A 4WM8A 4HOOA 1DLCA 3HNBM 3ZFEA 5CFCB 3LOBA 1COV2 4V1PA 5EXOA 1V6MA 3WQBA 2Y0OA 1AL21 3KSCA 3QBQA 5FMOS 5FZIA 3VKFC 4OQ8A 1QJU1 2WLPA 5FDBA 4IUGA 2WZEA 4Z2AA 3ZFGB 3O1MA 4IGPA 1W9TA 1JS9A 4JQRA 4ISRA 4UF0B 5I8SA 1W6QB 3VBOB 2BERA 4RA0A 4E8CA 2W52A 4Q0UA 4Q4Y2 4RR3C 5FPAA 3IAQA 3LZZA 3OPWA 3AVSA 2R0FA 4RL7A 2OQ6A 2AC1A 3AP4A 5EP9A 3ZLIA 4JGZB 1L7QA 3T2TA 1KS4A 2QE3A 1JW6A 1PVC1 4NRQA 4YG6A 2HKXA 3NV3A 3NJZA 1OPOA 4MGTA 4BK4A 1HJFA 1T2XA 1DQ2A 4D3WA 3RI8A 1BXHA 4Q1PA 1ZRCA 5CU1A 1LHOA 4AFBA 1C8M3 3IIAA 1S4CA 5L36A 2OXBA 4B7EA 3A22A 5JWPA 4FOYA 1WCDJ 2IXIA 4COZA 2DUPA 4TN7A 1XYNA 3QD6A 3P3NA 4UOJA 2YPJA 3ETPA 1SG3A 3HAGA 1AJOA 1ZRFA 3CU7A 4FPKA 1TMF1 4M00A 2GC0A 4UW5A 3MFCA 3NSTA 1SHWB 2D6MA 4OULA 5FUIA 2WFF2 4QQLA 1KS5A 4FTBA 1JZ8A 2V09A 4CU9A 5ABJB 2VAUA 1A8MA 4Y1VA 2ZHLA 1VAKA 1HB3A 5D1IA 2D6KA 2WT2A 4M3CE 4E2GA 1R081 2E7TA 1W6NA 2XKPA 2VH9A 3LB9A 4QPYA 2XQXA 4KG0A 4L8QA 4QQPA 4XF0A 5F6KA 2JDUA 1FMD1 1WCSA 3B69A 3ITQA 3AXEA 2HWB3 1XRUA 1D0HA 3ZX7A 4PCRA 1W8FA 3MDPA 5J98B 1F4HA 1S2BA 2W5FA 2WC2A 4Q1RA 3BI3A 1LU2A 1PO23 3HVDA 3OOXA 2O1QA 1TEIA 3OGJA 5IHRA 4LJHA 3K2OA 5KWRA 4IV1C 3U4XA 5IK5A 3WG4A 2J1TA 4XPVA 1AHSA 3AFKA 3WLUA 1XNCA 1MVEA 4QX8A 1LHWA 2RS51 5BPXA 3BU0A 4XMIA 4LO6B 3UJQA 3WNNA 2Y6KA 2ZACA 2ZMKA 2ZXQA 3DV8A 3ZDSA 1PGL2 4Q8KA 4LTAA 5DAPA 4GXLA 1QXPA 2ZX0A 1W90A 3BU7A 3C7OA 2ZGNA 1AYM1 3AC0A 2UY8A 1QY4A 4H2AA 1NX9A 1XXNA 1GNZA 2IXHA 1LHNA 1OA4A 1XC6A 1QH7A 1W6MB 3K48A 3MW4A 3OSDA 1V6NA 4PDWA 1QQP3 2EXKA 4C1XA 2D5FA 5DAQA 3W5MA 4QHZA 4UI9L 4LORA 4NHYA 5FY7A 5JMCA 2GMEA 3RWKX 3SHRA 5CAZA 4QPGC 1JTZX 1A78A 2Q1ZB 2WT0A 3E5QA 3H3LA 3MEPA 2WT1A 5EJ3A 2A6WA 1PK6A 2BOIA 4BQYA 5B2GB 4COUA 1WMDA 5L73A 3OBRA 1O5LA 4N90A 5GZFA 5F1RA 2XXZA 1K5MB 1YI7A 1NA1A 3VBRB 5BNQA 1VMFA 2R061 1IS5A 3KV6A 3QH6A 4ZS2A 5DUWA 1AL23 4JKLA 4MADA 4DUXA 4Q0SA 2B8MA 1QJU3 1O4YA 1H9PA 1XSRA 1S0CA 4XURA 5IFTA 4DFSA 1B35B 1UY3A 5DZFA 2OPKA 3NWKA 5C4WA 3RS6A 3INAA 3THCA 3R6SA 1UU6A 1VB2A 4RS5C 1YIFA 4N8MA 1OOPC 1GBGA 1V6KA 2E6VA 2RJKA 4XMAA 4AK3A 5BYNA 1SFPA 1JYTA 3B00A 2FD8A 2RM21 2FDGA 3W5NA 3ETQA 3C3VA 4FXKB 4AQSA 4Y20B 1PVC3 3UKTA 2FDFA 1KRIA 3P6BA 4P9WA 1QXRA 4F7ZA 5C70A 4XF9A 1CZSA 3B01A 2IVIB 4LO8A 3WY6A 4YLZA 2WA3A 1UXXX 3PTRB 4B4QA 3K51A 1IS6A 4LK7A 4I01A 5J3UA 3OYWB 5E1RA 3MZHA 2WQZC 4HN0A 4LBQB 3ILFA 2IZWA 1BYHA 4LITA 5FZ3A 5FYHA 1PHMA 3LGRA 4XZUG 2P6HA 2QVSB 5FLHA 4K40A 4GMP1 4E8DA 2WWUA 5LEKA 3HR9A 4K7JA 3WXPA 1WW5A 1CQ9A 2VULA 1TMF3 1ZZBA 2PYTA 4IV3A 2KM2A 2QKDA 3J8F3 1X36A 1COV1 4AEDC 3V64A 4MXWA 3THTA 5I0RA 3WR0A 2ZX4A 3I3BA 4B1LA 1X8MA 1F4AA 3U0ZA 5C3OA 5LK7B 5FZ1A 3H8XA 1R083 3VHOA 2XUEA 3JB4C 3BKZA 2ARCA 4Q4Y1 4L11A 1ZRDA 4HN1A 4XC9A 1FMD3 3VZOA 2YFUA 4ASLA 4AGVA 3CMGA 2XDVA 3AMPA 2VD7A 1KDMA 3DPRC 3LDBA 1CX4A 5FZKA 2ZGKA 1R092 5T54A 3V65A 2FCUA 1SDDB 3KHBA 1SLCA 4AAXA 2YBSA 3ES1A 4IL7A 4UFJA 2BW8A 5D8AB 1OQ1A 2EIBA 1LULA 4HVRA 3OEAA 1U5ZA 1Y4WA 2RS53 1RUJ2 3NV4A 5FZOA 2ETEA 3AB0A 3WF0A 1RUG2 4N9HA 2WNEA 5K0UB 3M7AA 5L9RA 3O12A 4TYSA 4WM8B 3VD7A 3S5QA 2XLAA 1Z78A 4XFCA 4LBKA 3GDBA 3VKOA 1ASJ2 2NZ9A 4A3XA 4MHRA 3GBFA 4CCDA 2W2IA 4QX2A 3I49A 2BZDA 4XDPA 2FBEA 5EFUA 2XJPA 3GCXA 5DAVA 5JAXA 3VD9A 1HJGA 2VGDA 4XJZA 2WAOA 1RUE2 5GLUA 1YRZA 2VZQA 5LB6A 2HEYF 3FLTA 3HMYA 1FPN3 2RDRA 3MPBA 3PUHA 4AL9A 3JB8A 4YW5A 4AWDA 2BRTA 5A32A 4QXBA 1HKDA 4AAPA 5L7OC 2VUCA 1S0GA 2AACA 3ZR6A 3I8TA 4IE5A 1N1TA 4A41A 4LNVA 1DG6A 3O14A 5FCCA 4A7ZA 3RZJA 3QACA 4Q4X3 1TZOA 3NKGA 3RRDA 3EO6A 2O0OA 4FP3A 1UZ0A 1ZBE2 2R063 3M3CA 2W08A 3KQ4B 1S0JA 4GMP0 3RYRA 3PVOA 3LCPA 5A3WA 4H7LA 4EN0A 2WNVA 2X29A 1WKYA 2YBPA 3V0AA 3ZPYA 1VBD1 2PLV1 2QFEA 1EP0A 5I0DA 2FDKA 2ILMA 3O1TA 4N43B 4A45A 1OLME 3HN1A 3TRSB 1PGL1 1F8VA 4OZXA 2AEYA 2V4VA 2RM23 4CP0A 3H8UA 2D6PA 2ZGSA 2ZA9A 4XFBA 4XFAA 3MI8A 3WZ1A 3IIIA 3LDRA 3LOIA 1PMIA 3B02A 2HLEA 1DQ1A 2BGCA 2JDKA 4YW1A 2RJLA 3RJ2X 5EHDA 4CVUA 1DYPA 2J1VA 1GYKA 4QHOA 5E89A 4NIIA 2YC0A 4CP2A 1TME2 4H55A 3LD8A 4QB1A 2VBDA 4SBVA 3AVRA 4Q26A 2VMFA 2D40A 2YBKA 4HFSA 3CIHA 4GMP3 3IDBB 3WG2A 2OQ7A 3HQXA 1JHNA 3ACLA 1NQJA 4NOTA 4PBPA 4XJ9A 1CAUB 2W91A 5FY1A 1CD3G 3ZYIB 1H6XA 5T5OA 5FP8A 5FY5A 4QGNA 4NMIA 4Z2WA 1COV3 2R073 3FJSA 3D5OA 2QCSB 1JOBA 3HEIA 1RVF1 1GLHA 5LA2A 2VO5A 1UKGA 2CSGA 1LOCA 4BQ4A 1FX5A 2C6SA 1KXGA 3BOWA 5FLIA 1CAVA 2F17A 2W68A 2GH8A 4QPIC 1HXS2 3ZSKA 1IPSA 1FOD2 2B9UA 4A7KA 3I2HA 4URAA 1YFUA 3VN4A 5FPXA 3R4UA 5IVEA 3O1OA 4Y4RA 4XBQA 1JU4A 2VUAA 3VL9A 3K46A 3WHTA 2DCKA 2G9FA 3RVHA 2VXRA 4Z8BA 4WM7A 1DFQA 2VTXA 3I3QA 4IEPA 4OLLA 3SH4A 2R0HA 3KCCA 3W58A 4A6SA 3IN9A 2OZJA 1MQTA 1S2KA 1T6BX 1PK6B 4GWIA 3WF3A 4ARXA 5IK4A 3J7HA 1Y7BA 4JVAA 3T2OA 3WDYA 2BVBA 1MS3A 2C4XA 3ES4A 4JV4A 1Q8OA 1HB1A 1W8TA 3SEEA 4QB2A 4BA6A 1NA1B 4C90A 1X9TA 3BODA 2WJSA 4HT1T 2ARXA 4YFZA 1ND2B 3Q8EA 1BHGA 2YB7A 3AYCA 3FHIB 3VBSC 3WNOA 3AYDA 1PMJX 4IEOA 3IZOA 1LCLA 3VZJA 4CUAA 5C7GA 2BP6A 1E5HA 3HT1A 1QDCA 2VC9A 4S2FA 4Y5TA 4P9IA 4P14A 2WN3A 4CCEA 1YC61 1LOFA 1CZTA 5JXGA 1OT5A 1DLLA 3ZOIA 4AE2A 1C8M2 1ZZ6A 4YGBA 2BOJA 2E32A 2C1FA 4Q4V3 1IG3A 4KGGA 1UAIA 4AFAA 1XB9A 2VNRA 5A6YA 3ZSEA 1VRH3 5JXHA 1C4RA 4EWAA 3FN9A 3IMMA 4ZHNA 1R091 5FO8B 4AR2A 1RITA 5FTTC 5ACA2 4U2AA 1VMHA 3GZAA 4DUWA 2C5DA 3ATGA 5JLVA 4GJZA 4ZU5A 4AQ6A 1AL0G 1YJKA 1X9PA 3VHNA 4XHBA 3BTYA 4FPHA 4LLOA 2WO2A 3RZGA 2DDUA 1AR71 1RUJ1 2X5IB 4FFGA 1W6OB 1O3QA 1RUG1 1VBD3 2OT7A 2JG9A 2PLV3 2ZABA 2JE9A 4LIVA 3S0MA 1IGOA 3N35A 1NCQC 4YVSA 1XYPA 5DG1A 5H9SA 1O3TA 4P9LA 4FPLA 3ILRA 5AC92 3MYXA 4N53A 1VB4A 5FO7B 2LUWA 1ASJ1 4I3GA 1JZ4A 1DYOA 2HWB2 3EYPA 1LNSA 3KQRA 3HT2A 4IETA 4IESA 3VDDC 1VR3A 5E8AA 1V9U1 4NIAA 2EXIA 3IWZA 5F5AA 4Q0VA 2RVAA 4LMFA 3URFA 1RUE1 3OJBA 3SH5A 2A70A 1SPPB 3HQUA 3KMHA 1ZZ7A 1S0FA 1D4VB 1POV1 3IPVA 5CFCA 4XCBA 3ZFFC 1EPWA 1NCRC 2JXAA 1DQ4A 2JG8C 2VNVA 2DVFA 3WNLA 1LAJA 3T0DA 3IM0A 3PMSA 1LOAA 3ZFGA 5K9YA 2IUWA 4UF0A 2QZ2A 4DIQA 1W6QA 4DEQA 4UAPA 5GALA 5FZOB 2QTWB 4AI0A 4QM8A 4URTA 5T50A 3PL0A 1UCXA 1V0AA 1O8SA 2W1QA 3WG3A 2AGSA 2R32A 1RVF3 3J26N 1W9YA 4JGZA 2G4IA 4UWDA 4AHXA 1XE0A 3LFIA 2Y38A 1EY2A 3I3EA 4EJRA 3HBZA 4MGIE 5FZDA 3CEWA 1UIJA 5F2WA 2E53A 2E63A 1QQP2 3USUA 5F3EA 2DURA 2JDZA 3WT3A 4IE7A 3BUCA 1UZZA 2Q30A 3FUOA 3NNMA 3WNKA 5FK8A 5BNOA 4OFGA 1ZYBA 4BXFA 1WW7A 1OLRA 1WBLA 4ATFA 5FAXA 1VBE3 2RMU1 1LGBA 4FCAA 5FYCA 4DQAA 5J96B 1ULEA 2J22A 3OPTA 4KBZA 1KITA 3PTYA 1WCUA 5A7QA 2JD4A 1DHKB 1TME1 2UY9A 3AK0A 4NWVA 1QJU2 4KU8A 4GULA 5EJZB 1MZ6A 3ZYGA 1KGYA 1I5PA 2GC1A 5JIAA 2CDOA 2EALA 3UETA 3O0VA 3VZNA 5ABJA 1I5ZA 1NLQA 1WMFA 4YZ2A 4XBNA 1QJY1 2QQLA 2PHFA 2WNVB 2Y64A 3V0AB 2UYAA 2O8OA 4CTEA 4CEWC 4PLNA 2WQ4A 3H1WA 4KMQA 5B4XA 1WCKA 4OHZA 2VW0A 5CG8A 5DMYA 1VLNA 4AI2A 2BQPA 3AZYA 1Y9MA 2NN8A 3WD5A 1PZ7A 5A7PA 3ELNA 4GH4A 1IG0A 4YW3A 2XMLA 2VOXA 2F4PA 3JBG2 1GQHA 1C1FA 1HXS1 1UY1A 4ZKTB 1FOD1 1HN0A 2E7QA 2PAEA 1HW5A 2JDNA 3PUAA 3KB5A 1PGW2 1LJ7A 4EN8B 3NV2A 3A23A 2HBUA 2JE7A 1POV0 1OPMA 3AZZA 3T30A 5JMOA 2LM3A 3J8F2 3O1SA 2PXJA 3BYWA 2WQ8A 2X53S 4EZHA 5FZLA 1X33A 3WW4A 1OF4A 1AR73 1RUJ3 2N7GA 4GIQA 2OW4A 1O4ZA 1RUG3 2WFPA 2B39A 3D0JA 2MHFA 3FUQA 3JXSA 4G3YC 3VBFC 5JOXA 1WZXA 1ZBA3 5FXWA 2ZZQA 4P9YA 4EROA 1F5FA 5LBCA 1PZ9A 5FPLA 3NAPB 3U75A 1ND3C 1R082 4OCTA 1J84A 1H2LA 1I9RA 1W6MA 2YV8A 3MW3A 1FMD2 4Y5Z0 4Y22B 3WP5A 2K0GA 4Y5SA 5GZDA 3OUJA 4P9GA 1JYVA 1W2TA 1V9U3 4G4FA 3U10A 5JR2A 3RG0A 1O8PA 2D6NA 2H6BA 3WNMA 3MFAA 4ORFA 3LA2A 3NJVA 4OZOA 4L97A 2BV4A 1CAVB 4QGMA 4DY3A 3HQRA 2PHDA 1TNRA 2Z79A 4W8JA 5CFDB 1POV3 1C8M1 3VBRA 2EAAA 5JDBA 1IQDC 2RS52 5IJRA 2ZTNA 2ZGPA 1K5JA 5FWJA 3AM2A 5FFOC 5IVYA 3ZSLA 2W0XA 1B35A 3JCIA 3U11A 4QQHA 3BCWA 5ACA1 4WM7B 4LIUA 1N1VA 4CP9B 3DL3A 5E6HA 5IAVA 1AR62 4XAEA 3Q8CA 3V0BA 5DZEA 3I54A 4HETA 1LOGA 1MQTB 3UNPA 3M3EA 3NNLA 5FY9A 4A44A 4ZONA 4LT5A 4OHWA 3ZVXA 1OUSA 4OQ9A 4Y20A 1CPMA 3NKTA 5JI7A 3L2YA 1FPN2 5JOWA 5JPNB 5AC91 3UL2A 1X7NA 3H0OA 5D2AA 4NUBA 2VQAA 2HWB1 5A6ZA 5FYVA 4C91A 1DP0A 3DKWA 4LBQA 4YRDA 5DAWA 1Q5OA 3LIHA 2PQSA 1QNWA 2XONA 1MS0A 4BH9A 2BWCA 3AZXA 2RMU3 3U37A 2QQJA 4Q4X2 1W8UA 4CP1A 1G86A 2GU9A 3JZVA 2TEPA 2DCYA 3KV5A 4W50A 2R062 4Q8LA 3GM8A 4WVMB 4BB3A 3MIGA 1TME3 1UY4A 3VBHB 1YFYA 4DXTA 5FBJA 2W1SA 4JTOA 3D82A 5FKCA 1UN1A 2CL2A 3KGZA 1CONA 4AQ2A 4E4DX 2ZBJA 4GAZA 2VZPA 3ZXGA 2W39A 1RUI3 5BUVA 2PHRA 1QJY3 3GBWA 5DN2A 1QH6A 3DUIA 4K8FA 4ONUA 4PIZA 5BNNB 5CVRA 3EJKA 4PHZA 3RSJA 1UYPA 5FYSA 1W0NA 1YQ2A 4MVTA 3POWA 1S1AA 4X8NA 4GJYA 5CG9A 4FPCA 4NJ4A 1WW6A 4R9BA 1VBC2 2ZGLA 4LLFA 1UD1A 5BNPC 1QQP1 2OUHA 3O0XA 5H9RA 3BN6A 4LBNA 3Q8BA 1RUD3 1APNA 4RFT0 2WO3A 5DUUA 3WG1A 4BLIA 5HCAA 5A3UA 4D6QA 1ULGA 2P4EA 3I2JA 4NHLA 4Q0QA 4CDUC 2F4LA 4FPJA 4BMBA 4QDRA 4P02B 3BTAA 4FPEA 3ZKYA 4XQDA 4TTGA 1OI6A 2QZ3A 3HJRA 3J7MA 2B5HA 3IPVB 3WDXA 3IDEA 2D98A 1KD7A 1BJQA 2QQWA 1GP4A 3WP6A 1N1SA 2R072 4UFIA 2WABA 4XFGA 3GBGA 5CYYA 2A71A 5JXIA 3EB7A 1BMV2 1IPKA 2YU2A 4BISA 3QLQA 4YM1A 2D97A 4P9XA 1SBFA 5HXMA 4CXYA 4JKKA 2W9XA 2VPVA 2JDAA 1URXA 2C9KA 2VVEA 4K1YA 1ZX5A 2BYVE 2YPDA 4YM0A 1GQPA 2A6VA 2RS32 2H0BA 1UW8A 1NUKA 2ORZA 4UBGA 5FRAA 3PUQA 3NV1A 3HPNA 4CZSA 2PMWB 1CAXB 2R6QA 2SLIA 3USUB 3WDUA 2TBVA 2DFBA 2XB6C 1F2NA 4UW3A 5A3NA 1RUOA 1RHI2 3HOBA 4FPYA 4FXGB 3AP7A 2QBXA 2VCMA 3OGRA 5LRSA 1H8TB 4JCKA 1GZ9A 4AF9A 1Z7S2 5BNOB 2YMZA 2WNOA 2XHNA 3JBG1 4XFFA 5FZ7A 2UWBA 4AYUA 3VBUB 5DG2A 4JRAA 4BU2A 4AVAA 4AQTA 1PGW1 4I30A 2CTVA 3VKNA 4UXAA 1Y3TA 4AHYA 5ACA3 4N43A 3F95A 2L9LA 1JYXA 5H9PA 3POFA 2WDBA 3J8F1 4V2VA 5H9QA 3POBA 1NYWA 3LFMA 1REFA 4RQPA 4CPBA 2KD7A 2WLQA 4YZ5A 4CDQB 2XPJA 1QJEA 3TAYA 2Z2SB 1N3OA 3S30A 5A3LA 3TEYA 3E6CC 3IB3A 2HWF2 2GMMA 3PUSA 4RGGA 2D43A 3ME2A 1W2AX 4AOCA 4FFFA 1PIV1 4CEYB 1LHVA 5I8TA 4YG3A 3NNJA 5AC93 3HNMA 2VZUA 1N3PA 3HN3A 2DYCA 5A32B 1PGSA 2B42B 2IFRA 5KHIA 2VMCA 4B29A 2XKOA 4Q4V2 1RUC1 3RQ0A 1UMHA 4ATEA 3S5AA 5KHHA 1RXFA 2P3KA 5LY2A 3DGTA 3RPQA 4YNIA 1VRH2 5GKAC 3ACGA 2B9VA 2DF7A 4IE4A 3AFGA 5C8CB 3UGFA 4GH4B 5CBLA 3ROUA 3N9PA 5FZ9A 1OA3A 1FNYA 1CAUA 4IEUA 4LO5B 2PHWA 4AI8A 1REEA 3VDBA 1OUXA 4FPGA 2A1XA 3T08A 4YVWC 4NPLA 1JZ2A 1VBD2 2PLV2 2ZHKA 4Y26A 2IFWA 5KR7A 3LA7A 2I07B 1JHJA 3CNAA 2WIIB 3ZXAC 2MPFA 3IKWA 4HANA 2VR4A 4OUEA 3O5SA 2VQUA 1KDKA 1K45A 2G1MA 2XLGA 2I45A 1AR61 4Y1XA 1O6UA 1US3A 3KV9A 3KT7A 3KT1A 3MLJA 3A4UA 5A7SA 4PF1A 2ZGOA 2W46A 5FYMA 1IQAA 3TN92 3IBMA 3U07A 2Y6HA 5T52A 4IQPA 5FZBA 1O3RA 1FPN1 2JEMA 1QOSA 3ZN4A 3MV01 4QKFA 4FI9A 4MO3M 5D8AC 3H8OA 4MGSA 1SMVA 4DXSA 1YNAA 1K3IA 2KA3A 2IC1A 2Q1FA 1D4M3 1G9AA 2VTFA 2HWC3 2O8QA 4KBBA 4JX0A 4Q4X1 3K3NA 2WNUC 2KXLA 4RR3B 3ZFEC 3OCPA 1ND2A 1CN1A 5HI0A 1G9DA 4XTPA 2NM1A 2P3JA 5DDJ2 3RGBA 1RVF2 4BXSV 1YQ8A 4LEJA 1LEDA 5FK7A 5BXXA 1MVQA 5L7OA 4YZ4A 3V0BB 1JUHA 1GSLA 3I3MA 2D3SA 4OMDA 5FYIA 4ES9A 1H1MA 3E5XA 3KHCA 1AF9A 1DGWA 4XOGA 5T5PA 3GYDA 2CGOA 5HV4A 1ZRRA 2J1RA 1DQ5A 2EIGA 2UU8A 2Y6GA 1C5IA 4JGYC 1JI6A 1HB4A 5A7OA 2GH2A 4GB31 2FHRA 1VBE2 3GNEA 3KS7A 3E97A 3KM5A 1VBC1 5KXCA 4PF5A 4PBOA 4EN9B 4GALA 3RMXA 2AR6A 1UOGA 3A7QA 5A7WB 3RZHA 3GALA 3AL5A 3WCSA 2A7AA 2XBO3 3ZYBA 2P34A 3AZWA 3B5LB 3JBG3 5IAXA 4FOWA 1VMJA 1Q8SA 4DMIA 4PQ9A 2D7FA 3MIEA 4CDWC 4E9KA 1XNDA 1F15A 2VMIA 2X5IA 1W6OA 2W95A 2P5BA 1WD4A 4LK6A 3T0BA 4I3PA 4JRLA 5FUNA 3DN7A 2HJIA 4JDNA 1W2UA 2NLRA 1C57A 1I3HA 2ID4A 2Q4SA 2UURA 4QXCA 3SNMA 3KCYA 1UYXA 5FWEA 2R071 3O1RA 4AG4A 5F3GA 4BDVB 2I2SA 4KWUA 4B8EA 4OHXA 4XYXA 4BPZA 1ALYA 1ZZ9A 5FXXA 1PIV3 2A6ZA 5C8WA 1BMV1 4LKDA 1WMXA 4P9JA 3WQ0A
chains in the Genus database with same CATH topology
2PA7A 4XTMA 3PHMA 4FT8A 5AFEA 4O9GA 2MNGA 1A6CA 4IERA 1RUC3 2RS31 1TNFA 4KU7A 2DCTA 3IMNA 4N7IA 3TYJA 5KXEA 5SV5A 1DU3D 1XQNA 1NQDA 2PHLA 3QOPA 2R043 3X29B 4FVVA 1RHI1 2H0VA 2G9GA 4I0AA 3FZ3A 1Z7S1 1AR72 5GLZA 1RL3A 2UYBA 4UW6A 1ZBA2 4K3UA 4QPIA 1RUF2 4QM9A 5FO9B 1ZVFA 1QOTA 1AR63 2QUOA 1WW4A 2YGMA 2CAVA 4AEKA 2YHJA 2GDFA 1V9U2 4FTSA 1OHFA 3MPPG 1C8NA 4QPGB 2HWF1 1O4TA 3MGUA 4ZU4A 1RJ8A 2AZ5A 4PDWC 3AP6A 3GHNA 2XWJB 2NQYA 3TWIA 3SISA 5IK8A 2DWRA 4BMEA 4Q4V1 4LHLA 4YW4A 5KC5A 4TLFA 1VRH1 4FOQA 4OUSA 3ZO0B 2OZ6A 3I7DA 4G9SB 4QGLA 5FBZA 3ALQA 1MZ5A 3CJIA 1WUVA 1OOPB 4N7UA 3WHUA 1UX6A 2ZGQA 4LBJA 3ZXFA 1C3HA 1HQLA 4GWNA 3TNPB 4JTNA 4F83A 5C4WC 3MW2A 4GKXA 4KQ7A 5A3MA 3NL1A 4RQPB 4XHXA 5BV6A 3S7EA 2CYFA 1KFXL 2VQ0A 3AYAA 3VL8A 4GKYA 2YDEA 1WD3A 2AYHA 4GB33 5K8SA 2RMU2 3TN91 4WBBA 1VBC3 3IDCB 3M3OA 2HWE2 5T5JA 3EQEA 3RWNA 4L9BA 1AJKA 4EV0A 3N36A 4O9EA 3G6JB 3NVCA 4QD2A 4BHPA 4AEDB 1I1EA 4COYA 4YG0A 1RUI2 2OIIA 4YSFA 2YGLA 1BVVA 1QJY2 2EF6A 3NAPA 3O7OA 4IV3C 4Y22A 4FAGA 5DDJ1 1FATA 5CIRA 1MEC3 2A75A 3DPRB 1QDOA 1X8EA 2GNDA 1RUD2 1O7FA 1REDA 2RS33 4LBQD 5JZGC 2DU0A 4QT6A 2D5HA 5CFDA 3H7JA 1SLIA 1NLSA 2BWAA 4HPKB 1OFSA 1WLWA 5GJ6A 5JI9A 4DPNA 1VBE1 4X8PA 3FX3A 1RHI3 2PELA 4D7TA 4AFDA 1GZWB 4WZCA 1Z7S3 2HWD2 4AEJA 1BEV2 1JXNA 1DGLA 1S0IA 2OVUA 2PHTA 3QH7A 1M4WA 1ZA4A 3FBYA 4X6RB 3RMYA 4HVOA 2ZCWA 4WZFA 5KBFA 5J37A 3SCHA 2CY6A 4OI2A 5J09A 1F5JA 4XF3A 1KFUL 1QJZA 3VKMA 2D3PA 5KXBA 5L7OB 2HWF3 3V56A 4BCUA 4NO4A 4LO4B 5AFBA 3BOPA 2P37A 2IWGB 2D6LX 2PFWA 3VLBB 4MX3A 4WVMA 2NP0A 2GAUA 1XNKA 5FPZA 4AHWA 3VBHA 3OTFA 5C9AA 5CB7A 1XE7A 1AXYA 2JECA 3TNQA 2QQPA 5KHGA 1O91A 1JYIA 4AVTA 1YO8A 4XJWA 1YLLA 3W59A 1X50A 1EYBA 2ZX3A 3ECQA 2VUJA 2IXLA 2K2SA 4EN6B 4M01A 3R05A 5BNNA 1Q56A 1LEMA 1JN2P 4S2HA 1OD5A 1ZBA1 3FFQA 1OQDA 2PN5A 4META 3ZIWA 4J1XA 2CAUA 1RUF1 2ZJCA 5EZWA 4HKWA 5JSPA 2C0ZA 2YY1A 2CGPA 4FBFA 4XIKA 3WP3A 2ZPXA 3ZYPA 1HV0A 2XUMA 2JJ6A 3AP5A 1DYKA 3MICA 5K7PA 4FPFA 4MGYE 3TN93 2ZX2A 2Q0AA 1FYUA 4QX5A 1AUYA 4AVVA 3SCGA 4D94A 2OUJA 4MGZE 1J3PA 1JBCA 3D8CA 4KWJA 3SXWA 2NPIA 4M3CF 4Z07A 2B7YA 3CO2A 3AMQA 1ZREA 1DGWX 2YUEA 1H9WA 1S0EA 3PNAA 4LULA 3N7LA 4S2DA 4YGDA 3THPA 1IHMA 1WBFA 4XF1A 3VV1A 4AFMA 2JKBA 5DDJ3 1YIPA 4QPIB 1WLDA 1CAXA 2GN7A 2ZOEB 2WL1A 1HQWA 3KZ4C 3J9SA 2Y0IA 3AKPA 4ISQA 2EXHA 1H8TA 2PTMA 4MZUA 5JPMB 3SCFA 2VOWA 4Q29A 2R1DA 1AX1A 1D4M2 3VBUA 2HWC2 3POSA 1OLQA 5FQ0B 3WW2A 2HWE1 1O5UA 4RGAA 4E27A 2WS92 4Z1VA 2AREA 2EVXA 1SLTA 2XG3A 2FMYA 3VBSB 2LTNA 1NLRA 1NXD1 4CDQA 3ZXEA 4AEMA 4KGQA 3CJIB 3R4SA 1GZCA 4B7KA 4TZDA 1RUI1 2HEWF 4CEYA 2FZ1A 3AP9A 1SLBA 1F31A 5T3NA 2GMPA 4AI3A 1VBB3 4LE3A 5A32A 1QJX2 1IS4A 1J3QA 2R16A 2RE9A 4YARA 4HKOA 5IK7A 5KHJA 5GZCA 3OY8A 3I4IA 5C8CA 1LOFC 1PM7A 5I91A 3SITA 2Y26A 2XBO2 5AVAA 1RUD1 3PVEA 4R8HA 2V73A 5I0UA 4QMAA 4XE9A 1DF0A 4R4XA 4CDXC 5JCTA 2K9ZA 1DBNA 3P3PA 1BBT2 1NCQB 2XJTA 1QKQA 3ZN5A 2QDRA 1YXWA 1CAWB 3W9AA 4NHKA 2HWD1 1BEV1 1UIKA 1W0OA 3N7JA 4LR4A 1S55A 4WV8A 2DTWA 2JG9C 1PIV2 3VDDB 1UF2C 1WGPA 1RUF3 1H4HA 4YVSC 5JIUA 4FP2A 5F9TA 4N53C 1RUC2 2ZGUA 4RD7A 4DINB 1YCIA 1BQPA 2ZGRA 2GSYA 3ZFFB 1L3JA 1RB8G 1NCRB 2WA4A 2JG8B 2BTVC 1BZWA 2R042 5JVVA 4Z92B 4LHKA 4BZ4A 4NR1A 1CESA 2AENA 3WDVA 3AKTA 2Q5TA 4RR3A 1YUDA 2DUQA 5CFCC 1JYCA 5KC6A 2ET7A 1Q8VA 5C6CA 2PQQA 2WZPP 2VU9A 1SQ4A 4Y24A 3SLIA 1MS4A 4HMZA 1X82A 5I8YA 1ONAA 3ZFGC 4MLOA 1HV1A 1IOAA 3VBOC 4K9SA 2R49A 3EXUA 3VZKA 3E6BA 4BIFA 4JC1A 4F8AA 2DVAA 2VG9A 4M0HA 4PIYA 2R30A 4JGZC 4AGGA 4AVCA 1NY72 2SBAA 1Q8PA 4OI0A 3O0WA 2PAMA 2QJVA 4KWLA 2XGXA 2Q1MA 1IKQA 1LKNA 3GF6A 1V6JA 3KCXA 1QOOA 2BNMA 1MS1A 2ENRA 3R0RA 2ZGMA 4Q27A 5E88A 3H9AA 1IKPA 5CADA 4YGCA 2ZHMA 3ZXKA 2HWE3 1YFWA 1Z0HA 4UBHA 4Q4W1 4LUMA 4MH0E 2TUNA 5C9AB 3ZYRA 4CEWB 2WZR2 3VGIA 3LKJA 1DGRA 1H8VA 4P5HA 2YXSA 3GZTB 5ABJC 3N4MA 4BYYA 2BEOA 1JUIA 3WDWA 1D0GA 3ZXLA 3H7YA 4IV1A 3WUCA 1CPNA 1QMJA 2A6YA 4FQ4A 4GB32 1Q43A 3H3UA 4K20A 2BNOA 3PVBB 4Y4YA 5LEJA 2DVBA 5IUQA 1V00A 5DUXA 1LECA 1MR5A 4AVSA 1LHUA 4K21A 3MF9A 4DS0A 3VUOA 1QHDA 1D4M1 3VBFB 4D7YA 5I0SA 1YWKA 2HWC1 2UWAA 4YYOA 3MF6A 2VVDA 1FAYA 1ND3B 2ES3A 2WS91 1CIWA 1V6IA 1BKZA 1SBDA 2HWD3 1BEV3 4C0BA 3G7DA 1B09A 3ZN6B 3B94A 2ATFA 2D44A 1MEC2 1LTEA 3KLSA 4QPGA 1W6PB 1G7YA 2YZ4A 3ASIA 2GNBA 2DTYA 1G8WA 1GV9A 1D2SA 1CGPA 4QXKA 1WLTA 2EAKA 2WNUA 1QJX1 3AJYA 4C0HA 1OQEA 4EN7B 5CNAA 1FI2A 2MEV2 2VW2A 4XETA 2PAKA 2DVGA 3BB6A 3SMHA 2XBO1 2VVFA 4RS5A 3MLKA 1VALA 1K5MC 1DQ6A 3VBRC 1OOPA 2VNOA 4HKLA 5FLJA 2ZX1A 3AKSA 1QXJA 1H2MA 4Z82A 1BBT1 1EAH1 1B35C 1U12A 4JGYA 2VMGA 4HSLA 3M8LA 1LU1A 3I59B 3AYEA 5AVPA 1SDWA 4W6YA 1FV3A 2VOVA 3LA3A 3H3ZA 4HLTA 3WUDA 4CDWA 3WOGA 1PZ8A 3USSA 2D93A 2Z42A 2DU1A 5LK5A 3BPZA 4J1WA 4AXOA 3GHMA 4H14A 3MIBA 3JD71 4JAAA 4OI1A 1VBA2 3OY8B 3TB0A 4AEDA 2R041 4UW4A 1ZZCA 2XJRA 4COVA 4Q4W3 1IZ3A 1RUH2 1PO13 4TWTA 1HRI2 3OD0A 3UJOA 5J36A 1XYOA 4GQ7A 4H7MA 2PHXA 5LRRA 1AXKA 2H6CA 3N7MA 4E4ZA 3DPRA 4GA9A 2BFUS 1H2NA 1ENSA 3R4DB 5BNPB 4XJAA 3H1MA 4Q0PA 2LALA 2CGNA 1RC6A 1RIRA 1SFNA 3KD4A 4K6BA 3D0SA 2RR13 4HPKA 4LBMA 1NY71 4CDUB 2X8KA 1BK1A 3TBDA 2OYZA 1KJLA 3WV6A 1C5HA 2WSUA 4LBOA 3ZXJA 5I93A 1CVNA 5JSRA 1GZWA 1AR92 3T1MA 3UKVA 1SACA 2ARBA 2A3YA 1UU4A 4KH9A 1MS5A 3H50A 2VMHA 4YW2A 5K0UC 1NXMA 5GZGA 2WS93 4WM8C 1HRV3 1XU2A 3VHRA 1ENQA 1MS9A 2ZAHA 2WZR1 4R4ZA 4BWOA 1DQ0A 5F6LB 2GALA 4ZU7A 3B93A 4XIOA 1NE6A 5FOBB 5IT6A 3KGLA 1AX0A 3ILNA 1R1A3 1CJDA 4WVZA 2CWSA 1QJX3 1UZYA 3E5UA 4DB5A 3OGGA 3LSEA 1EV11 3ZXDA 5I0TA 1CJPA 1NG0A 3M3IA 5A33B 3WW1A 1LR5A 1MZFA 3IT8A 4Y1YA 2B45X 1LGNA 2DUOA 2ZMLA 1OFNA 1NZCA 4I09A 1AVBA 4IXLA 1BBT3 1EAH3 5KHKA 5CA6A 4W6XA 4L2NA 5SV8A 4N43C 1QU0A 2OA2A 1VBB2 4DRRA 5EWSA 1GKBA 4RQPC 2CWMA 1N1YA 1OSGA 4BLJA 1GICA 1KQRA 2QDNA 3T1LA 1MEC1 5HCFA 5JOZA 4BQ1A 1JOJA 2JX9A 4IV1B 4FOVA 4NN0A 1T6GC 1S0BA 4R9DA 1RMU2 1DDLA 1XU1A 5J48A 3ZMOA 3JD73 5TSWA 4M0NA 4YVWB 2MEV1 5HXVA 1VP6A 4IEVA 3FLRA 5T5LA 4PLOA 3M2MA 1UU5A 5JSOA 3GZUC 4B4RA 4ES8A 2CNAA 1LOEA 3B3QE 1SLLA 5JZGA 1LRHA 3AJZA 1Y9QA 3RYKA 4IEZA 1WLCA 4DRVA 2GNTA 1ULCA 1GFF2 4AW7A 1IPJA 3WX5A 3ZSJA 1W39A 1ZZ8A 3M70A 5FOJB 4LUKA 1OKQA 4QHBA 4Y1UA 2D6OX 5BY5A 5J7MA 1AYN2 3CL1A 1YFXA 1PNGA 3ZMNA 2XWBB 5FQ0A 2WNUB 2GZWA 4XF4A 3ENRA 3SH3A 5HBAA 3ZFEB 3WNXA 4TSVA 3VBSA 1VBA1 4HK9A 1AYM3 1FV2A 1ZNPA 5GZEA 1PK6C 3RNSA 4RHV2 2AH2A 3RZZA 2WFF1 4RS5B 4WVWA 3NO8A 1NA1C 1LOBA 3WINE 4FSJA 1SFYA 2HYKA 5C33A 1RUH1 1U5YA 1ND2C 3UKNA 3PLQA 1HRI1 2A73B 2WZR3 3I2DA 4JGYB 1Y43B 4AGRA 1U5IA 3MIFA 3FC0A 4A2UA 3MIDA 2YROA 2NYYA 5GM0A 1BCXA 4CRQA 1SCRA 2YYOA 3HD8B 2IXKA 4F3JA 3KT4A 2B46X 1EV13 4CDWB 3LWCA 4KNCA 4BOWA 1AR82 2R1BA 1FNZA 4I0BA 2PHUA 4I0WB 4N9IA 1NCQA 1A8DA 4OVEA 4QU2A 4XXPA 3ZYJB 1CAWA 2JENA 4FPOB 2DCZA 1AR91 1G9FA 1SLAA 1J3RA 4R9CA 2X5IC 1UKRA 4FQZA 3EHKA 1PVXA 3VDDA 1G9BA 4LHNA 4AVBA 4INDA 1U5XA 1W6NB 2E7AA 2FZ2A 4EWEA 4S2GA 1LESA 3L9JT 2XL9A 3ZFFA 3L2HA 3MLLA 1RTVA 3JQXA 1HIXA 1NCRA 5EYYA 2Z69A 2JG8A 3AMNA 1WMEA 4HBNA 1MZEA 1SCSA 3N3HA 1G9CA 2MEV3 1J1TA 2V5YA 4XDQA 1J58A 2ZGTA 2VY0A 3Q9OA 4NHMA 4U36A 5KXDA 1DZTA 3C2UA 3HWJA 2XVLA 2RS12 3FMGA 4FAHA 1IS3A 2P3IA 4GWMA 4Q4Y3 3ST7A 5DZGA 2EA7A 2IXCA 1N3QA 1RINA 4YM3A 3WQ1A 1ULDA 5EV7A 1OMIA 3VZMA 1D2QA 2ET1A 3FE5A 4PDWB 1QF3A 1VBB1 4PLMA 2F6BA 1HX6A 3WCRA 2GC2A 1VIWB 3POYA 2NMOA 2XVGA 1DGRN 3CJXA 5L19A 4EWDA 5EYXA 2DCJA 2A3WA 4K1ZA 4HVQA 3DF0A 1RMU1 4XQWA 4H3WA 1UL9A 1AX2A 1UPSA 2XJSA 1LENA 1VBA3 4CEWA 4LE4A 1H1IA 2WFF3 3D6EA 5C4WB 3UK9A 3CJIC 1RUH3 2DVDA 1HRI3 2WNVC 3B9CA 4OI4A 4M3CA 3PVNA 2XH6A 2ERFA 1OA2A 5GLWA 4CDXA 2HEVF 4NPRA 1TQ5A 3OD4A 4B4PA 4XILA 2XL7A 3S7IA 1XE8A 3CF6E 1FXZA 3B7MA 3S6PA 4KWKA 1FT9A 2WWSA 3D4KA 4W65A 4XBLA 1AYN1 2UWCA 3H1YA 3VBFA 2P2KA 5GLVA 4Q4W2 1PO12 1ND3A 3WW3A 4IV3B 1AR93 4C1WA 1GANA 4JDMA 3FBMA 3ZN6A 1LGCA 4MXWB 4MV2A 3WP4A 5GLTA 2TNFA 4WVVA 4RHV1 3OF1A 1DZRA 1W6PA 2FQPA 3WDTA 1C28A 1TE1B 2XLFA 3APBA 2VNGA 1PO22 3NAPC 4KL1A 4OUMA 4MYEA 5JZGB 2XHKA 4OHVA 2RR12 3E6DA 4ITCA 2BPA2 1LB2A 4E4SA 4IEQA 3RYPA 3M3QA 3JU9A 4XFHA 5JR7B 4FTEA 1DIWA 1J1LA 1QNYA 2AUYA 1CR7A 3EBRA 1WA4A 4PJYA 4J6GA 5CFDC 3VBOA 2ZS6B 4R9AA 1ZBE1 4IEYA 4NVPA 4IEWA 4DXZA 4W6WA 2GN3A 1SBEA 3FLPA 1AR81 1HRV2 5DUVA 4XEZA 3CLPA 2ZZJA 4WM7C 3I59A 1MQTC 4KG8A 3NW4A 4LA2A 5HCBA 3JQWA 3LSDA 1NE4A 1VAVA 4MSVA 5DXDA 4DNYA 2E51A 2BUKA 2BBVA 4I02A 1R1A2 1DZQA 1Q8QA 4D7SA 1H30A 4B3NA 1M06G 2Z5WA 2WINB 5JOYA 1ENRA 2XJQA 3AKRA 1AL22 4LBLA 3M1HA 1RMU3 2P17A 4CYDA 1YYNA 1V70A 2NMNA 4I2OA 3VBHC 1NOVA 2EXJA 3AZVA 5C9AC 1EAH2 4XXAA 3BIWE 2DV9A 5F5QA 3VZLA 1PVC2 1GR3A 4XFIA 2ZKNA 4L92A 1VJ2A 4XW3A 4DZGA 5BNPA 1SEFA 2BVVA 2RS11 1BVP1 1UPIA 2A5ZA 3BALA 1H0BA 5BNNC 1U0AA 4LA3A 4RSUA 3UV9A 1JH5A 2FMDA 4AI1A 4JDOA 2RHPA 3WVJA 4CDUA 1AXZA 4MUVA 3TOJA 1N47A 1YHFA 1R093 4PIXA 3JD72 3M4FA 1ZM1A 1TMF2 2XJUA 4X6QB 4HSJA 3PJYA 3PMEA 4XQ4A 1AYN3 3FFZA 4MXVA 3VHPA 1ENXA 2XJVA 1LODA 4BE3A 4HK8A 4YGEA 3WQ7A 4DOUA 1ASJ3 1HDKA 4FO9A 4L99A 4RHV3 4NWWA 5E16A 5FREA 1RUE3 2VW1A 1AZDA 3ZSMA 2VECA 1S0DA 3QCWA 4IEXA 2ZHNA 4Y1ZA 4OHYA 1K5MA 2I74A 3AMHA 4LO7A 4A7YA 3PJQA 4YFWA 5FMOL 1QWRA 1O3SA 2GNMA 1A3KA 2GC3A 4HL0A 1H8TC 2WKKA 3FWEA 5A33A 1V6OA 5BNOC 1V6LA 2DFCA 1AYM2 1ZBE3 3OPZA 4D69A 1XNBA 3VBUC 1KJRA 4E2QA 1G6NA 1AR83 1C1LA 1I6XA 1W0PA 2VOKA 1PO11 4AHZA 3RJRA 1VAMA 4YZ3A 4AFCA 1HLCA 4ZXKA 3MIHA 4XJ8A 3ZIXA 4CDQC 1Q3EA 1YJLA 1MACA 2Q8OA 4XZPA 4Q2FA 3OYWA 3HIFA 4YM2A 3JUUA 4CEYC 3OBTA 3VKLA 1QGLA 1PO21 1EPZA 4M3CB 3N7KA 4SLIA 4BM8A 1F9KA 3AMMA 1EV12 2A6XA 2QNKA 2RR11 4CDXB 2IXJA 1ULFA 2XVKA 2ZMNA 4YVWA 1H1AA 2ZKLA 2A3XA 2D3RA 1R1ZA 3RI9A 5C8CC 3AXDA 4GH4C 2BNNA 2E9QA 3LAGA 4E2SA 4ASMB 1MS8A 2WSVA 3A0NA 3B9IA 2RM22 2JICA 2CV6A 1RUNA 1GQGA 2JG9B 1E57A 1HQNA 4YZ1A 5T55A 4YVSB 4MGKE 2ZAAA 1HRV1 2BFUL 2RS13 4N53B 4XJUA 4QQOA 1RGSA 4BIOA 5D8AA 1H4GA 4R52A 4DY5A 3AX4A 1HXS3 3J4UH 1UMZA 4HZFA 1FOD3 3AKQA 4QQ2A 1GNHA 1H2KA 1R1A1 3A0KA 5K0UA 2C9AA 1RJ7A 3RDIA 1PNFA 1YI9A 4COWA 4WM8A 3ZFEA 5CFCB 3LOBA 1COV2 4V1PA 5EXOA 1V6MA 2Y0OA 1AL21 3KSCA 3QBQA 5FMOS 3VKFC 1QJU1 2WLPA 5FDBA 3ZFGB 4JQRA 4ISRA 5I8SA 1W6QB 3VBOB 4RA0A 2W52A 4Q0UA 4Q4Y2 4RR3C 3LZZA 2R0FA 4RL7A 3AP4A 4JGZB 3T2TA 1KS4A 2QE3A 1JW6A 1PVC1 4YG6A 2HKXA 3NV3A 3NJZA 1OPOA 1DQ2A 4D3WA 3RI8A 1BXHA 4Q1PA 1ZRCA 5CU1A 1LHOA 4AFBA 1C8M3 3IIAA 5L36A 4B7EA 5JWPA 4FOYA 1WCDJ 2IXIA 4COZA 2DUPA 1XYNA 3QD6A 3P3NA 2YPJA 3HAGA 1AJOA 1ZRFA 3CU7A 4FPKA 1TMF1 4M00A 2GC0A 4UW5A 3MFCA 3NSTA 2D6MA 4OULA 2WFF2 4QQLA 1KS5A 4FTBA 2V09A 5ABJB 1A8MA