4GH7A

Crystal structure of anticalin n7a in complex with oncofetal fibronectin fragment fn7b8
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
SDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGKAGNHDLREDKDPRKMQATIYELKEDKSYNVTNVRFVHKKCNYRIWTFVPGSQPGEFTLGNIKSWPGLTSWLVRVVSTNYNQHAMVFFKRVYQNRELFEITLYGRTKELTNELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Combinatorial design of an Anticalin directed against the extra-domain b for the specific targeting of oncofetal fibronectin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 42
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4gh7A00
5KIDA 4YFPA 1OBQA 2DM5A 2XKLA 1SXWA 5F1EA 2NNDA 2AH7X 5LJKA 2JOZA 1VYFA 1FEMA 4YKOA 1JJXA 2OZQA 2OVEA 5F58A 2OFRX 3L4RA 1EPBA 2WR6A 4ORUA 2ACPX 1LPJA 5AQ6A 3MVFA 4MVIA 2RCTA 5JR8A 1DF3A 4DQ4A 1X89A 4HPCA 3NQ3A 1HBPA 1QY1A 2RQ0A 1KT4A 1CBRA 5HWZA 3BSZE 3JS1A 1KT5A 3KFIA 4I3DA 2A2UA 1OEKA 2RCQA 3FA7A 3EBKA 1KT3A 4RUUA 1GT5A 2HNXA 4YFRA 1PBOA 1GX9A 4MVKA 2G78A 1GKAA 5EPQA 1NGLA 4D6AA 3VG2A 1G74A 4UU2A 4IAXA 1RLBE 3FMZA 4Y0SA 3QKGA 5D8JA 1SY2A 4AZOA 2ANSA 1SY1A 4M6SA 2LFOA 3UEUA 4N7CA 4YDAA 4D6BA 3CQNA 1TVQA 3WJCA 1JBHA 1FE3A 2BLGA 3FIQA 1D2UA 2POAA 3VG6A 1YWAA 3NX1A 2QO5A 1CRBA 1TXLA 1YP6A 1SA8A 5LJBA 1KZWA 5D48A 5H9KA 5LJDA 1AB0A 4YGHA 4AZMA 1T68X 3P6FA 5HZ8A 2LKKA 4YKMA 4CK4A 1E02A 3MBTA 4ZHHA 5EDBA 2CBSA 3DTQA 3CBCA 2FR3A 4QYPA 3PPTA 4TLJA 5IO5A 5H8TA 1QFTA 3AKNA 2FTBA 3F8AA 1OBUA 1FELA 4QAEA 2AT8X 5DPQA 1GGLA 5L8NA 4IB9A 2K62A 1G85A 3UEXA 1YIVA 3WJEA 1QWDA 3PP6A 4GNWA 4ZGUA 1EIOA 5EEDA 4OS0A 1Z24A 4M7MA 2L5PA 3APWA 1UREA 2RD7C 3BU9A 2P8GA 1MDCA 1E00A 2N93A 1OBPA 3F9DA 2ALLX 2X46A 3IFBA 3VG7A 5HAEA 1PMPA 4HFOA 3UEVA 1EUOA 2GC9A 1IFBA 3TGAA 3NP1A 4AZRA 1PEEA 4TNNA 5FAZA 1QG5A 3STKA 4IB8A 3KQ0A 3FA6A 4GKCA 4O9SA 4ZHDA 4ZHFA 1U18A 2LB6A 1DZKA 3VG4A 1T8VA 5HA0A 3TGCA 3S26A 3KZAA 2OFMX 3BX7A 2HYSA 1ACDA 5HCCC 1P6PA 4I3BA 3OJYC 4TJZA 5HZ9A 4NP1A 1B0OA 1QQSA 4R0BA 2L9CA 5L8IA 1OPAA 3KFFA 2GTFX 2ACOA 3FR2A 4BQUA 4GH7A 1ICMA 1ZNEA 3KFHA 3NR3A 3PECA 1O1UA 2MJIA 1LIFA 4ARHA 3I0AA 2R74A 2JU3A 1B8EA 3NQ9A 3FA9A 5HA1A 3D95A 4OS3A 4LKTA 1QABE 5BVTA 2FLJA 2QO6A 2AKQA 1JYJA 3B2KA 3BDRA 3TZSA 2FT9A 2CZTA 3P6GA 2Q39A 3FW4A 1BRPA 3HK1A 1I05A 5H9LA 3C77X 1GKAB 5HTDA 3FELA 1CBQA 2NNQA 3APVA 4BOEA 1BSOA 2CM9A 5KHPA 1DV9A 1ZNGA 3WJDA 1VYGA 3BU1A 3EBWA 4I3CA 4IBAA 1BWYA 2E4JA 4I9RA 3IA8A 2Q9SA 2HLVA 4AZNA 4XMDA 4IB7A 1HMSA 1TW4A 4AYHA 2FS7A 2WQAE 1PM1X 1OPBA 3B2LA 5LJEA 4ORWA 2JN3A 3O19A 1ALBA 1YP7A 5CE4A 3SAOA 5D4AA 1O8VA 1O1VA 4XMGA 2KTDA 4GE1A 3ZQ3A 5F7GA 1IIUA 1ZRYA 3U9PC 1S2PA 3U03A 3BY0A 1I06A 3CWKA 3APXA 2W2FA 4EEJA 2PY1A 1CBSA 4LZUA 1ZNHA 2JU8A 2FRSA 1R0UA 3I17A 1MVGA 1FDQA 4IAWA 1X8NA 3CR6A 2CBRA 4YGGA 3STNA 3WJFA 1CJ5A 2HZQA 3O2YA 4TKJA 4ORSA 1G5WA 1AQBA 1YWDA 5LKEA 1DZMA 1AVGI 3GAQA 1GT4A 4OS8A 5FFHA 2FS6A 5LKFA 3ELXA 4RUNA 2QM9A 2W2AA 4EXZA 4ZH9A 5HCEC 5HBSA 3FEPA 3FLLA 4UU3A 1KT6A 1IKJA 3B2JA 3HWGA 1KOIA 2G79A 3WBGA 4ZFXA 5HZ6A 3C76X 3K3LA 2A3FX 1E06A 1HBQA 2AL0X 2NP1A 1BEBA 3ELZA 4PSQA 3P6CA 1DZPA 1SXXA 1QFVA 2R73A 2RA6A 3BS2A 1ZNKA 3P6DA 4LKPA 4YCHA 2AMMX 1SY0A 4AZQA 3BX8A 1LF7A 2A13A 3FR5A 3O22A 4OMWA 5BVQA 4IMNA 2EU7X 3PH5A 1X8UA 3PH6A 2CZUA 4NLJA 5F6BA 4HPAA 4HPBA 1OEJA 1LKEA 5HTEA 4ZR2A 4XMEA 1T0VA 2NNEA 1X8PA 3WJBA 1GT3A 2CM4A 4QGWA 3ZUOA 4YDBA 4NLIA 4IB6A 4EDEA 1ERBA 2OVDA 1NP1A 1GXAA 4GNYA 4A1HA 2X45A 2FR2A 3P6EA 2MO5A 5K06A 2HZRA 1TOWA 2O62A 4A1YA 3APUA 3STMX 2GJ5A 4TKHA 4IMOA 4AZPA 1HN2A 4AW8A 4YMYA 2AT6X 3EMMA 4WFUA 4ALOA 1KGLA 1GM6A 1KXOA 4YBPA 2WSJA 3C78X 2A2GA 3PEDA 5HZ5A 3BLGA 2AT0X 3D97A 2W2BA 1JZUA 1B4MA 5LJCA 2WEXA 1I4UA 1KQWA 2OVAA 1LICA 4NNTA 4ES7A 4ZHCA 1ML7A 5HCDC 3TGBA 3FA8A 1ZNLA 5C0NA 4ZJ0A 5F6ZA 4YFQA 4TQ2A 2ASNX 3FW5A 4XMHA 1A2DA 4Y0QA 3HWEA 1BJ7A 1LIDA 1YWCA 4ORYA 2LBVA 3FEKA 1KZXA 2KT4B 1FTPA 4K19A 4NYRA 5D45A 5BVSA 3RZYA 3B2HA 5L8OA 4ZH6A 1S7DA 1MUPA 4TKBA 4DQ3A 3CBSA 2YG2A 5FENA 3WVMA 2JU7A 1IFCA 2QOSC 3D96A 1RBPA 1EQDA 2LBAA 1MX7A 1HMRA 1YUPA 2WQ9A 3P6HA 4WBKA 3DSZA 3CQRA 3Q6LA 1NP4A 1BBPA 4N7DA 2K23A 1SY3A 1X8QA 1QY2A 1A57A 1QY0A 1G7NA 4WFVA 3HWDA 1GT1A 4GRJA 3CMPA 1A18A 5H9NA 2HMBA 1TOUA 2G7BA 5H9AA 4YBUA 3VG3A 4YCEA 3WXQA 5EEEA 3FENA 1L6MA 1UZ2X 5D47A 4ORRA 4QYNA 1JV4A 2A0AA 3NADA 1OEEA 1H91A 4HPDA 2L68A 4YGZA 2WEWA 1LIBA 3TF6A 3VG5A 4OMXA 4I9SA 5HZQA 4Y0RA 1S44A 1DC9A 1KT7A 1ADLA 2AT3X 4Y0PA 3ZUIA 3HWFA 1BLRA 1EXSA 1LIEA 1X8OA 2IFBA 4A60A 1U0XA 3JSQA 4XMFA 4KIIA 5B29A 4MVLA 4ZHGA 3WJGA 1JYDA 2Q4NA 2QO4A 1B56A 1A3YA 1I04A 3BRNA 1LFOA 1SXUA 1GX8A 1EALA 5LJHA 4LZVA 2XSTA 4XMCA 1BRQA 3RSWA 4QGVA 4ALBA 1CBIA 1XKIA 4QZTA 3KFGA 4QGXA 1N0SA 2L67A 1EPAA 2FWVA 1ZNDA 1X71A 2F73A 3G7XA 2Q2MA 1IW2A 3AKMA 5LJGA 3FR4A 1VPRA 4BVMA 2Q2PA 1EIIA 1ERXA 3NX2A 1XCAA 1ICNA 1MX8A 2WUTA 1BSYA 4YH0A 3NPOA 1IKEA 4GETA 1YWBA 5IO6A 1DFVA 4QZUA 5B27A 5IO7A 3EM0A 4NNSA 1BM5A 1D3SA 4A8ZA 1AELA 1FENA 2AT5X 5KICA 3B2IA 1HQPA 1SXYA 1E5PA 1EW3A 4NYQA 3UEWA 1KQXA 1LNMA 2R56A 3EYCA 4EFGA 1U17A 5DG4A 2WWPA 1HMTA 4ORXA 5EDCA 4ZCBA 1JJJA 3T1DA 5EZ2A 1DZJA 4ODDA 3U0DA 2MM3A 1BSQA
chains in the Genus database with same CATH superfamily
4YVBA 2CAMA 5KIDA 3P24A 4YFPA 1NQNA 1OBQA 2DM5A 2XKLA 1SXWA 5F1EA 2NNDA 2AH7X 5LJKA 2JOZA 1VYFA 1FEMA 4YKOA 3RBYA 1JJXA 2QCBA 3MM0A 3OD9A 1SRJA 3AEHA 2F01A 1N43A 2IZKA 2OZQA 2OVEA 5F58A 2OFRX 3L4RA 3F6ZB 1EPBA 2F09A 2WR6A 4ORUA 2ACPX 1LPJA 3OBLA 5AQ6A 3MVFA 2A5CA 4MVIA 2RCTA 1MK5A 1WUBA 1VWMB 5JR8A 4DQ4A 1DF3A 1X89A 3MX7A 2OL6O 3NQ3A 1HBPA 4HPCA 3WYQA 1QY1A 4BX5A 2RQ0A 1KT4A 1CBRA 2BSZA 5HWZA 3BSZE 1SWJA 3JS1A 1KT5A 2GH7A 3KFIA 4OEMA 3VU1A 4I3DA 2A2UA 3JQOA 1OEKA 2RCQA 4COTA 3FA7A 1SWRA 2FHNX 3EBKA 1KT3A 4RUUA 1GT5A 1HXLA 2HNXA 4YFRA 1PBOA 1GX9A 1SWCA 3OE3A 4MVKA 1Y0GA 4FGIB 3PDFA 2G78A 4Z28A 1GKAA 5CHKA 1W4TA 5EPQA 1NGLA 4D6AA 2OVSA 3SZHA 3VG2A 2A5BA 1G74A 4UU2A 3RDQA 4IAXA 3WZNA 4Z2VA 1RLBE 1NQMA 3FMZA 4Y0SA 3QKGA 5D8JA 4WHIA 1SY2A 2GTLN 3EC5A 1E2TA 1SRIA 4AZOA 2ANSA 1SY1A 4M6SA 2OFBA 2LFOA 3UEUA 4N7CA 4YDAA 2LA7A 1SWDA 2FKJA 2GTLM 4D6BA 3CQNA 1RSTB 3VE2A 1VWKB 5IRWA 1TVQA 3WJCA 1JBHA 1FE3A 3HPEA 2BLGA 3FIQA 1D2UA 3HOEA 4GGZA 4MVEA 2POAA 3VG6A 3X00A 1YWAA 3NX1A 2QO5A 3S60A 1CRBA 1TXLA 1YP6A 1SA8A 2VFBA 5LJBA 1KZWA 5D48A 5H9KA 5LJDA 1AB0A 4YGHA 4HWMA 4U8UN 4AZMA 1T68X 3P6FA 2RTAA 2BS6A 3LHNA 5HZ8A 2LKKA 3SLJA 4YKMA 4CK4A 1E02A 3MBTA 4ZHHA 1Y53X 2FGSA 4NV8A 2RTCB 4QQ1A 2CBSA 3DTQA 2MHDA 5EDBA 3CBCA 4ON1A 2FR3A 4Z6JA 2RTJA 4QYPA 3PPTA 2YMSA 4TLJA 5IO5A 5H8TA 1QFTA 3AKNA 2FTBA 3F8AA 1OBUA 1FELA 4QAEA 4GZVA 2AT8X 5DPQA 3CKFA 1GGLA 5L8NA 4IB9A 2K62A 1G85A 2RTLA 3UEXA 1YIVA 3LV4A 1JMZA 3WJEA 1QWDA 5AJBA 3RY1A 3RDUA 3PP6A 4GNWA 1PBYA 1NC9A 4ZGUA 5EEDA 3HTYA 4OS0A 1Z24A 1LDOA 1EIOA 4M7MA 2L5PA 3APWA 3PK2A 3H3IA 1UREA 2RD7C 2C4IA 2X32A 3BU9A 2P8GA 1MDCA 1E00A 2N93A 1OBPA 3F9DA 2ALLX 2QOMA 2X46A 3IFBA 3VG7A 1SLDB 1STPA 3MG5A 3GE2A 4INNA 5HAEA 1PMPA 4HFOA 1N9MA 1EUOA 2GC9A 1IFBA 3RE5A 3TGAA 1WBIA 3NP1A 3UEVA 3WYPA 3ZW1B 1PEEA 4AZRA 2OY5O 4TNNA 5FAZA 5IRAA 1QG5A 3STKA 4IB8A 3KQ0A 3FA6A 4GKCA 4O9SA 4BX7B 4ZHDA 4ZHFA 1U18A 4GJSA 1STRB 2LB6A 1DZKA 3VG4A 2BS5A 1SRHA 4GD9A 1T8VA 1GX3A 5HA0A 3TGCA 1K3BA 2OY1O 3S26A 3KZAA 2OFMX 3BX7A 2HYSA 1ACDA 5K68A 5HCCC 3T6LA 1P6PA 4I3BA 1SWFA 3OJYC 4TJZA 4JNJA 3S5XA 5HZ9A 4NW4A 2OL7A 4MISA 4NP1A 2M4LA 1B0OA 1QQSA 1SWEA 3AUMO 2L9CA 4R0BA 1OPAA 3KFFA 2GTFX 5L8IA 2ACOA 2GTLO 3FR2A 4BQUA 4GH7A 1VWIB 1ICMA 1ZNEA 3KFHA 4CDCA 3NR3A 3PECA 1SWAA 4CPEA 3RDMA 1O1UA 2MJIA 3VGWA 1LIFA 2X56A 3SOTA 4ARHA 3I0AA 2RTEB 3S5VA 4LQZA 2R74A 2JU3A 1SWUA 2OF9A 1B8EA 3KVNA 3NQ9A 3V8UA 3FA9A 5HA1A 4BX5B 2VDFA 3D95A 4OS3A 4DCBA 4LKTA 1LCVA 1VWLB 1QABE 2IZFB 5BVTA 4Z2PA 4GDZA 2FLJA 2QO6A 2AKQA 1JYJA 1EI5A 2IZBA 2X8FA 2FT9A 2CZTA 3B2KA 3BDRA 2Q39A 3FW4A 3FIDA 3P6GA 4ID2A 4CDDA 5IRUA 4U8UO 1BRPA 3HK1A 1I05A 4NV7A 5H9LA 3EW1A 4I6SA 3C77X 1GKAB 1VWGB 2RN4A 1SWQA 5HTDA 2I5VO 3FELA 1CBQA 2NNQA 3APVA 5B3MO 1SWBA 1BSOA 1MM9A 2CM9A 4BOEA 5KHPA 1DV9A 1ZNGA 3WJDA 1VYGA 3BU1A 3EBWA 4I3CA 4IBAA 1BWYA 2E4JA 4I9RA 3IA8A 2Q9SA 2HLVA 1VYOA 4AZNA 3P02A 1SWLA 1VWCB 4MEEA 1STSB 4XMDA 2C1QA 4IB7A 1HMSA 1TW4A 4AYHA 2FS7A 4DNEA 2WQAE 1PM1X 4BBOA 2FHLA 2G8CO 2RTPB 1OPBA 4Z2OA 4O4UA 3ZWEA 3B2LA 1LDQA 2OY8A 5LJEA 1IJ8A 2IZEB 3D4RA 1Y52X 3LTWA 4ORWA 4ML7B 2JN3A 3O19A 1ALBA 1YP7A 5CE4A 3SAOA 5D4AA 3ZW0A 1O8VA 3T6FA 4B55A 1O1VA 4XMGA 2KTDA 4GE1A 1NBXA 3ZQ3A 5F7GA 1IIUA 1ZRYA 2OF8A 2G5LA 2KW1A 3U9PC 1S2PA 3WZOA 3U03A 3BY0A 1I06A 3Q34A 3VHIA 2JGSA 3APXA 3CWKA 2W2FA 4EEJA 4KT5A 4OELA 5AJCA 2PY1A 1CBSA 4JHQA 4LZUA 2Z4IA 1PTSA 1ZNHA 2JU8A 2PI3O 2FRSA 4PJ2A 1R0UA 3I17A 4YCHA 1MVGA 1FDQA 4IAWA 3T2XA 3ZZVA 1X8NA 3CR6A 3NQKA 2CBRA 2RTRB 3PQSA 4YGGA 1W5RA 3STNA 3WJFA 2HZQA 3O2YA 4TKJA 1CJ5A 4ORSA 2OFAA 1FJ1E 4O3WA 1G5WA 1AQBA 3RY2A 1YWDA 5LKEA 1DZMA 1SMPI 4U8UM 1AVGI 3RDXA 1SWHA 4BGFA 2Y3EA 3GAQA 1GT4A 1KL3A 1VWJB 2HKDA 2FS6A 4OS8A 1JIWI 4QRLA 2QMIA 5FFHA 5LKFA 2RTHB 3ELXA 2QM9A 4RUNA 2W2AA 3ZI8A 4BJ8A 4EXZA 2IZGB 4ZH9A 5HCEC 5HBSA 3FEPA 1UYNX 4MIRA 1SLEB 3FLLA 4UU3A 5AEOA 1KT6A 4JGLA 4BX6A 4FBOA 4CPHA 1IKJA 4I60A 5B5FA 4CPIA 5B11O 3B2JA 3HWGA 4CSBA 1KOIA 2ZAGA 2G79A 3QQ2A 3WBGA 4ZFXA 5HZ6A 3C76X 2JW1A 3K3LA 2A3FX 1E06A 2JMBA 2RTQB 1HBQA 2AL0X 2NP1A 1BEBA 3ELZA 2IZCB 2FKGA 4PSQA 3P6CA 1DZPA 1SXXA 1QFVA 2IZLB 2R73A 2RA6A 1ZNKA 3BS2A 3P6DA 4LKPA 2AMMX 1SY0A 4U9CA 4AZQA 3BX8A 1LF7A 2A13A 3FR5A 3O22A 1UYOX 4OMWA 3E3CA 5BVQA 2IZJA 4IMNA 4JO6A 4I95A 2EU7X 3PH5A 1X8UA 4U3QA 3CKGA 3PH6A 2CZUA 4NLJA 5F6BA 4HPAA 4HPBA 1OEJA 2DJGA 1LKEA 4OKAA 2RTGB 5B5GA 5HTEA 1I9HA 1LCZA 3EW2A 4ZR2A 3RDOA 4XMEA 1T0VA 2NNEA 5B10O 4CPFA 3HOLA 4EKVA 1X8PA 2X4MA 3WJBA 2IZAA 4FBVA 1GT3A 2CM4A 2VFCA 4QGWA 3ZUOA 4YDBA 4NLIA 1LCWA 1SLGB 4IB6A 4EDEA 1ERBA 1N9YA 2BHVA 1NP1A 1GXAA 1SWGA 2AF5A 2OVDA 2RTMA 4GU8A 4GNYA 4Y59A 4EQAC 4A1HA 2X45A 2FR2A 2X34A 1K24A 2X8TA 3SLTA 3P6EA 4IRWA 2MO5A 2BT9A 5K06A 4O49A 1SWNA 2HZRA 5FQ6E 1TOWA 2O62A 1VWQB 4A1YA 3APUA 3STMX 2GJ5A 4TKHA 3ZW1A 1HQQA 5FQ8E 2MWHA 4IMOA 4CDEA 3TZSA 4AZPA 1HN2A 2ZSCA 4AW8A 4YMYA 2UZ2A 2AT6X 3EMMA 4FQBB 4QNIA 4WFUA 4ALOA 1KGLA 1GM6A 2RTNB 3SLOA 1KXOA 1RXHA 2WSJA 3FDCA 3C78X 4YBPA 1VWAB 2A2GA 2Y3FA 3PEDA 2RTKA 1VWOB 3BLGA 5HZ5A 5IXGA 2AT0X 4O4OA 1N4JA 3D97A 4O3YA 2W2BA 4GJVA 4CV7A 1JZUA 1HXZA 5LJCA 2WEXA 3VHMA 4U46A 2A8GA 5L3YA 2X8SA 1B4MA 1I4UA 1KQWA 1AVEA 2OVAA 1LICA 4NNTA 1OSPO 4ES7A 4KC8A 3WZQA 4O3ZA 1ML7A 4ZHCA 5HCDC 3TGBA 3FA8A 1ZNLA 4C5PA 5C0NA 4ZJ0A 5F6ZA 2C1SA 4YFQA 1VWRB 2ASNX 3FW5A 1I78A 4XMHA 1A2DA 4TQ2A 4Y0QA 3HWEA 1BJ7A 1LIDA 1VWDB 1YWCA 4ORYA 1DF8A 2LBVA 3FEKA 1KZXA 1HY2A 2KT4B 1FTPA 4K19A 4NYRA 4O4XA 2KD2A 5D45A 5BVSA 3RZYA 3B2HA 5L8OA 2UYWA 4ZH6A 2OYBO 1S7DA 1MUPA 3ZW0B 1KL4A 4TKBA 4DQ3A 2X55A 3CBSA 4L1NA 2YG2A 1SRGA 2RTFB 1KFFA 5FENA 3WVMA 3WZPA 2RTBB 2JU7A 3T2WA 1IFCA 2QOSC 3D96A 1RBPA 5F2BA 1SWPA 1EQDA 2LBAA 1MX7A 4O4SA 1HMRA 1MOYA 1YUPA 4GGRA 2WQ9A 1RXKA 3D9WA 3P6HA 4Z27A 4WBKA 3DSZA 3CQRA 3Q6LA 1BSQA 1NP4A 4ZGFA 2KTSA 2IZIA 5B2AO 1BBPA 3WOVA 1SREA 5BYPA 4N7DA 2K23A 1SY3A 1X8QA 4GGTA 1QY2A 1A57A 1QY0A 5FQ7E 1G7NA 4WFVA 3HWDA 1GT1A 4GRJA 3CMPA 4FBRA 1A18A 5H9NA 1SWSA 4GK9A 2HMBA 1TOUA 2G7BA 5H9AA 4YBUA 3VG3A 4YCEA 3WXQA 5EEEA 3FENA 1L6MA 4BCSA 1UZ2X 2IZDB 5D47A 4ORRA 4QYNA 1JV4A 2A0AA 5JD2A 4BX6B 4CPHB 3NADA 1OEEA 1H91A 1VWNB 1SLFB 4HPDA 2L68A 2ZAIA 4YGZA 2OL8O 2WEWA 4GDAA 5CYBA 1LIBA 1SWTA 3TF6A 3VG5A 3RKGA 4OMXA 4I9SA 3UAQA 5HZQA 4Y0RA 1S44A 1DC9A 1KT7A 4O3XB 1ADLA 1VWHB 2AT3X 4IABA 4Y0PA 1W6FA 3RDSA 3HWFA 3ZUIA 1BLRA 4CDFA 1EXSA 1LIEA 1N7YA 1X8OA 1RXJA 1Y55X 2IFBA 3N91A 4A60A 3VE1A 1U0XA 3JSQA 4XMFA 4KIIA 1LELA 5B29A 4MVLA 3VPJE 4ZHGA 3WJGA 1JYDA 1Y9LA 2Q4NA 2QO4A 1B56A 3RE6A 1A3YA 1I04A 3BRNA 1LFOA 1SXUA 3SZJA 1SWKA 1GX8A 1EALA 2Y32A 5LJHA 4LZVA 4KC7A 2XSTA 4XMCA 1BRQA 2I5ZO 3RSWA 4QGVA 2BC3A 4ALBA 1CBIA 1XKIA 4QZTA 1VWEB 3KFGA 3ZW2A 4QGXA 1N0SA 2L67A 1EPAA 1Y9TA 2FWVA 1ZNDA 1X71A 2F73A 3G7XA 4Y5DA 2Q2MA 1IW2A 3AKMA 5LJGA 3FR4A 1VPRA 3PQUA 2AVIA 2Q2PA 4BVMA 1ERXA 2RTDB 1EIIA 3NX2A 1XCAA 2OY7A 1VWFB 1ICNA 1NDJA 1SRFA 1MX8A 2WUTA 2RTIB 1AVDA 1VWBB 2RTOB 1BSYA 1LUQA 1SWOA 1RSUB 2WPUA 4KH8A 4YH0A 3NPOA 1IKEA 4GETA 1YWBA 3NBXX 1DFVA 4QZUA 5IO6A 5B27A 1JMXA 5CSEA 5IO7A 3EM0A 4NNSA 1BM5A 1MEPA 4GUZA 1D3SA 1VWPB 2Z4HA 4A8ZA 4KCAA 2IZHB 2DJFA 1AELA 1FENA 1JQPA 2AT5X 5KICA 3B2IA 1HQPA 1JJUA 3RWXA 1SXYA 2MF6A 4L3RA 1E5PA 1EW3A 3FYFA 4NYQA 1KL5A 3UEWA 1KQXA 3VHHA 4BX7A 1LNMA 2R56A 3EYCA 4EFGA 1U17A 5DG4A 2WWPA 1HMTA 4ORXA 5EDCA 4ZCBA 1JJJA 3T1DA 5EZ2A 1DZJA 5K67A 4ODDA 3U0DA 2MM3A 1RAVA 3SZIA
chains in the Genus database with same CATH topology
5KIDA 3P24A 4YFPA 1OBQA 2DM5A 2XKLA 1SXWA 5F1EA 2NNDA 2AH7X 5LJKA 2JOZA 1VYFA 1FEMA 4YKOA 3RBYA 1JJXA 3OD9A 2OZQA 2OVEA 5F58A 2OFRX 3L4RA 3F6ZB 1EPBA 2F09A 2WR6A 4ORUA 2ACPX 1LPJA 3OBLA 5AQ6A 3MVFA 4MVIA 2RCTA 5JR8A 1DF3A 4DQ4A 1X89A 3MX7A 4HPCA 3NQ3A 1HBPA 1QY1A 2RQ0A 1KT4A 1CBRA 5HWZA 3BSZE 3JS1A 1KT5A 3KFIA 3VU1A 4I3DA 2A2UA 3JQOA 1OEKA 2RCQA 4COTA 3FA7A 3EBKA 1KT3A 4RUUA 1GT5A 2HNXA 4YFRA 1PBOA 1GX9A 3OE3A 4MVKA 4FGIB 2G78A 1GKAA 5EPQA 1NGLA 4D6AA 2OVSA 3VG2A 1G74A 4UU2A 4IAXA 1RLBE 3FMZA 4Y0SA 3QKGA 5D8JA 4WHIA 1SY2A 2GTLN 4AZOA 2ANSA 1SY1A 4M6SA 2LFOA 3UEUA 4N7CA 4YDAA 2LA7A 2GTLM 4D6BA 3CQNA 3VE2A 1TVQA 3WJCA 1JBHA 1FE3A 2BLGA 3FIQA 1D2UA 3HOEA 4MVEA 2POAA 3VG6A 1YWAA 3NX1A 2QO5A 3S60A 1CRBA 1TXLA 1YP6A 1SA8A 5LJBA 1KZWA 5D48A 5H9KA 5LJDA 1AB0A 4YGHA 4HWMA 4U8UN 4AZMA 1T68X 3P6FA 2BS6A 3LHNA 5HZ8A 2LKKA 4YKMA 4CK4A 1E02A 3MBTA 4ZHHA 4QQ1A 2CBSA 3DTQA 2MHDA 5EDBA 3CBCA 4ON1A 2FR3A 4QYPA 3PPTA 2YMSA 4TLJA 5IO5A 5H8TA 1QFTA 3AKNA 2FTBA 3F8AA 1OBUA 1FELA 4QAEA 4GZVA 2AT8X 5DPQA 1GGLA 5L8NA 4IB9A 2K62A 1G85A 3UEXA 1YIVA 3LV4A 3WJEA 1QWDA 5AJBA 3PP6A 4GNWA 4ZGUA 1EIOA 5EEDA 3HTYA 4OS0A 1Z24A 4M7MA 2L5PA 3APWA 3H3IA 1UREA 2RD7C 3BU9A 2P8GA 1MDCA 1E00A 2N93A 1OBPA 3F9DA 2ALLX 2X46A 3IFBA 3VG7A 3GE2A 4INNA 5HAEA 1PMPA 4HFOA 3UEVA 1EUOA 2GC9A 1IFBA 3TGAA 3ZW1B 3NP1A 4AZRA 1PEEA 4TNNA 5FAZA 1QG5A 3STKA 4IB8A 3KQ0A 3FA6A 4GKCA 4O9SA 4ZHDA 4ZHFA 1U18A 2LB6A 1DZKA 3VG4A 2BS5A 1T8VA 5HA0A 3TGCA 3S26A 3KZAA 2OFMX 3BX7A 2HYSA 1ACDA 5HCCC 1P6PA 4I3BA 3OJYC 4TJZA 3S5XA 5HZ9A 4NW4A 4MISA 4NP1A 2M4LA 1B0OA 1QQSA 4R0BA 2L9CA 5L8IA 1OPAA 3KFFA 2GTFX 2ACOA 2GTLO 3FR2A 4BQUA 4GH7A 1ICMA 1ZNEA 3KFHA 3NR3A 3PECA 1O1UA 2MJIA 1LIFA 3SOTA 4ARHA 3I0AA 3S5VA 4LQZA 2R74A 2JU3A 1B8EA 3NQ9A 3V8UA 3FA9A 5HA1A 3D95A 4OS3A 4LKTA 1QABE 5BVTA 4GDZA 2FLJA 2QO6A 2AKQA 1JYJA 1EI5A 2X8FA 3B2KA 2FT9A 2CZTA 3BDRA 3P6GA 2Q39A 3FW4A 4ID2A 4U8UO 1BRPA 3HK1A 1I05A 5H9LA 4I6SA 3C77X 1GKAB 2RN4A 5HTDA 3FELA 1CBQA 2NNQA 3APVA 4BOEA 1BSOA 2CM9A 5KHPA 1DV9A 1ZNGA 3WJDA 1VYGA 3BU1A 3EBWA 4I3CA 4IBAA 1BWYA 2E4JA 4I9RA 3IA8A 2Q9SA 2HLVA 4AZNA 3P02A 4XMDA 4IB7A 1HMSA 1TW4A 4AYHA 2FS7A 2WQAE 1PM1X 1OPBA 4O4UA 3ZWEA 3B2LA 5LJEA 3D4RA 4ORWA 4ML7B 2JN3A 3O19A 1ALBA 1YP7A 5CE4A 3SAOA 5D4AA 3ZW0A 1O8VA 1O1VA 4XMGA 2KTDA 4GE1A 3ZQ3A 5F7GA 1IIUA 1ZRYA 3U9PC 2KW1A 1S2PA 3U03A 3BY0A 1I06A 3CWKA 3APXA 2W2FA 4EEJA 4KT5A 5AJCA 2PY1A 1CBSA 4LZUA 2Z4IA 1ZNHA 2JU8A 4PJ2A 2FRSA 4YCHA 1R0UA 3I17A 1MVGA 1FDQA 4IAWA 3ZZVA 1X8NA 3CR6A 3NQKA 2CBRA 3PQSA 4YGGA 3STNA 3WJFA 1CJ5A 2HZQA 3O2YA 4TKJA 4ORSA 4O3WA 1G5WA 1AQBA 1YWDA 5LKEA 1DZMA 1SMPI 4U8UM 1AVGI 3GAQA 1GT4A 4OS8A 4QRLA 5FFHA 2FS6A 1JIWI 5LKFA 2QMIA 3ELXA 4RUNA 2QM9A 3ZI8A 2W2AA 4EXZA 4ZH9A 5HCEC 5HBSA 3FEPA 4MIRA 3FLLA 4UU3A 5AEOA 1KT6A 4JGLA 4FBOA 1IKJA 3B2JA 3HWGA 4CSBA 1KOIA 2ZAGA 2G79A 3WBGA 4ZFXA 5HZ6A 3C76X 2JW1A 3K3LA 2A3FX 1E06A 2JMBA 1HBQA 2AL0X 2NP1A 1BEBA 3ELZA 4PSQA 3P6CA 1DZPA 1SXXA 1QFVA 2R73A 2RA6A 3BS2A 1ZNKA 3P6DA 4LKPA 4U9CA 2AMMX 1SY0A 4AZQA 3BX8A 1LF7A 2A13A 3FR5A 3O22A 4OMWA 3E3CA 5BVQA 4IMNA 4I95A 2EU7X 3PH5A 1X8UA 4U3QA 3PH6A 2CZUA 4NLJA 5F6BA 4HPAA 4HPBA 1OEJA 1LKEA 5HTEA 4ZR2A 4XMEA 1T0VA 2NNEA 3HOLA 1X8PA 3WJBA 4FBVA 1GT3A 2CM4A 4QGWA 3ZUOA 4YDBA 4NLIA 4IB6A 4EDEA 1ERBA 2BHVA 2OVDA 1NP1A 1GXAA 4GU8A 4GNYA 4A1HA 2X45A 2FR2A 2X8TA 3P6EA 2MO5A 2BT9A 5K06A 4O49A 5FQ6E 2HZRA 1TOWA 2O62A 4A1YA 3APUA 3STMX 2GJ5A 4TKHA 3ZW1A 5FQ8E 2MWHA 4IMOA 3TZSA 4AZPA 1HN2A 4AW8A 4YMYA 2AT6X 3EMMA 4FQBB 4QNIA 4WFUA 4ALOA 1KGLA 1GM6A 1KXOA 4YBPA 2WSJA 3C78X 2A2GA 3PEDA 5HZ5A 3BLGA 2AT0X 4O4OA 3D97A 4O3YA 2W2BA 4CV7A 1JZUA 1B4MA 5LJCA 2WEXA 2X8SA 1I4UA 1KQWA 2OVAA 1LICA 4NNTA 4ES7A 4KC8A 4ZHCA 4O3ZA 1ML7A 5HCDC 3TGBA 3FA8A 1ZNLA 5C0NA 4ZJ0A 5F6ZA 4YFQA 4TQ2A 2ASNX 3FW5A 4XMHA 1A2DA 4Y0QA 3HWEA 1BJ7A 1LIDA 1YWCA 4ORYA 2LBVA 3FEKA 1KZXA 2KT4B 1FTPA 4K19A 4NYRA 4O4XA 2KD2A 5D45A 5BVSA 3RZYA 3B2HA 5L8OA 4ZH6A 1S7DA 1MUPA 3ZW0B 4TKBA 4DQ3A 4L1NA 3CBSA 2YG2A 5FENA 3WVMA 2JU7A 1IFCA 2QOSC 3D96A 1RBPA 1EQDA 2LBAA 1MX7A 4O4SA 1HMRA 1YUPA 2WQ9A 3P6HA 4WBKA 3DSZA 3CQRA 3Q6LA 1NP4A 4ZGFA 2KTSA 1BBPA 3WOVA 5BYPA 4N7DA 2K23A 1SY3A 1X8QA 1QY2A 1A57A 1QY0A 5FQ7E 1G7NA 4WFVA 3HWDA 1GT1A 4GRJA 3CMPA 4FBRA 1A18A 5H9NA 4GK9A 2HMBA 1TOUA 2G7BA 5H9AA 4YBUA 3VG3A 4YCEA 3WXQA 5EEEA 3FENA 1L6MA 1UZ2X 5D47A 4ORRA 4QYNA 1JV4A 2A0AA 3NADA 1OEEA 1H91A 4HPDA 2L68A 2ZAIA 4YGZA 2WEWA 5CYBA 1LIBA 3TF6A 3VG5A 3RKGA 4OMXA 4I9SA 3UAQA 5HZQA 4Y0RA 1S44A 1DC9A 1KT7A 4O3XB 1ADLA 2AT3X 4IABA 4Y0PA 3ZUIA 3HWFA 1BLRA 1EXSA 1LIEA 1X8OA 2IFBA 4A60A 3N91A 3VE1A 1U0XA 3JSQA 4XMFA 4KIIA 5B29A 4MVLA 3VPJE 4ZHGA 3WJGA 1JYDA 1Y9LA 2Q4NA 2QO4A 1B56A 1A3YA 1I04A 3BRNA 1LFOA 1SXUA 1GX8A 1EALA 5LJHA 4LZVA 4KC7A 2XSTA 4XMCA 1BRQA 3RSWA 4QGVA 4ALBA 1CBIA 1XKIA 4QZTA 3KFGA 3ZW2A 4QGXA 1N0SA 2L67A 1EPAA 1Y9TA 2FWVA 1ZNDA 1X71A 2F73A 3G7XA 4EQAC 2Q2MA 1IW2A 3AKMA 5LJGA 3FR4A 1VPRA 3PQUA 2Q2PA 4BVMA 1EIIA 1ERXA 3NX2A 1XCAA 1ICNA 1MX8A 2WUTA 1BSYA 4KH8A 4YH0A 3NPOA 1IKEA 4GETA 1YWBA 3NBXX 1DFVA 4QZUA 5IO6A 5B27A 5IO7A 3EM0A 4NNSA 1BM5A 1D3SA 2Z4HA 4A8ZA 4KCAA 1AELA 1FENA 2AT5X 5KICA 3B2IA 1HQPA 3RWXA 1SXYA 4L3RA 1E5PA 1EW3A 3FYFA 4NYQA 3UEWA 1KQXA 1LNMA 2R56A 3EYCA 4EFGA 1U17A 5DG4A 2WWPA 1HMTA 4ORXA 5EDCA 4ZCBA 1JJJA 3T1DA 5EZ2A 1DZJA 4ODDA 3U0DA 2MM3A 1BSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KID A;  4YFP A;  1OBQ A;  2DM5 A;  2XKL A;  1SXW A;  5F1E A;  2NND A;  2AH7 X;  5LJK A;  2JOZ A;  1VYF A;  1FEM A;  4YKO A;  1JJX A;  2OZQ A;  2OVE A;  5F58 A;  2OFR X;  3L4R A;  1EPB A;  2WR6 A;  4ORU A;  2ACP X;  1LPJ A;  5AQ6 A;  3MVF A;  4MVI A;  2RCT A;  5JR8 A;  1DF3 A;  4DQ4 A;  1X89 A;  4HPC A;  3NQ3 A;  1HBP A;  1QY1 A;  2RQ0 A;  1KT4 A;  1CBR A;  5HWZ A;  3BSZ E;  3JS1 A;  1KT5 A;  3KFI A;  4I3D A;  2A2U A;  1OEK A;  2RCQ A;  3FA7 A;  3EBK A;  1KT3 A;  4RUU A;  1GT5 A;  2HNX A;  4YFR A;  1PBO A;  1GX9 A;  4MVK A;  2G78 A;  1GKA A;  5EPQ A;  1NGL A;  4D6A A;  3VG2 A;  1G74 A;  4UU2 A;  4IAX A;  1RLB E;  3FMZ A;  4Y0S A;  3QKG A;  5D8J A;  1SY2 A;  4AZO A;  2ANS A;  1SY1 A;  4M6S A;  2LFO A;  3UEU A;  4N7C A;  4YDA A;  4D6B A;  3CQN A;  1TVQ A;  3WJC A;  1JBH A;  1FE3 A;  2BLG A;  3FIQ A;  1D2U A;  2POA A;  3VG6 A;  1YWA A;  3NX1 A;  2QO5 A;  1CRB A;  1TXL A;  1YP6 A;  1SA8 A;  5LJB A;  1KZW A;  5D48 A;  5H9K A;  5LJD A;  1AB0 A;  4YGH A;  4AZM A;  1T68 X;  3P6F A;  5HZ8 A;  2LKK A;  4YKM A;  4CK4 A;  1E02 A;  3MBT A;  4ZHH A;  5EDB A;  2CBS A;  3DTQ A;  3CBC A;  2FR3 A;  4QYP A;  3PPT A;  4TLJ A;  5IO5 A;  5H8T A;  1QFT A;  3AKN A;  2FTB A;  3F8A A;  1OBU A;  1FEL A;  4QAE A;  2AT8 X;  5DPQ A;  1GGL A;  5L8N A;  4IB9 A;  2K62 A;  1G85 A;  3UEX A;  1YIV A;  3WJE A;  1QWD A;  3PP6 A;  4GNW A;  4ZGU A;  1EIO A;  5EED A;  4OS0 A;  1Z24 A;  4M7M A;  2L5P A;  3APW A;  1URE A;  2RD7 C;  3BU9 A;  2P8G A;  1MDC A;  1E00 A;  2N93 A;  1OBP A;  3F9D A;  2ALL X;  2X46 A;  3IFB A;  3VG7 A;  5HAE A;  1PMP A;  4HFO A;  3UEV A;  1EUO A;  2GC9 A;  1IFB A;  3TGA A;  3NP1 A;  4AZR A;  1PEE A;  4TNN A;  5FAZ A;  1QG5 A;  3STK A;  4IB8 A;  3KQ0 A;  3FA6 A;  4GKC A;  4O9S A;  4ZHD A;  4ZHF A;  1U18 A;  2LB6 A;  1DZK A;  3VG4 A;  1T8V A;  5HA0 A;  3TGC A;  3S26 A;  3KZA A;  2OFM X;  3BX7 A;  2HYS A;  1ACD A;  5HCC C;  1P6P A;  4I3B A;  3OJY C;  4TJZ A;  5HZ9 A;  4NP1 A;  1B0O A;  1QQS A;  4R0B A;  2L9C A;  5L8I A;  1OPA A;  3KFF A;  2GTF X;  2ACO A;  3FR2 A;  4BQU A;  4GH7 A;  1ICM A;  1ZNE A;  3KFH A;  3NR3 A;  3PEC A;  1O1U A;  2MJI A;  1LIF A;  4ARH A;  3I0A A;  2R74 A;  2JU3 A;  1B8E A;  3NQ9 A;  3FA9 A;  5HA1 A;  3D95 A;  4OS3 A;  4LKT A;  1QAB E;  5BVT A;  2FLJ A;  2QO6 A;  2AKQ A;  1JYJ A;  3B2K A;  3BDR A;  3TZS A;  2FT9 A;  2CZT A;  3P6G A;  2Q39 A;  3FW4 A;  1BRP A;  3HK1 A;  1I05 A;  5H9L A;  3C77 X;  1GKA B;  5HTD A;  3FEL A;  1CBQ A;  2NNQ A;  3APV A;  4BOE A;  1BSO A;  2CM9 A;  5KHP A;  1DV9 A;  1ZNG A;  3WJD A;  1VYG A;  3BU1 A;  3EBW A;  4I3C A;  4IBA A;  1BWY A;  2E4J A;  4I9R A;  3IA8 A;  2Q9S A;  2HLV A;  4AZN A;  4XMD A;  4IB7 A;  1HMS A;  1TW4 A;  4AYH A;  2FS7 A;  2WQA E;  1PM1 X;  1OPB A;  3B2L A;  5LJE A;  4ORW A;  2JN3 A;  3O19 A;  1ALB A;  1YP7 A;  5CE4 A;  3SAO A;  5D4A A;  1O8V A;  1O1V A;  4XMG A;  2KTD A;  4GE1 A;  3ZQ3 A;  5F7G A;  1IIU A;  1ZRY A;  3U9P C;  1S2P A;  3U03 A;  3BY0 A;  1I06 A;  3CWK A;  3APX A;  2W2F A;  4EEJ A;  2PY1 A;  1CBS A;  4LZU A;  1ZNH A;  2JU8 A;  2FRS A;  1R0U A;  3I17 A;  1MVG A;  1FDQ A;  4IAW A;  1X8N A;  3CR6 A;  2CBR A;  4YGG A;  3STN A;  3WJF A;  1CJ5 A;  2HZQ A;  3O2Y A;  4TKJ A;  4ORS A;  1G5W A;  1AQB A;  1YWD A;  5LKE A;  1DZM A;  1AVG I;  3GAQ A;  1GT4 A;  4OS8 A;  5FFH A;  2FS6 A;  5LKF A;  3ELX A;  4RUN A;  2QM9 A;  2W2A A;  4EXZ A;  4ZH9 A;  5HCE C;  5HBS A;  3FEP A;  3FLL A;  4UU3 A;  1KT6 A;  1IKJ A;  3B2J A;  3HWG A;  1KOI A;  2G79 A;  3WBG A;  4ZFX A;  5HZ6 A;  3C76 X;  3K3L A;  2A3F X;  1E06 A;  1HBQ A;  2AL0 X;  2NP1 A;  1BEB A;  3ELZ A;  4PSQ A;  3P6C A;  1DZP A;  1SXX A;  1QFV A;  2R73 A;  2RA6 A;  3BS2 A;  1ZNK A;  3P6D A;  4LKP A;  4YCH A;  2AMM X;  1SY0 A;  4AZQ A;  3BX8 A;  1LF7 A;  2A13 A;  3FR5 A;  3O22 A;  4OMW A;  5BVQ A;  4IMN A;  2EU7 X;  3PH5 A;  1X8U A;  3PH6 A;  2CZU A;  4NLJ A;  5F6B A;  4HPA A;  4HPB A;  1OEJ A;  1LKE A;  5HTE A;  4ZR2 A;  4XME A;  1T0V A;  2NNE A;  1X8P A;  3WJB A;  1GT3 A;  2CM4 A;  4QGW A;  3ZUO A;  4YDB A;  4NLI A;  4IB6 A;  4EDE A;  1ERB A;  2OVD A;  1NP1 A;  1GXA A;  4GNY A;  4A1H A;  2X45 A;  2FR2 A;  3P6E A;  2MO5 A;  5K06 A;  2HZR A;  1TOW A;  2O62 A;  4A1Y A;  3APU A;  3STM X;  2GJ5 A;  4TKH A;  4IMO A;  4AZP A;  1HN2 A;  4AW8 A;  4YMY A;  2AT6 X;  3EMM A;  4WFU A;  4ALO A;  1KGL A;  1GM6 A;  1KXO A;  4YBP A;  2WSJ A;  3C78 X;  2A2G A;  3PED A;  5HZ5 A;  3BLG A;  2AT0 X;  3D97 A;  2W2B A;  1JZU A;  1B4M A;  5LJC A;  2WEX A;  1I4U A;  1KQW A;  2OVA A;  1LIC A;  4NNT A;  4ES7 A;  4ZHC A;  1ML7 A;  5HCD C;  3TGB A;  3FA8 A;  1ZNL A;  5C0N A;  4ZJ0 A;  5F6Z A;  4YFQ A;  4TQ2 A;  2ASN X;  3FW5 A;  4XMH A;  1A2D A;  4Y0Q A;  3HWE A;  1BJ7 A;  1LID A;  1YWC A;  4ORY A;  2LBV A;  3FEK A;  1KZX A;  2KT4 B;  1FTP A;  4K19 A;  4NYR A;  5D45 A;  5BVS A;  3RZY A;  3B2H A;  5L8O A;  4ZH6 A;  1S7D A;  1MUP A;  4TKB A;  4DQ3 A;  3CBS A;  2YG2 A;  5FEN A;  3WVM A;  2JU7 A;  1IFC A;  2QOS C;  3D96 A;  1RBP A;  1EQD A;  2LBA A;  1MX7 A;  1HMR A;  1YUP A;  2WQ9 A;  3P6H A;  4WBK A;  3DSZ A;  3CQR A;  3Q6L A;  1NP4 A;  1BBP A;  4N7D A;  2K23 A;  1SY3 A;  1X8Q A;  1QY2 A;  1A57 A;  1QY0 A;  1G7N A;  4WFV A;  3HWD A;  1GT1 A;  4GRJ A;  3CMP A;  1A18 A;  5H9N A;  2HMB A;  1TOU A;  2G7B A;  5H9A A;  4YBU A;  3VG3 A;  4YCE A;  3WXQ A;  5EEE A;  3FEN A;  1L6M A;  1UZ2 X;  5D47 A;  4ORR A;  4QYN A;  1JV4 A;  2A0A A;  3NAD A;  1OEE A;  1H91 A;  4HPD A;  2L68 A;  4YGZ A;  2WEW A;  1LIB A;  3TF6 A;  3VG5 A;  4OMX A;  4I9S A;  5HZQ A;  4Y0R A;  1S44 A;  1DC9 A;  1KT7 A;  1ADL A;  2AT3 X;  4Y0P A;  3ZUI A;  3HWF A;  1BLR A;  1EXS A;  1LIE A;  1X8O A;  2IFB A;  4A60 A;  1U0X A;  3JSQ A;  4XMF A;  4KII A;  5B29 A;  4MVL A;  4ZHG A;  3WJG A;  1JYD A;  2Q4N A;  2QO4 A;  1B56 A;  1A3Y A;  1I04 A;  3BRN A;  1LFO A;  1SXU A;  1GX8 A;  1EAL A;  5LJH A;  4LZV A;  2XST A;  4XMC A;  1BRQ A;  3RSW A;  4QGV A;  4ALB A;  1CBI A;  1XKI A;  4QZT A;  3KFG A;  4QGX A;  1N0S A;  2L67 A;  1EPA A;  2FWV A;  1ZND A;  1X71 A;  2F73 A;  3G7X A;  2Q2M A;  1IW2 A;  3AKM A;  5LJG A;  3FR4 A;  1VPR A;  4BVM A;  2Q2P A;  1EII A;  1ERX A;  3NX2 A;  1XCA A;  1ICN A;  1MX8 A;  2WUT A;  1BSY A;  4YH0 A;  3NPO A;  1IKE A;  4GET A;  1YWB A;  5IO6 A;  1DFV A;  4QZU A;  5B27 A;  5IO7 A;  3EM0 A;  4NNS A;  1BM5 A;  1D3S A;  4A8Z A;  1AEL A;  1FEN A;  2AT5 X;  5KIC A;  3B2I A;  1HQP A;  1SXY A;  1E5P A;  1EW3 A;  4NYQ A;  3UEW A;  1KQX A;  1LNM A;  2R56 A;  3EYC A;  4EFG A;  1U17 A;  5DG4 A;  2WWP A;  1HMT A;  4ORX A;  5EDC A;  4ZCB A;  1JJJ A;  3T1D A;  5EZ2 A;  1DZJ A;  4ODD A;  3U0D A;  2MM3 A;  1BSQ A; 
#chains in the Genus database with same CATH topology
 4YVB A;  2CAM A;  5KID A;  3P24 A;  4YFP A;  1NQN A;  1OBQ A;  2DM5 A;  2XKL A;  1SXW A;  5F1E A;  2NND A;  2AH7 X;  5LJK A;  2JOZ A;  1VYF A;  1FEM A;  4YKO A;  3RBY A;  1JJX A;  2QCB A;  3MM0 A;  3OD9 A;  1SRJ A;  3AEH A;  2F01 A;  1N43 A;  2IZK A;  2OZQ A;  2OVE A;  5F58 A;  2OFR X;  3L4R A;  3F6Z B;  1EPB A;  2F09 A;  2WR6 A;  4ORU A;  2ACP X;  1LPJ A;  3OBL A;  5AQ6 A;  3MVF A;  2A5C A;  4MVI A;  2RCT A;  1MK5 A;  1WUB A;  1VWM B;  5JR8 A;  4DQ4 A;  1DF3 A;  1X89 A;  3MX7 A;  2OL6 O;  3NQ3 A;  1HBP A;  4HPC A;  3WYQ A;  1QY1 A;  4BX5 A;  2RQ0 A;  1KT4 A;  1CBR A;  2BSZ A;  5HWZ A;  3BSZ E;  1SWJ A;  3JS1 A;  1KT5 A;  2GH7 A;  3KFI A;  4OEM A;  3VU1 A;  4I3D A;  2A2U A;  3JQO A;  1OEK A;  2RCQ A;  4COT A;  3FA7 A;  1SWR A;  2FHN X;  3EBK A;  1KT3 A;  4RUU A;  1GT5 A;  1HXL A;  2HNX A;  4YFR A;  1PBO A;  1GX9 A;  1SWC A;  3OE3 A;  4MVK A;  1Y0G A;  4FGI B;  3PDF A;  2G78 A;  4Z28 A;  1GKA A;  5CHK A;  1W4T A;  5EPQ A;  1NGL A;  4D6A A;  2OVS A;  3SZH A;  3VG2 A;  2A5B A;  1G74 A;  4UU2 A;  3RDQ A;  4IAX A;  3WZN A;  4Z2V A;  1RLB E;  1NQM A;  3FMZ A;  4Y0S A;  3QKG A;  5D8J A;  4WHI A;  1SY2 A;  2GTL N;  3EC5 A;  1E2T A;  1SRI A;  4AZO A;  2ANS A;  1SY1 A;  4M6S A;  2OFB A;  2LFO A;  3UEU A;  4N7C A;  4YDA A;  2LA7 A;  1SWD A;  2FKJ A;  2GTL M;  4D6B A;  3CQN A;  1RST B;  3VE2 A;  1VWK B;  5IRW A;  1TVQ A;  3WJC A;  1JBH A;  1FE3 A;  3HPE A;  2BLG A;  3FIQ A;  1D2U A;  3HOE A;  4GGZ A;  4MVE A;  2POA A;  3VG6 A;  3X00 A;  1YWA A;  3NX1 A;  2QO5 A;  3S60 A;  1CRB A;  1TXL A;  1YP6 A;  1SA8 A;  2VFB A;  5LJB A;  1KZW A;  5D48 A;  5H9K A;  5LJD A;  1AB0 A;  4YGH A;  4HWM A;  4U8U N;  4AZM A;  1T68 X;  3P6F A;  2RTA A;  2BS6 A;  3LHN A;  5HZ8 A;  2LKK A;  3SLJ A;  4YKM A;  4CK4 A;  1E02 A;  3MBT A;  4ZHH A;  1Y53 X;  2FGS A;  4NV8 A;  2RTC B;  4QQ1 A;  2CBS A;  3DTQ A;  2MHD A;  5EDB A;  3CBC A;  4ON1 A;  2FR3 A;  4Z6J A;  2RTJ A;  4QYP A;  3PPT A;  2YMS A;  4TLJ A;  5IO5 A;  5H8T A;  1QFT A;  3AKN A;  2FTB A;  3F8A A;  1OBU A;  1FEL A;  4QAE A;  4GZV A;  2AT8 X;  5DPQ A;  3CKF A;  1GGL A;  5L8N A;  4IB9 A;  2K62 A;  1G85 A;  2RTL A;  3UEX A;  1YIV A;  3LV4 A;  1JMZ A;  3WJE A;  1QWD A;  5AJB A;  3RY1 A;  3RDU A;  3PP6 A;  4GNW A;  1PBY A;  1NC9 A;  4ZGU A;  5EED A;  3HTY A;  4OS0 A;  1Z24 A;  1LDO A;  1EIO A;  4M7M A;  2L5P A;  3APW A;  3PK2 A;  3H3I A;  1URE A;  2RD7 C;  2C4I A;  2X32 A;  3BU9 A;  2P8G A;  1MDC A;  1E00 A;  2N93 A;  1OBP A;  3F9D A;  2ALL X;  2QOM A;  2X46 A;  3IFB A;  3VG7 A;  1SLD B;  1STP A;  3MG5 A;  3GE2 A;  4INN A;  5HAE A;  1PMP A;  4HFO A;  1N9M A;  1EUO A;  2GC9 A;  1IFB A;  3RE5 A;  3TGA A;  1WBI A;  3NP1 A;  3UEV A;  3WYP A;  3ZW1 B;  1PEE A;  4AZR A;  2OY5 O;  4TNN A;  5FAZ A;  5IRA A;  1QG5 A;  3STK A;  4IB8 A;  3KQ0 A;  3FA6 A;  4GKC A;  4O9S A;  4BX7 B;  4ZHD A;  4ZHF A;  1U18 A;  4GJS A;  1STR B;  2LB6 A;  1DZK A;  3VG4 A;  2BS5 A;  1SRH A;  4GD9 A;  1T8V A;  1GX3 A;  5HA0 A;  3TGC A;  1K3B A;  2OY1 O;  3S26 A;  3KZA A;  2OFM X;  3BX7 A;  2HYS A;  1ACD A;  5K68 A;  5HCC C;  3T6L A;  1P6P A;  4I3B A;  1SWF A;  3OJY C;  4TJZ A;  4JNJ A;  3S5X A;  5HZ9 A;  4NW4 A;  2OL7 A;  4MIS A;  4NP1 A;  2M4L A;  1B0O A;  1QQS A;  1SWE A;  3AUM O;  2L9C A;  4R0B A;  1OPA A;  3KFF A;  2GTF X;  5L8I A;  2ACO A;  2GTL O;  3FR2 A;  4BQU A;  4GH7 A;  1VWI B;  1ICM A;  1ZNE A;  3KFH A;  4CDC A;  3NR3 A;  3PEC A;  1SWA A;  4CPE A;  3RDM A;  1O1U A;  2MJI A;  3VGW A;  1LIF A;  2X56 A;  3SOT A;  4ARH A;  3I0A A;  2RTE B;  3S5V A;  4LQZ A;  2R74 A;  2JU3 A;  1SWU A;  2OF9 A;  1B8E A;  3KVN A;  3NQ9 A;  3V8U A;  3FA9 A;  5HA1 A;  4BX5 B;  2VDF A;  3D95 A;  4OS3 A;  4DCB A;  4LKT A;  1LCV A;  1VWL B;  1QAB E;  2IZF B;  5BVT A;  4Z2P A;  4GDZ A;  2FLJ A;  2QO6 A;  2AKQ A;  1JYJ A;  1EI5 A;  2IZB A;  2X8F A;  2FT9 A;  2CZT A;  3B2K A;  3BDR A;  2Q39 A;  3FW4 A;  3FID A;  3P6G A;  4ID2 A;  4CDD A;  5IRU A;  4U8U O;  1BRP A;  3HK1 A;  1I05 A;  4NV7 A;  5H9L A;  3EW1 A;  4I6S A;  3C77 X;  1GKA B;  1VWG B;  2RN4 A;  1SWQ A;  5HTD A;  2I5V O;  3FEL A;  1CBQ A;  2NNQ A;  3APV A;  5B3M O;  1SWB A;  1BSO A;  1MM9 A;  2CM9 A;  4BOE A;  5KHP A;  1DV9 A;  1ZNG A;  3WJD A;  1VYG A;  3BU1 A;  3EBW A;  4I3C A;  4IBA A;  1BWY A;  2E4J A;  4I9R A;  3IA8 A;  2Q9S A;  2HLV A;  1VYO A;  4AZN A;  3P02 A;  1SWL A;  1VWC B;  4MEE A;  1STS B;  4XMD A;  2C1Q A;  4IB7 A;  1HMS A;  1TW4 A;  4AYH A;  2FS7 A;  4DNE A;  2WQA E;  1PM1 X;  4BBO A;  2FHL A;  2G8C O;  2RTP B;  1OPB A;  4Z2O A;  4O4U A;  3ZWE A;  3B2L A;  1LDQ A;  2OY8 A;  5LJE A;  1IJ8 A;  2IZE B;  3D4R A;  1Y52 X;  3LTW A;  4ORW A;  4ML7 B;  2JN3 A;  3O19 A;  1ALB A;  1YP7 A;  5CE4 A;  3SAO A;  5D4A A;  3ZW0 A;  1O8V A;  3T6F A;  4B55 A;  1O1V A;  4XMG A;  2KTD A;  4GE1 A;  1NBX A;  3ZQ3 A;  5F7G A;  1IIU A;  1ZRY A;  2OF8 A;  2G5L A;  2KW1 A;  3U9P C;  1S2P A;  3WZO A;  3U03 A;  3BY0 A;  1I06 A;  3Q34 A;  3VHI A;  2JGS A;  3APX A;  3CWK A;  2W2F A;  4EEJ A;  4KT5 A;  4OEL A;  5AJC A;  2PY1 A;  1CBS A;  4JHQ A;  4LZU A;  2Z4I A;  1PTS A;  1ZNH A;  2JU8 A;  2PI3 O;  2FRS A;  4PJ2 A;  1R0U A;  3I17 A;  4YCH A;  1MVG A;  1FDQ A;  4IAW A;  3T2X A;  3ZZV A;  1X8N A;  3CR6 A;  3NQK A;  2CBR A;  2RTR B;  3PQS A;  4YGG A;  1W5R A;  3STN A;  3WJF A;  2HZQ A;  3O2Y A;  4TKJ A;  1CJ5 A;  4ORS A;  2OFA A;  1FJ1 E;  4O3W A;  1G5W A;  1AQB A;  3RY2 A;  1YWD A;  5LKE A;  1DZM A;  1SMP I;  4U8U M;  1AVG I;  3RDX A;  1SWH A;  4BGF A;  2Y3E A;  3GAQ A;  1GT4 A;  1KL3 A;  1VWJ B;  2HKD A;  2FS6 A;  4OS8 A;  1JIW I;  4QRL A;  2QMI A;  5FFH A;  5LKF A;  2RTH B;  3ELX A;  2QM9 A;  4RUN A;  2W2A A;  3ZI8 A;  4BJ8 A;  4EXZ A;  2IZG B;  4ZH9 A;  5HCE C;  5HBS A;  3FEP A;  1UYN X;  4MIR A;  1SLE B;  3FLL A;  4UU3 A;  5AEO A;  1KT6 A;  4JGL A;  4BX6 A;  4FBO A;  4CPH A;  1IKJ A;  4I60 A;  5B5F A;  4CPI A;  5B11 O;  3B2J A;  3HWG A;  4CSB A;  1KOI A;  2ZAG A;  2G79 A;  3QQ2 A;  3WBG A;  4ZFX A;  5HZ6 A;  3C76 X;  2JW1 A;  3K3L A;  2A3F X;  1E06 A;  2JMB A;  2RTQ B;  1HBQ A;  2AL0 X;  2NP1 A;  1BEB A;  3ELZ A;  2IZC B;  2FKG A;  4PSQ A;  3P6C A;  1DZP A;  1SXX A;  1QFV A;  2IZL B;  2R73 A;  2RA6 A;  1ZNK A;  3BS2 A;  3P6D A;  4LKP A;  2AMM X;  1SY0 A;  4U9C A;  4AZQ A;  3BX8 A;  1LF7 A;  2A13 A;  3FR5 A;  3O22 A;  1UYO X;  4OMW A;  3E3C A;  5BVQ A;  2IZJ A;  4IMN A;  4JO6 A;  4I95 A;  2EU7 X;  3PH5 A;  1X8U A;  4U3Q A;  3CKG A;  3PH6 A;  2CZU A;  4NLJ A;  5F6B A;  4HPA A;  4HPB A;  1OEJ A;  2DJG A;  1LKE A;  4OKA A;  2RTG B;  5B5G A;  5HTE A;  1I9H A;  1LCZ A;  3EW2 A;  4ZR2 A;  3RDO A;  4XME A;  1T0V A;  2NNE A;  5B10 O;  4CPF A;  3HOL A;  4EKV A;  1X8P A;  2X4M A;  3WJB A;  2IZA A;  4FBV A;  1GT3 A;  2CM4 A;  2VFC A;  4QGW A;  3ZUO A;  4YDB A;  4NLI A;  1LCW A;  1SLG B;  4IB6 A;  4EDE A;  1ERB A;  1N9Y A;  2BHV A;  1NP1 A;  1GXA A;  1SWG A;  2AF5 A;  2OVD A;  2RTM A;  4GU8 A;  4GNY A;  4Y59 A;  4EQA C;  4A1H A;  2X45 A;  2FR2 A;  2X34 A;  1K24 A;  2X8T A;  3SLT A;  3P6E A;  4IRW A;  2MO5 A;  2BT9 A;  5K06 A;  4O49 A;  1SWN A;  2HZR A;  5FQ6 E;  1TOW A;  2O62 A;  1VWQ B;  4A1Y A;  3APU A;  3STM X;  2GJ5 A;  4TKH A;  3ZW1 A;  1HQQ A;  5FQ8 E;  2MWH A;  4IMO A;  4CDE A;  3TZS A;  4AZP A;  1HN2 A;  2ZSC A;  4AW8 A;  4YMY A;  2UZ2 A;  2AT6 X;  3EMM A;  4FQB B;  4QNI A;  4WFU A;  4ALO A;  1KGL A;  1GM6 A;  2RTN B;  3SLO A;  1KXO A;  1RXH A;  2WSJ A;  3FDC A;  3C78 X;  4YBP A;  1VWA B;  2A2G A;  2Y3F A;  3PED A;  2RTK A;  1VWO B;  3BLG A;  5HZ5 A;  5IXG A;  2AT0 X;  4O4O A;  1N4J A;  3D97 A;  4O3Y A;  2W2B A;  4GJV A;  4CV7 A;  1JZU A;  1HXZ A;  5LJC A;  2WEX A;  3VHM A;  4U46 A;  2A8G A;  5L3Y A;  2X8S A;  1B4M A;  1I4U A;  1KQW A;  1AVE A;  2OVA A;  1LIC A;  4NNT A;  1OSP O;  4ES7 A;  4KC8 A;  3WZQ A;  4O3Z A;  1ML7 A;  4ZHC A;  5HCD C;  3TGB A;  3FA8 A;  1ZNL A;  4C5P A;  5C0N A;  4ZJ0 A;  5F6Z A;  2C1S A;  4YFQ A;  1VWR B;  2ASN X;  3FW5 A;  1I78 A;  4XMH A;  1A2D A;  4TQ2 A;  4Y0Q A;  3HWE A;  1BJ7 A;  1LID A;  1VWD B;  1YWC A;  4ORY A;  1DF8 A;  2LBV A;  3FEK A;  1KZX A;  1HY2 A;  2KT4 B;  1FTP A;  4K19 A;  4NYR A;  4O4X A;  2KD2 A;  5D45 A;  5BVS A;  3RZY A;  3B2H A;  5L8O A;  2UYW A;  4ZH6 A;  2OYB O;  1S7D A;  1MUP A;  3ZW0 B;  1KL4 A;  4TKB A;  4DQ3 A;  2X55 A;  3CBS A;  4L1N A;  2YG2 A;  1SRG A;  2RTF B;  1KFF A;  5FEN A;  3WVM A;  3WZP A;  2RTB B;  2JU7 A;  3T2W A;  1IFC A;  2QOS C;  3D96 A;  1RBP A;  5F2B A;  1SWP A;  1EQD A;  2LBA A;  1MX7 A;  4O4S A;  1HMR A;  1MOY A;  1YUP A;  4GGR A;  2WQ9 A;  1RXK A;  3D9W A;  3P6H A;  4Z27 A;  4WBK A;  3DSZ A;  3CQR A;  3Q6L A;  1BSQ A;  1NP4 A;  4ZGF A;  2KTS A;  2IZI A;  5B2A O;  1BBP A;  3WOV A;  1SRE A;  5BYP A;  4N7D A;  2K23 A;  1SY3 A;  1X8Q A;  4GGT A;  1QY2 A;  1A57 A;  1QY0 A;  5FQ7 E;  1G7N A;  4WFV A;  3HWD A;  1GT1 A;  4GRJ A;  3CMP A;  4FBR A;  1A18 A;  5H9N A;  1SWS A;  4GK9 A;  2HMB A;  1TOU A;  2G7B A;  5H9A A;  4YBU A;  3VG3 A;  4YCE A;  3WXQ A;  5EEE A;  3FEN A;  1L6M A;  4BCS A;  1UZ2 X;  2IZD B;  5D47 A;  4ORR A;  4QYN A;  1JV4 A;  2A0A A;  5JD2 A;  4BX6 B;  4CPH B;  3NAD A;  1OEE A;  1H91 A;  1VWN B;  1SLF B;  4HPD A;  2L68 A;  2ZAI A;  4YGZ A;  2OL8 O;  2WEW A;  4GDA A;  5CYB A;  1LIB A;  1SWT A;  3TF6 A;  3VG5 A;  3RKG A;  4OMX A;  4I9S A;  3UAQ A;  5HZQ A;  4Y0R A;  1S44 A;  1DC9 A;  1KT7 A;  4O3X B;  1ADL A;  1VWH B;  2AT3 X;  4IAB A;  4Y0P A;  1W6F A;  3RDS A;  3HWF A;  3ZUI A;  1BLR A;  4CDF A;  1EXS A;  1LIE A;  1N7Y A;  1X8O A;  1RXJ A;  1Y55 X;  2IFB A;  3N91 A;  4A60 A;  3VE1 A;  1U0X A;  3JSQ A;  4XMF A;  4KII A;  1LEL A;  5B29 A;  4MVL A;  3VPJ E;  4ZHG A;  3WJG A;  1JYD A;  1Y9L A;  2Q4N A;  2QO4 A;  1B56 A;  3RE6 A;  1A3Y A;  1I04 A;  3BRN A;  1LFO A;  1SXU A;  3SZJ A;  1SWK A;  1GX8 A;  1EAL A;  2Y32 A;  5LJH A;  4LZV A;  4KC7 A;  2XST A;  4XMC A;  1BRQ A;  2I5Z O;  3RSW A;  4QGV A;  2BC3 A;  4ALB A;  1CBI A;  1XKI A;  4QZT A;  1VWE B;  3KFG A;  3ZW2 A;  4QGX A;  1N0S A;  2L67 A;  1EPA A;  1Y9T A;  2FWV A;  1ZND A;  1X71 A;  2F73 A;  3G7X A;  4Y5D A;  2Q2M A;  1IW2 A;  3AKM A;  5LJG A;  3FR4 A;  1VPR A;  3PQU A;  2AVI A;  2Q2P A;  4BVM A;  1ERX A;  2RTD B;  1EII A;  3NX2 A;  1XCA A;  2OY7 A;  1VWF B;  1ICN A;  1NDJ A;  1SRF A;  1MX8 A;  2WUT A;  2RTI B;  1AVD A;  1VWB B;  2RTO B;  1BSY A;  1LUQ A;  1SWO A;  1RSU B;  2WPU A;  4KH8 A;  4YH0 A;  3NPO A;  1IKE A;  4GET A;  1YWB A;  3NBX X;  1DFV A;  4QZU A;  5IO6 A;  5B27 A;  1JMX A;  5CSE A;  5IO7 A;  3EM0 A;  4NNS A;  1BM5 A;  1MEP A;  4GUZ A;  1D3S A;  1VWP B;  2Z4H A;  4A8Z A;  4KCA A;  2IZH B;  2DJF A;  1AEL A;  1FEN A;  1JQP A;  2AT5 X;  5KIC A;  3B2I A;  1HQP A;  1JJU A;  3RWX A;  1SXY A;  2MF6 A;  4L3R A;  1E5P A;  1EW3 A;  3FYF A;  4NYQ A;  1KL5 A;  3UEW A;  1KQX A;  3VHH A;  4BX7 A;  1LNM A;  2R56 A;  3EYC A;  4EFG A;  1U17 A;  5DG4 A;  2WWP A;  1HMT A;  4ORX A;  5EDC A;  4ZCB A;  1JJJ A;  3T1D A;  5EZ2 A;  1DZJ A;  5K67 A;  4ODD A;  3U0D A;  2MM3 A;  1RAV A;  3SZI A; 
#chains in the Genus database with same CATH homology
 5KID A;  3P24 A;  4YFP A;  1OBQ A;  2DM5 A;  2XKL A;  1SXW A;  5F1E A;  2NND A;  2AH7 X;  5LJK A;  2JOZ A;  1VYF A;  1FEM A;  4YKO A;  3RBY A;  1JJX A;  3OD9 A;  2OZQ A;  2OVE A;  5F58 A;  2OFR X;  3L4R A;  3F6Z B;  1EPB A;  2F09 A;  2WR6 A;  4ORU A;  2ACP X;  1LPJ A;  3OBL A;  5AQ6 A;  3MVF A;  4MVI A;  2RCT A;  5JR8 A;  1DF3 A;  4DQ4 A;  1X89 A;  3MX7 A;  4HPC A;  3NQ3 A;  1HBP A;  1QY1 A;  2RQ0 A;  1KT4 A;  1CBR A;  5HWZ A;  3BSZ E;  3JS1 A;  1KT5 A;  3KFI A;  3VU1 A;  4I3D A;  2A2U A;  3JQO A;  1OEK A;  2RCQ A;  4COT A;  3FA7 A;  3EBK A;  1KT3 A;  4RUU A;  1GT5 A;  2HNX A;  4YFR A;  1PBO A;  1GX9 A;  3OE3 A;  4MVK A;  4FGI B;  2G78 A;  1GKA A;  5EPQ A;  1NGL A;  4D6A A;  2OVS A;  3VG2 A;  1G74 A;  4UU2 A;  4IAX A;  1RLB E;  3FMZ A;  4Y0S A;  3QKG A;  5D8J A;  4WHI A;  1SY2 A;  2GTL N;  4AZO A;  2ANS A;  1SY1 A;  4M6S A;  2LFO A;  3UEU A;  4N7C A;  4YDA A;  2LA7 A;  2GTL M;  4D6B A;  3CQN A;  3VE2 A;  1TVQ A;  3WJC A;  1JBH A;  1FE3 A;  2BLG A;  3FIQ A;  1D2U A;  3HOE A;  4MVE A;  2POA A;  3VG6 A;  1YWA A;  3NX1 A;  2QO5 A;  3S60 A;  1CRB A;  1TXL A;  1YP6 A;  1SA8 A;  5LJB A;  1KZW A;  5D48 A;  5H9K A;  5LJD A;  1AB0 A;  4YGH A;  4HWM A;  4U8U N;  4AZM A;  1T68 X;  3P6F A;  2BS6 A;  3LHN A;  5HZ8 A;  2LKK A;  4YKM A;  4CK4 A;  1E02 A;  3MBT A;  4ZHH A;  4QQ1 A;  2CBS A;  3DTQ A;  2MHD A;  5EDB A;  3CBC A;  4ON1 A;  2FR3 A;  4QYP A;  3PPT A;  2YMS A;  4TLJ A;  5IO5 A;  5H8T A;  1QFT A;  3AKN A;  2FTB A;  3F8A A;  1OBU A;  1FEL A;  4QAE A;  4GZV A;  2AT8 X;  5DPQ A;  1GGL A;  5L8N A;  4IB9 A;  2K62 A;  1G85 A;  3UEX A;  1YIV A;  3LV4 A;  3WJE A;  1QWD A;  5AJB A;  3PP6 A;  4GNW A;  4ZGU A;  1EIO A;  5EED A;  3HTY A;  4OS0 A;  1Z24 A;  4M7M A;  2L5P A;  3APW A;  3H3I A;  1URE A;  2RD7 C;  3BU9 A;  2P8G A;  1MDC A;  1E00 A;  2N93 A;  1OBP A;  3F9D A;  2ALL X;  2X46 A;  3IFB A;  3VG7 A;  3GE2 A;  4INN A;  5HAE A;  1PMP A;  4HFO A;  3UEV A;  1EUO A;  2GC9 A;  1IFB A;  3TGA A;  3ZW1 B;  3NP1 A;  4AZR A;  1PEE A;  4TNN A;  5FAZ A;  1QG5 A;  3STK A;  4IB8 A;  3KQ0 A;  3FA6 A;  4GKC A;  4O9S A;  4ZHD A;  4ZHF A;  1U18 A;  2LB6 A;  1DZK A;  3VG4 A;  2BS5 A;  1T8V A;  5HA0 A;  3TGC A;  3S26 A;  3KZA A;  2OFM X;  3BX7 A;  2HYS A;  1ACD A;  5HCC C;  1P6P A;  4I3B A;  3OJY C;  4TJZ A;  3S5X A;  5HZ9 A;  4NW4 A;  4MIS A;  4NP1 A;  2M4L A;  1B0O A;  1QQS A;  4R0B A;  2L9C A;  5L8I A;  1OPA A;  3KFF A;  2GTF X;  2ACO A;  2GTL O;  3FR2 A;  4BQU A;  4GH7 A;  1ICM A;  1ZNE A;  3KFH A;  3NR3 A;  3PEC A;  1O1U A;  2MJI A;  1LIF A;  3SOT A;  4ARH A;  3I0A A;  3S5V A;  4LQZ A;  2R74 A;  2JU3 A;  1B8E A;  3NQ9 A;  3V8U A;  3FA9 A;  5HA1 A;  3D95 A;  4OS3 A;  4LKT A;  1QAB E;  5BVT A;  4GDZ A;  2FLJ A;  2QO6 A;  2AKQ A;  1JYJ A;  1EI5 A;  2X8F A;  3B2K A;  2FT9 A;  2CZT A;  3BDR A;  3P6G A;  2Q39 A;  3FW4 A;  4ID2 A;  4U8U O;  1BRP A;  3HK1 A;  1I05 A;  5H9L A;  4I6S A;  3C77 X;  1GKA B;  2RN4 A;  5HTD A;  3FEL A;  1CBQ A;  2NNQ A;  3APV A;  4BOE A;  1BSO A;  2CM9 A;  5KHP A;  1DV9 A;  1ZNG A;  3WJD A;  1VYG A;  3BU1 A;  3EBW A;  4I3C A;  4IBA A;  1BWY A;  2E4J A;  4I9R A;  3IA8 A;  2Q9S A;  2HLV A;  4AZN A;  3P02 A;  4XMD A;  4IB7 A;  1HMS A;  1TW4 A;  4AYH A;  2FS7 A;  2WQA E;  1PM1 X;  1OPB A;  4O4U A;  3ZWE A;  3B2L A;  5LJE A;  3D4R A;  4ORW A;  4ML7 B;  2JN3 A;  3O19 A;  1ALB A;  1YP7 A;  5CE4 A;  3SAO A;  5D4A A;  3ZW0 A;  1O8V A;  1O1V A;  4XMG A;  2KTD A;  4GE1 A;  3ZQ3 A;  5F7G A;  1IIU A;  1ZRY A;  3U9P C;  2KW1 A;  1S2P A;  3U03 A;  3BY0 A;  1I06 A;  3CWK A;  3APX A;  2W2F A;  4EEJ A;  4KT5 A;  5AJC A;  2PY1 A;  1CBS A;  4LZU A;  2Z4I A;  1ZNH A;  2JU8 A;  4PJ2 A;  2FRS A;  4YCH A;  1R0U A;  3I17 A;  1MVG A;  1FDQ A;  4IAW A;  3ZZV A;  1X8N A;  3CR6 A;  3NQK A;  2CBR A;  3PQS A;  4YGG A;  3STN A;  3WJF A;  1CJ5 A;  2HZQ A;  3O2Y A;  4TKJ A;  4ORS A;  4O3W A;  1G5W A;  1AQB A;  1YWD A;  5LKE A;  1DZM A;  1SMP I;  4U8U M;  1AVG I;  3GAQ A;  1GT4 A;  4OS8 A;  4QRL A;  5FFH A;  2FS6 A;  1JIW I;  5LKF A;  2QMI A;  3ELX A;  4RUN A;  2QM9 A;  3ZI8 A;  2W2A A;  4EXZ A;  4ZH9 A;  5HCE C;  5HBS A;  3FEP A;  4MIR A;  3FLL A;  4UU3 A;  5AEO A;  1KT6 A;  4JGL A;  4FBO A;  1IKJ A;  3B2J A;  3HWG A;  4CSB A;  1KOI A;  2ZAG A;  2G79 A;  3WBG A;  4ZFX A;  5HZ6 A;  3C76 X;  2JW1 A;  3K3L A;  2A3F X;  1E06 A;  2JMB A;  1HBQ A;  2AL0 X;  2NP1 A;  1BEB A;  3ELZ A;  4PSQ A;  3P6C A;  1DZP A;  1SXX A;  1QFV A;  2R73 A;  2RA6 A;  3BS2 A;  1ZNK A;  3P6D A;  4LKP A;  4U9C A;  2AMM X;  1SY0 A;  4AZQ A;  3BX8 A;  1LF7 A;  2A13 A;  3FR5 A;  3O22 A;  4OMW A;  3E3C A;  5BVQ A;  4IMN A;  4I95 A;  2EU7 X;  3PH5 A;  1X8U A;  4U3Q A;  3PH6 A;  2CZU A;  4NLJ A;  5F6B A;  4HPA A;  4HPB A;  1OEJ A;  1LKE A;  5HTE A;  4ZR2 A;  4XME A;  1T0V A;  2NNE A;  3HOL A;  1X8P A;  3WJB A;  4FBV A;  1GT3 A;  2CM4 A;  4QGW A;  3ZUO A;  4YDB A;  4NLI A;  4IB6 A;  4EDE A;  1ERB A;  2BHV A;  2OVD A;  1NP1 A;  1GXA A;  4GU8 A;  4GNY A;  4A1H A;  2X45 A;  2FR2 A;  2X8T A;  3P6E A;  2MO5 A;  2BT9 A;  5K06 A;  4O49 A;  5FQ6 E;  2HZR A;  1TOW A;  2O62 A;  4A1Y A;  3APU A;  3STM X;  2GJ5 A;  4TKH A;  3ZW1 A;  5FQ8 E;  2MWH A;  4IMO A;  3TZS A;  4AZP A;  1HN2 A;  4AW8 A;  4YMY A;  2AT6 X;  3EMM A;  4FQB B;  4QNI A;  4WFU A;  4ALO A;  1KGL A;  1GM6 A;  1KXO A;  4YBP A;  2WSJ A;  3C78 X;  2A2G A;  3PED A;  5HZ5 A;  3BLG A;  2AT0 X;  4O4O A;  3D97 A;  4O3Y A;  2W2B A;  4CV7 A;  1JZU A;  1B4M A;  5LJC A;  2WEX A;  2X8S A;  1I4U A;  1KQW A;  2OVA A;  1LIC A;  4NNT A;  4ES7 A;  4KC8 A;  4ZHC A;  4O3Z A;  1ML7 A;  5HCD C;  3TGB A;  3FA8 A;  1ZNL A;  5C0N A;  4ZJ0 A;  5F6Z A;  4YFQ A;  4TQ2 A;  2ASN X;  3FW5 A;  4XMH A;  1A2D A;  4Y0Q A;  3HWE A;  1BJ7 A;  1LID A;  1YWC A;  4ORY A;  2LBV A;  3FEK A;  1KZX A;  2KT4 B;  1FTP A;  4K19 A;  4NYR A;  4O4X A;  2KD2 A;  5D45 A;  5BVS A;  3RZY A;  3B2H A;  5L8O A;  4ZH6 A;  1S7D A;  1MUP A;  3ZW0 B;  4TKB A;  4DQ3 A;  4L1N A;  3CBS A;  2YG2 A;  5FEN A;  3WVM A;  2JU7 A;  1IFC A;  2QOS C;  3D96 A;  1RBP A;  1EQD A;  2LBA A;  1MX7 A;  4O4S A;  1HMR A;  1YUP A;  2WQ9 A;  3P6H A;  4WBK A;  3DSZ A;  3CQR A;  3Q6L A;  1NP4 A;  4ZGF A;  2KTS A;  1BBP A;  3WOV A;  5BYP A;  4N7D A;  2K23 A;  1SY3 A;  1X8Q A;  1QY2 A;  1A57 A;  1QY0 A;  5FQ7 E;  1G7N A;  4WFV A;  3HWD A;  1GT1 A;  4GRJ A;  3CMP A;  4FBR A;  1A18 A;  5H9N A;  4GK9 A;  2HMB A;  1TOU A;  2G7B A;  5H9A A;  4YBU A;  3VG3 A;  4YCE A;  3WXQ A;  5EEE A;  3FEN A;  1L6M A;  1UZ2 X;  5D47 A;  4ORR A;  4QYN A;  1JV4 A;  2A0A A;  3NAD A;  1OEE A;  1H91 A;  4HPD A;  2L68 A;  2ZAI A;  4YGZ A;  2WEW A;  5CYB A;  1LIB A;  3TF6 A;  3VG5 A;  3RKG A;  4OMX A;  4I9S A;  3UAQ A;  5HZQ A;  4Y0R A;  1S44 A;  1DC9 A;  1KT7 A;  4O3X B;  1ADL A;  2AT3 X;  4IAB A;  4Y0P A;  3ZUI A;  3HWF A;  1BLR A;  1EXS A;  1LIE A;  1X8O A;  2IFB A;  4A60 A;  3N91 A;  3VE1 A;  1U0X A;  3JSQ A;  4XMF A;  4KII A;  5B29 A;  4MVL A;  3VPJ E;  4ZHG A;  3WJG A;  1JYD A;  1Y9L A;  2Q4N A;  2QO4 A;  1B56 A;  1A3Y A;  1I04 A;  3BRN A;  1LFO A;  1SXU A;  1GX8 A;  1EAL A;  5LJH A;  4LZV A;  4KC7 A;  2XST A;  4XMC A;  1BRQ A;  3RSW A;  4QGV A;  4ALB A;  1CBI A;  1XKI A;  4QZT A;  3KFG A;  3ZW2 A;  4QGX A;  1N0S A;  2L67 A;  1EPA A;  1Y9T A;  2FWV A;  1ZND A;  1X71 A;  2F73 A;  3G7X A;  4EQA C;  2Q2M A;  1IW2 A;  3AKM A;  5LJG A;  3FR4 A;  1VPR A;  3PQU A;  2Q2P A;  4BVM A;  1EII A;  1ERX A;  3NX2 A;  1XCA A;  1ICN A;  1MX8 A;  2WUT A;  1BSY A;  4KH8 A;  4YH0 A;  3NPO A;  1IKE A;  4GET A;  1YWB A;  3NBX X;  1DFV A;  4QZU A;  5IO6 A;  5B27 A;  5IO7 A;  3EM0 A;  4NNS A;  1BM5 A;  1D3S A;  2Z4H A;  4A8Z A;  4KCA A;  1AEL A;  1FEN A;  2AT5 X;  5KIC A;  3B2I A;  1HQP A;  3RWX A;  1SXY A;  4L3R A;  1E5P A;  1EW3 A;  3FYF A;  4NYQ A;  3UEW A;  1KQX A;  1LNM A;  2R56 A;  3EYC A;  4EFG A;  1U17 A;  5DG4 A;  2WWP A;  1HMT A;  4ORX A;  5EDC A;  4ZCB A;  1JJJ A;  3T1D A;  5EZ2 A;  1DZJ A;  4ODD A;  3U0D A;  2MM3 A;  1BSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...