4GHAA

Crystal structure of marburg virus vp35 rna binding domain bound to 12-bp dsrna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
pubmed doi rcsb
source organism Marburg virus - musoke, kenya, 1980
molecule tags Viral protein,rna binding protein/rna
molecule keywords Polymerase cofactor VP35
total genus 39
structure length 122
sequence length 122
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ghaA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ghaA02
3FKEA 4IJEA 3L2AA 3L29A 4GH9A 3L28A 3L26A 4GHLA 4IBIA 4IBBA 4IBFA 4IBCA 3L27A 3L25A 4IBEA 3KS4A 4IJFA 4IBJA 4IBKA 3KS8A 4LG2A 4IBDA 4IBGA 4GHAA 5BPVA
chains in the Genus database with same CATH superfamily
8CATA 4B3RM 1L6JA 2KZSA 2MH8A 3WD1A 1IN5A 3DA1A 3DZDA 3HY5A 3SARA 4I8OA 2N35A 2KXEA 4R3DA 5F3WA 3KXEC 4GRIA 3LMMA 1EAKA 3KOYE 5IREB 4HMEA 1HJPA 2WZJA 3HU1A 2F5SA 2L7IA 3L27A 1ZMUA 1VEGA 3I01M 2CHGA 2KA6B 5KPZA 2RRUA 1ZAEA 3HU2A 1E9SA 2BNKA 2FE8A 3KS4A 5KPTA 1Z6TA 2L09A 2K0BX 4QOSA 3SHFA 1D0LA 3W0FA 2V5OA 4AKGA 3K9OA 2ZANA 4FWHA 4GITA 3KOWE 1QAMA 1I4WA 4P16A 2MR9A 3RE8A 4LF6M 1J5EM 4G6ZA 1PRBA 4X62M 4LFCM 1OGGA 2DZOB 4Z2JA 3CF6E 3HJ8A 2JY8A 3IG8A 4FW9A 4HEOA 1G8PA 4AKHA 1R2ZA 1GABA 4IJEA 3J2PB 1W1PA 1DV0A 1QQWA 1DGGA 4R71A 1G59A 3FTFA 1E32A 4DBGB 1YSYA 1L2CA 2XFSA 3FUXA 1XNQM 3L25A 3HHZA 3M7GA 1TDZA 2O5RA 1ZQ9A 1GL7A 4L16A 1IQPA 3GLIE 3WHKA 2JA2A 4EIWA 1GJSA 4JXJA 2ZBKB 1X37A 4JYAM 1NV8A 2EO2A 4PDGA 2EA0A 2LXEA 2Y2LA 1GO5A 4DV0M 3GLFE 2JY5A 2BWBA 1JR3A 5BPVA 2WSCF 3KFUG 5C1BA 2H1RA 1OKSA 3FYCA 3GRUA 1IBMM 3WX7A 3ILKA 3K9PA 1XHBA 1YE9A 4OU7A 2VDBB 4LZZA 1MU5A 3VKGA 2ZTCA 3J81S 2O01F 2OPFA 2R6FA 4G4RA 2UXCM 3LW5F 3HHXA 1UM8A 1IM2A 4CISA 2VF7A 1HNWM 3PFIA 1QO6A 1IN4A 1E6ZA 1XWIA 4D80A 4B3TM 3KS8A 3R9XB 2XEPA 1UFZA 2OO9A 2K9DA 1NVMA 1W1TA 4IBGA 1YU0A 2MGWA 4NYUA 3D8BA 2H5XA 4L6V6 2DNAA 4MGKE 3VK8A 5IT9S 5DFLA 1QANA 3PNVA 5EXTA 3F92A 4MM3B 3GRRA 3GLGA 2M60A 1VDLA 1IBKM 4B7GA 1E6PA 2JWSA 2JXNA 3QWLA 4AQYM 3GPYA 4D82A 1AIWA 2CE7A 2LVPC 2Y2GA 5GKNA 3E4RA 2JCHA 2LHCA 3A42A 4NRWA 3U61B 4LJ9A 2L4EA 2R4JA 3KP0E 1T43A 3I04M 1E94E 2DZLA 3SC3A 4AI6A 3W0LB 2QHOB 4JI2M 2Y2JA 4TX8A 3GRVA 1OFIA 3C58A 4I5SA 4IBJA 3LQQA 4LFAM 3W67A 4NZ5A 1E88A 2UUBM 4LJ6A 2J7OA 2Q2EB 2R45A 1QUTA 1NO1A 4A3VB 2Y2IA 1NV9A 1GLNA 2RGHA 4AZFA 3BOSA 1G3IA 3LCVB 4DV7M 3RGPA 2YNMD 4OJOA 1ED7A 1JR3E 2QSFX 2DENA 2F5NA 1IY0A 5FTMA 4DV1M 4JI4M 2DWLA 3LVVA 4BBAA 1QDTA 4I81A 3K2LA 4MB5A 1D0KA 3GQ4A 1NY6A 3IECA 3SAUA 3THGA 2Y2MA 4F2LA 4NC6A 4Z8XA 3U6PA 4IBFA 4AG6A 1NSFA 1A5TA 1F4IA 2R65A 4IBEA 1AIPC 1GOIA 1NJGA 1GXDA 1KSFX 2XFTA 3SAVA 2APLA 1IBLM 3HSHA 1DGFA 2BJWA 1V92A 1DO0A 2FNAA 3AFHA 3UK6A 3U6LA 2KNVA 2DAMA 1Z59A 2OOBA 4LJ5A 2HWJA 4M9ZA 2Y2HA 4G3OA 2YQZA 4KO8A 1QZEA 2FOIC 3FD9A 5ITQA 3CF0A 2ZAOA 4DV5M 4OX9M 2Y2QA 4G4OA 1VQ1A 2G5GX 1N78A 1YU2A 2Y2NA 1T6OA 4LGMA 3KSXA 4M0DA 4YHHM 3CF2A 1EIJA 3PNYA 3T38A 1PJJA 2BJVA 4XBOA 1IFYA 4LRSA 1YUBA 4S12A 5EXPA 3TL4X 4XGIA 3MHVC 3HKPA 1UR8A 1MX0A 3V76A 1CXWA 4FCWA 3T1YM 4CJ6A 3U5ZA 2A5YB 1SXJD 3TWKA 3SBJA 4DR4M 2V1UA 2O25A 5ITYA 1L1TA 4JV5M 3GLGB 1C7YA 1VG5A 4ANRA 4NSOB 4LRTA 2R4EA 1NJFA 5FTKA 1G71A 4PCZA 4IIWA 2UU9M 3VK7A 1MJGM 2C9CA 3EIHA 1J7KA 2K6BA 3FUVA 2KNZA 4D81A 2QBYB 4GKJM 4JI3M 3HONA 4Z2HA 2WSEF 2F5PA 3ZCBB 2CV1A 2KHHA 2XF3A 3Q8XA 2XSZA 3U61A 1N34M 2DXIA 1W1YA 2UWXA 3VDUA 2FFFB 4GH9A 4QHSA 2DAGA 5KQ8A 2CV0A 2Z8YM 2EKKA 1XNRM 4RKUF 2V1CA 2XH9A 3HGIA 2LBCA 2YFQA 1IN6A 5EXXA 4CGYB 3GLIB 4GHLA 3MJ5A 3SHGB 2RGOA 3WD3A 7CATA 2LVQD 4P17A 1N36M 3C9PA 2I7NA 2HHHM 5FSWA 5ITTA 2JY7A 4MGZE 4BLCA 1D0MA 2HL7A 3A98B 1HR0M 2C98A 4Z2IA 3LVWA 4TUWA 4B3MM 1FJGM 4B3SM 1WGNA 3C3EA 2ZAMA 4JN6A 3UZUA 3FKEA 1XXHE 3VDPA 2HAKA 3AJIB 3C3DA 2FFJA 4B7FA 1DO2A 4PDIA 2ZTDA 4KLNA 2D49A 3GO8A 1PJTA 4F1IA 1NHGC 3SYKA 2YR0A 2IOUA 4L8RC 1R4GA 1SXJC 4L4UA 5EP4A 1TDHA 2BWEA 4Z6YA 3U6QA 1S3SA 2E5LM 1WHCA 3FTEA 4LJAA 1E8BA 4OJLA 2C5RA 4MB3A 1KYIA 3VLFB 3DOAA 3B89A 2LHGA 4JI5M 1I94M 4G4QA 4L78A 1L1ZA 1HT1E 3WHLA 4FD2A 3GPXA 1HNXM 2KNAA 5EJCA 4UN2B 2DAEA 5A2QS 3U6DA 2XD1A 2CRUA 3J27B 2QP9X 2DAIA 2R18A 2XZUA 2CEAA 2HCBA 3U5ZB 3I51A 1PM5A 1NNUC 1YUEA 4KODA 2JUJA 3SYLA 4LF7M 1SG9A 4DR3M 4QHTA 4IBBA 1E6RA 3H4MA 3J80S 3GP1A 2CHVA 1W1VA 5L8RF 1IY1A 5FTNA 3TWMA 3SMSA 4MGIE 2JZ0A 1SXJA 1ZMWA 2ERCA 5EP1A 3GLIA 1E15A 2EJSA 4M0WA 1L2DA 4DR5M 2Y2OA 3FUTA 3DFZA 3KP1E 3FUWA 3M6AA 1H0IA 1O6IA 1Q3BA 2I7PA 1T3TA 1E6NA 4HMDA 3B74A 4GEWA 3T1HM 3HX3A 1WJ7A 1XC8A 1K82A 1QZMA 4NY2A 1DGBA 2LH0A 4LY6A 1OIPA 3Q8GA 3U6OA 2Y21A 4GMQA 4R7GA 1N77A 1YU3A 3KOZE 2RTSA 2XSZD 4OUIA 2C96A 2W82A 1OFHA 1TF0B 3AOEA 2C99A 4GIPA 1GL6A 3B9PA 1NNJA 4B08A 4LF9M 4JI7M 4G4NA 4GKKM 5EQTA 5LMNM 4FWDA 2GQFA 1L2BA 4LF8M 3JAMS 1IXSA 4IBCA 4LJ7A 4X65M 4DR2M 3SASA 3GLHB 4NL4H 4XK8F 2XLJA 2Y2PA 3WD2A 1UR9A 3SFZA 5FLXS 1WXQA 4BB9A 3QAUA 3HZJA 2CV2A 4Y28F 1HQCA 1R5LA 1NHWC 1Z5AA 2V6ZM 5IZ7D 4NZ1A 1SXJB 4LGYA 4DV2M 3N3FA 4LG2A 3GPPA 1CUKA 3BXWA 3ZC7B 2DWMA 1XB2B 1WIVA 3WD0A 3KDSE 5LMUM 1N33M 1NY5A 1V34A 3I4VA 3K1JA 1PJIA 3JR5A 3K8ZA 4MB4A 3KSJA 2F5OA 2KEBA 1P3QQ 3LQRA 4RF0A 5E26A 3NWLA 2MJ5B 3HHYA 5H37D 1YLAA 1IN8A 4QNLA 2QPAA 2Z3XA 1RU3A 1PGYA 4HLQA 2J7NA 2F5QA 2B3TA 3AOEC 5DNYA 1N32M 4LFBM 1ORYB 3MMPA 5E6JA 3UMMA 1IY2A 1K3XA 4I4LA 4NZ3A 4NXMM 3AKZA 1HT2E 4IBKA 2XZFA 3FUUA 4DR6M 3AL0C 4DR1M 3EIEA 4ITQA 1L8QA 2WSFF 3CGWA 4NSRA 2DKLA 3SATA 1JQJC 2DAKA 1N75A 3BBZA 2X4AA 4NOOB 5ITXA 5KO3A 1H8PA 1BVSA 3B7ZA 2NQ8C 4GC9A 1QVRA 1Q39A 1OIZA 2AHMA 1QAOA 1VEKA 2L7HA 3FE3A 3FRHA 4RNAA 4GC5A 1LTMA 1OTRA 3KW6A 3U60B 1GKIA 4DUYM 2M5ZA 2D7EA 3HHWA 3HJSA 4PT5A 3UJNA 1WGLA 5BR8M 4MGHA 3I4YA 1OJLA 5EXSA 1IXZA 2R0IA 2JNHA 3TQSA 3OTOM 3RFWA 2DHRA 2LTUA 1DGHA 1EE8A 5DYGA 4QOZC 4DV3M 2KRUA 3KVWA 4B7HA 4W5WA 3M0EA 3QYBA 4CHTB 1XXHB 3U6CA 1QUSA 1GJTA 1TTEA 2Z7JA 1YU1A 1G4AE 3D8LA 3K92A 2G8LA 3R8FA 3FTCA 2MROB 2XD5A 1Z5BA 4ZPXA 1H6UA 2DZNB 4KT0F 1QDRA 1VEJA 3HWSA 3FRIA 1QAQA 2DWNA 2UUCM 4DUZM 1OAOC 2CWBA 3E9SA 4LCBA 3GLHA 3GPUA 1ZV1A 2P5TA 3AV0A 2DWZB 2KRKA 5ITUA 4FWGA 3T15A 4JI6M 1VDDA 1PJQA 4IBIA 3SMPA 1OAIA 3PVSA 2R44A 2X8AA 4AW4A 1K3WA 2L4FA 2QCUA 1YU4A 1HNZM 1Y8GA 2X49A 2DHYA 3JR4A 2LVAA 1AUAA 4IBDA 4M9XA 3A45A 3GQ5A 4KHPM 1OGBA 3FYDA 1MN3A 2LVNC 2Z4RA 3HU3A 4MH0E 5KQDA 2FN2A 3NBXX 4LZJA 3U6MA 3VFDA 1Z5CA 5ITXE 4OVZB 3GLGE 1FNNA 1XXHA 5DYIA 1XMQM 5FTJA 4K0KM 3L2AA 4DV6M 2HKJA 1JB0F 1IN7A 2BG1A 4QNMA 4LF5M 3J7AS 2G3QA 5EP2A 2DI0A 2UUAM 2K47A 3MK6A 3GLFA 3WD4A 3GQ3A 4OJ5A 3U60A 3PXGA 2ZM6M 2LWXA 2FH0A 2EUCA 1C1KA 1QYRA 3TE6A 3A46A 4PD2A 2XGNA 2KDLA 5JI2E 1G41A 2R62A 1D2NA 3M7PA 2UXDM 2CUZA 2CHQA 2KZUA 1DGHB 1GPFA 2QENA 4L15A 2D7GA 4WURA 4LF4M 4YY3M 2Y0QA 4CIZA 3FTDA 1W5TA 2L6OA 4JI0M 2R46A 4QNRA 3IHPA 5JI3E 5C18A 4X64M 3L29A 2C9OA 3LCUA 3GLHE 4AG5A 1PJSA 4WP2A 1LV7A 3E21A 1ZMVA 4LJ4A 5IWAM 2LNHC 4NRVA 3L28A 2JZ1A 3L26A 2VIIA 2Y2KA 1CK7A 4HMCA 2F4VM 3IG5A 2CFOA 3SAWA 1E9RA 1Q3CA 2FS1A 4X66M 4II7A 4AKIA 1SXJE 1KS0A 2QNJA 4LJ8A 2UXBM 2QQ8A 4NZ4A 4HL4A 4Q7JA 4REZA 4IJFA 2Y0TA 4MGYE 1H0GA 2VF8A 3GLFB 1XMOM 1J09A 1EFUB 3GRYA 2J5YA 3NBIA 1TR8A 3ZQJA 4DV4M 1JR3D 2VQEM 4NYYA 2Z4SA 4OW0A 3W68A 2GNOA 4DR7M 1V33A 2EKFA 3B7NA 5KPRA 2JY6B 4MB7A 1OQYA 4Z2GA 3H4JA 3AOGA 2JP7A 2Y20A 3QYEA 1IXRC 3RGSA 4JI1M 3J7BA 1TH4A 4FCVA 3U6SA 4Z2KA 1KFVA 2L2DA 2QZ4A 4OVZA 2OQ4A 2OOAA 1TH3A 2D7HA 4WW0A 1R7RA 3MQLA 3HJQA 1TGUA 4FCTA 3ZH9B 1R2YA 3B7QA 3VKHA 3E46A 1HQYE 1PDCA 3TPZA 1W5SA 3KOXE 4M9SA 2JE5A 2VQFM 4OJPA 2CP8A 4JI8M 3U6EA 3TWLA 4FVMA 4Z2LA 4OJ6A 1WR1B 5EP3A 3T6PA 1IXSB 3CTWB 2QBYA 1J7MA 5FTLA 1GVNA 2DVWB 1R6BX 1Q02A 2RKOA 4NXNM 1TH2A 3UGJA 5ITRA 4GHAA 2LVOC 4RF1A 2KW0A
chains in the Genus database with same CATH topology
8CATA 4B3RM 2KZSA 1IN5A 3DA1A 3DZDA 3SARA 4I8OA 5F3WA 2KXEA 4R3DA 3KXEC 4GRIA 3LMMA 3KOYE 5IREB 3HU1A 2F5SA 2L7IA 3L27A 2CHGA 2KA6B 5KPZA 1ZAEA 3HU2A 1E9SA 2BNKA 2FE8A 3KS4A 5KPTA 1Z6TA 2L09A 4QOSA 3SHFA 3W0FA 4AKGA 2ZANA 4FWHA 4GITA 3KOWE 1QAMA 1I4WA 4P16A 3RE8A 4LF6M 1J5EM 4G6ZA 4X62M 4LFCM 2DZOB 3CF6E 3HJ8A 3IG8A 4FW9A 1G8PA 4AKHA 1R2ZA 4IJEA 3J2PB 1QQWA 1DGGA 1G59A 3FTFA 1E32A 1YSYA 1L2CA 2XFSA 3FUXA 1XNQM 3L25A 3HHZA 3M7GA 1TDZA 2O5RA 1ZQ9A 1GL7A 4L16A 1IQPA 3WHKA 2JA2A 4EIWA 4JXJA 2ZBKB 1X37A 4JYAM 2EO2A 4PDGA 2EA0A 2LXEA 2Y2LA 4DV0M 1JR3A 5BPVA 3KFUG 5C1BA 2H1RA 3GRUA 3FYCA 1IBMM 3WX7A 3ILKA 1XHBA 1YE9A 4OU7A 4LZZA 3VKGA 1MU5A 3J81S 2OPFA 4G4RA 2UXCM 3HHXA 1UM8A 1IM2A 4CISA 1HNWM 3PFIA 1IN4A 1XWIA 4D80A 4B3TM 3KS8A 3R9XB 2XEPA 1NVMA 4IBGA 1YU0A 4NYUA 3D8BA 4MGKE 3VK8A 5IT9S 1QANA 3PNVA 5EXTA 4MM3B 3GLGA 3GRRA 2M60A 1IBKM 4B7GA 4AQYM 3QWLA 3GPYA 4D82A 2CE7A 5GKNA 3E4RA 2JCHA 3A42A 4NRWA 3U61B 4LJ9A 2R4JA 3SC3A 3KP0E 4AI6A 2Y2JA 1E94E 3W0LB 4JI2M 3GRVA 1OFIA 3C58A 4I5SA 4IBJA 3LQQA 4LFAM 4NZ5A 2UUBM 4LJ6A 2J7OA 2Q2EB 2R45A 4A3VB 2Y2IA 1GLNA 2RGHA 4AZFA 3BOSA 1G3IA 4DV7M 3RGPA 2YNMD 4OJOA 2F5NA 1IY0A 5FTMA 4DV1M 4JI4M 2DWLA 3LVVA 4BBAA 4I81A 3K2LA 3GQ4A 1NY6A 3SAUA 3THGA 2Y2MA 3U6PA 4Z8XA 4IBFA 4AG6A 1NSFA 2R65A 4IBEA 1NJGA 1KSFX 2XFTA 3SAVA 1IBLM 4OJLA 3HSHA 1DGFA 2BJWA 2FNAA 1DO0A 3AFHA 3UK6A 3U6LA 1Z59A 4LJ5A 4M9ZA 2Y2HA 2YQZA 4KO8A 5ITQA 2FOIC 3FD9A 4DV5M 3CF0A 2ZAOA 4OX9M 2Y2QA 3N3FA 4G4OA 2G5GX 1N78A 1YU2A 4LGMA 3KSXA 4M0DA 4YHHM 3CF2A 3PNYA 3T38A 1PJJA 2BJVA 4XBOA 4LRSA 1YUBA 4S12A 5EXPA 3TL4X 4XGIA 3MHVC 3HKPA 1MX0A 4FCWA 3T1YM 3U5ZA 2A5YB 1SXJD 3TWKA 3SBJA 4DR4M 2V1UA 5ITYA 1L1TA 4JV5M 3GLGB 4PCZA 4NSOB 4LRTA 1NJFA 2R4EA 5FTKA 4IIWA 2UU9M 3VK7A 2C9CA 3EIHA 1J7KA 3FUVA 4D81A 2QBYB 4GKJM 4JI3M 3HONA 2F5PA 3ZCBB 2CV1A 2XF3A 3Q8XA 3U61A 2XSZA 1N34M 2DXIA 2UWXA 3VDUA 2FFFB 4GH9A 4QHSA 5KQ8A 2CV0A 1XNRM 2V1CA 2XH9A 3HGIA 2YFQA 5EXXA 1IN6A 3GLIB 4CGYB 4GHLA 3MJ5A 3SHGB 2RGOA 7CATA 1N36M 2I7NA 2HHHM 5FSWA 5ITTA 4MGZE 4BLCA 2HL7A 3A98B 1HR0M 2C98A 3LVWA 4TUWA 4B3MM 1FJGM 4B3SM 2ZAMA 4JN6A 3UZUA 3FKEA 3VDPA 3AJIB 2FFJA 4B7FA 1DO2A 4PDIA 4KLNA 3GO8A 2IOUA 1NHGC 3SYKA 2YR0A 4L8RC 1SXJC 4L4UA 5EP4A 4Z6YA 1TDHA 3U6QA 2E5LM 1S3SA 3FTEA 4LJAA 2C5RA 1KYIA 3VLFB 3DOAA 4JI5M 1I94M 4G4QA 4L78A 1L1ZA 1HT1E 3WHLA 4FD2A 3GPXA 1HNXM 5EJCA 5A2QS 3U6DA 2XD1A 3J27B 2QP9X 2R18A 2XZUA 2CEAA 2HCBA 3U5ZB 3I51A 1PM5A 1NNUC 1YUEA 4KODA 3SYLA 4LF7M 4DR3M 4QHTA 4IBBA 3H4MA 3J80S 3GP1A 2CHVA 1IY1A 5FTNA 3TWMA 3SMSA 4MGIE 1SXJA 2ERCA 5EP1A 3GLIA 4M0WA 1L2DA 4DR5M 2Y2OA 3FUTA 3KP1E 3DFZA 3FUWA 3M6AA 1Q3BA 2I7PA 1T3TA 3T1HM 1XC8A 1K82A 1QZMA 4NY2A 1DGBA 2LH0A 4LY6A 3U6OA 2Y21A 4GMQA 4R7GA 1N77A 1YU3A 3KOZE 2XSZD 4OUIA 2C96A 2W82A 1OFHA 3AOEA 1NNJA 2C99A 4GIPA 1GL6A 3B9PA 4LF9M 4B08A 4GKKM 4JI7M 4G4NA 5EQTA 5LMNM 4FWDA 1L2BA 4LF8M 3JAMS 4IBCA 4LJ7A 4X65M 3SASA 4DR2M 3GLHB 4NL4H 2XLJA 2Y2PA 3SFZA 5FLXS 1WXQA 4BB9A 3QAUA 2CV2A 1HQCA 2V6ZM 1NHWC 1Z5AA 5IZ7D 4NZ1A 1SXJB 4LGYA 4DV2M 4LG2A 3GPPA 3ZC7B 2DWMA 3KDSE 5LMUM 1N33M 1NY5A 3I4VA 1PJIA 3K1JA 3JR5A 3K8ZA 3KSJA 2F5OA 2KEBA 3LQRA 4RF0A 5E26A 3HHYA 3NWLA 5H37D 4QNLA 1IN8A 2QPAA 2Z3XA 4HLQA 2J7NA 2F5QA 5DNYA 3AOEC 1N32M 4LFBM 1ORYB 5E6JA 3UMMA 1IY2A 1K3XA 4I4LA 4NZ3A 4NXMM 3AKZA 1HT2E 4IBKA 2XZFA 3FUUA 4DR6M 3AL0C 4DR1M 3EIEA 4ITQA 1L8QA 4NSRA 3SATA 1JQJC 1N75A 4NOOB 2X4AA 5ITXA 5KO3A 2NQ8C 4GC9A 1QVRA 1Q39A 2AHMA 1QAOA 2L7HA 4RNAA 3U60B 4GC5A 3KW6A 1GKIA 4DUYM 3HJSA 2D7EA 2M5ZA 3HHWA 4PT5A 3UJNA 5BR8M 4MGHA 3I4YA 1OJLA 5EXSA 1IXZA 3TQSA 3OTOM 3RFWA 2DHRA 1DGHA 1EE8A 5DYGA 4QOZC 4DV3M 2KRUA 3KVWA 4B7HA 4W5WA 3M0EA 4CHTB 3U6CA 1XXHB 1YU1A 2Z7JA 3D8LA 3K92A 1G4AE 2G8LA 3R8FA 3FTCA 2XD5A 1Z5BA 4ZPXA 1H6UA 2DZNB 2UUCM 3HWSA 2Y2NA 2DWNA 1QAQA 4DUZM 3E9SA 4LCBA 3GLHA 3GPUA 2P5TA 3AV0A 2DWZB 2KRKA 5ITUA 4FWGA 3T15A 4JI6M 1VDDA 4IBIA 3SMPA 3PVSA 2X8AA 4AW4A 1K3WA 2QCUA 1YU4A 1HNZM 2X49A 3JR4A 4IBDA 4M9XA 3A45A 3GQ5A 4KHPM 3FYDA 3HU3A 2Z4RA 5KQDA 4LZJA 3U6MA 3VFDA 1Z5CA 5ITXE 4OVZB 1FNNA 1XXHA 5DYIA 1XMQM 5FTJA 4K0KM 3L2AA 4DV6M 2HKJA 1IN7A 2BG1A 4QNMA 4LF5M 3J7AS 5EP2A 2UUAM 2K47A 3MK6A 3GLFA 3GQ3A 4OJ5A 3U60A 3PXGA 2ZM6M 2LWXA 2EUCA 1C1KA 1QYRA 3TE6A 3A46A 4PD2A 2XGNA 5JI2E 1G41A 2R62A 1D2NA 2UXDM 2CUZA 2CHQA 2KZUA 1DGHB 2QENA 4L15A 2D7GA 4WURA 4LF4M 4YY3M 2Y0QA 3FTDA 1W5TA 2L6OA 4JI0M 2R46A 4QNRA 5JI3E 5C18A 4X64M 3L29A 2C9OA 4AG5A 2Y2GA 1LV7A 4LJ4A 5IWAM 2LNHC 4NRVA 3L28A 3L26A 2VIIA 2Y2KA 2F4VM 3IG5A 2CFOA 3SAWA 1E9RA 1Q3CA 4X66M 4II7A 4AKIA 1SXJE 4LJ8A 2UXBM 4NZ4A 4HL4A 4REZA 4IJFA 2Y0TA 4MGYE 3GLFB 1XMOM 1J09A 3GRYA 3NBIA 4DV4M 1JR3D 2VQEM 4NYYA 2Z4SA 4OW0A 4DR7M 5KPRA 4MB7A 3AOGA 2Y20A 1IXRC 3RGSA 4JI1M 3J7BA 1TH4A 4FCVA 3U6SA 1KFVA 2QZ4A 4OVZA 2OQ4A 4WW0A 1TH3A 2D7HA 1R7RA 3HJQA 1TGUA 4FCTA 3ZH9B 1R2YA 3VKHA 1HQYE 2JE5A 3TPZA 1W5SA 3KOXE 4M9SA 4OJPA 2VQFM 4JI8M 3U6EA 3TWLA 4FVMA 4OJ6A 5EP3A 2QBYA 1IXSB 3CTWB 5FTLA 1GVNA 2DVWB 1R6BX 2RKOA 4NXNM 1TH2A 3UGJA 5ITRA 4GHAA 4MH0E 4RF1A 2KW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKE A;  4IJE A;  3L2A A;  3L29 A;  4GH9 A;  3L28 A;  3L26 A;  4GHL A;  4IBI A;  4IBB A;  4IBF A;  4IBC A;  3L27 A;  3L25 A;  4IBE A;  3KS4 A;  4IJF A;  4IBJ A;  4IBK A;  3KS8 A;  4LG2 A;  4IBD A;  4IBG A;  4GHA A;  5BPV A; 
#chains in the Genus database with same CATH topology
 8CAT A;  4B3R M;  1L6J A;  2KZS A;  2MH8 A;  3WD1 A;  1IN5 A;  3DA1 A;  3DZD A;  3HY5 A;  3SAR A;  4I8O A;  2N35 A;  2KXE A;  4R3D A;  5F3W A;  3KXE C;  4GRI A;  3LMM A;  1EAK A;  3KOY E;  5IRE B;  4HME A;  1HJP A;  2WZJ A;  3HU1 A;  2F5S A;  2L7I A;  3L27 A;  1ZMU A;  1VEG A;  3I01 M;  2CHG A;  2KA6 B;  5KPZ A;  2RRU A;  1ZAE A;  3HU2 A;  1E9S A;  2BNK A;  2FE8 A;  3KS4 A;  5KPT A;  1Z6T A;  2L09 A;  2K0B X;  4QOS A;  3SHF A;  1D0L A;  3W0F A;  2V5O A;  4AKG A;  3K9O A;  2ZAN A;  4FWH A;  4GIT A;  3KOW E;  1QAM A;  1I4W A;  4P16 A;  2MR9 A;  3RE8 A;  4LF6 M;  1J5E M;  4G6Z A;  1PRB A;  4X62 M;  4LFC M;  1OGG A;  2DZO B;  4Z2J A;  3CF6 E;  3HJ8 A;  2JY8 A;  3IG8 A;  4FW9 A;  4HEO A;  1G8P A;  4AKH A;  1R2Z A;  1GAB A;  4IJE A;  3J2P B;  1W1P A;  1DV0 A;  1QQW A;  1DGG A;  4R71 A;  1G59 A;  3FTF A;  1E32 A;  4DBG B;  1YSY A;  1L2C A;  2XFS A;  3FUX A;  1XNQ M;  3L25 A;  3HHZ A;  3M7G A;  1TDZ A;  2O5R A;  1ZQ9 A;  1GL7 A;  4L16 A;  1IQP A;  3GLI E;  3WHK A;  2JA2 A;  4EIW A;  1GJS A;  4JXJ A;  2ZBK B;  1X37 A;  4JYA M;  1NV8 A;  2EO2 A;  4PDG A;  2EA0 A;  2LXE A;  2Y2L A;  1GO5 A;  4DV0 M;  3GLF E;  2JY5 A;  2BWB A;  1JR3 A;  5BPV A;  2WSC F;  3KFU G;  5C1B A;  2H1R A;  1OKS A;  3FYC A;  3GRU A;  1IBM M;  3WX7 A;  3ILK A;  3K9P A;  1XHB A;  1YE9 A;  4OU7 A;  2VDB B;  4LZZ A;  1MU5 A;  3VKG A;  2ZTC A;  3J81 S;  2O01 F;  2OPF A;  2R6F A;  4G4R A;  2UXC M;  3LW5 F;  3HHX A;  1UM8 A;  1IM2 A;  4CIS A;  2VF7 A;  1HNW M;  3PFI A;  1QO6 A;  1IN4 A;  1E6Z A;  1XWI A;  4D80 A;  4B3T M;  3KS8 A;  3R9X B;  2XEP A;  1UFZ A;  2OO9 A;  2K9D A;  1NVM A;  1W1T A;  4IBG A;  1YU0 A;  2MGW A;  4NYU A;  3D8B A;  2H5X A;  4L6V 6;  2DNA A;  4MGK E;  3VK8 A;  5IT9 S;  5DFL A;  1QAN A;  3PNV A;  5EXT A;  3F92 A;  4MM3 B;  3GRR A;  3GLG A;  2M60 A;  1VDL A;  1IBK M;  4B7G A;  1E6P A;  2JWS A;  2JXN A;  3QWL A;  4AQY M;  3GPY A;  4D82 A;  1AIW A;  2CE7 A;  2LVP C;  2Y2G A;  5GKN A;  3E4R A;  2JCH A;  2LHC A;  3A42 A;  4NRW A;  3U61 B;  4LJ9 A;  2L4E A;  2R4J A;  3KP0 E;  1T43 A;  3I04 M;  1E94 E;  2DZL A;  3SC3 A;  4AI6 A;  3W0L B;  2QHO B;  4JI2 M;  2Y2J A;  4TX8 A;  3GRV A;  1OFI A;  3C58 A;  4I5S A;  4IBJ A;  3LQQ A;  4LFA M;  3W67 A;  4NZ5 A;  1E88 A;  2UUB M;  4LJ6 A;  2J7O A;  2Q2E B;  2R45 A;  1QUT A;  1NO1 A;  4A3V B;  2Y2I A;  1NV9 A;  1GLN A;  2RGH A;  4AZF A;  3BOS A;  1G3I A;  3LCV B;  4DV7 M;  3RGP A;  2YNM D;  4OJO A;  1ED7 A;  1JR3 E;  2QSF X;  2DEN A;  2F5N A;  1IY0 A;  5FTM A;  4DV1 M;  4JI4 M;  2DWL A;  3LVV A;  4BBA A;  1QDT A;  4I81 A;  3K2L A;  4MB5 A;  1D0K A;  3GQ4 A;  1NY6 A;  3IEC A;  3SAU A;  3THG A;  2Y2M A;  4F2L A;  4NC6 A;  4Z8X A;  3U6P A;  4IBF A;  4AG6 A;  1NSF A;  1A5T A;  1F4I A;  2R65 A;  4IBE A;  1AIP C;  1GOI A;  1NJG A;  1GXD A;  1KSF X;  2XFT A;  3SAV A;  2APL A;  1IBL M;  3HSH A;  1DGF A;  2BJW A;  1V92 A;  1DO0 A;  2FNA A;  3AFH A;  3UK6 A;  3U6L A;  2KNV A;  2DAM A;  1Z59 A;  2OOB A;  4LJ5 A;  2HWJ A;  4M9Z A;  2Y2H A;  4G3O A;  2YQZ A;  4KO8 A;  1QZE A;  2FOI C;  3FD9 A;  5ITQ A;  3CF0 A;  2ZAO A;  4DV5 M;  4OX9 M;  2Y2Q A;  4G4O A;  1VQ1 A;  2G5G X;  1N78 A;  1YU2 A;  2Y2N A;  1T6O A;  4LGM A;  3KSX A;  4M0D A;  4YHH M;  3CF2 A;  1EIJ A;  3PNY A;  3T38 A;  1PJJ A;  2BJV A;  4XBO A;  1IFY A;  4LRS A;  1YUB A;  4S12 A;  5EXP A;  3TL4 X;  4XGI A;  3MHV C;  3HKP A;  1UR8 A;  1MX0 A;  3V76 A;  1CXW A;  4FCW A;  3T1Y M;  4CJ6 A;  3U5Z A;  2A5Y B;  1SXJ D;  3TWK A;  3SBJ A;  4DR4 M;  2V1U A;  2O25 A;  5ITY A;  1L1T A;  4JV5 M;  3GLG B;  1C7Y A;  1VG5 A;  4ANR A;  4NSO B;  4LRT A;  2R4E A;  1NJF A;  5FTK A;  1G71 A;  4PCZ A;  4IIW A;  2UU9 M;  3VK7 A;  1MJG M;  2C9C A;  3EIH A;  1J7K A;  2K6B A;  3FUV A;  2KNZ A;  4D81 A;  2QBY B;  4GKJ M;  4JI3 M;  3HON A;  4Z2H A;  2WSE F;  2F5P A;  3ZCB B;  2CV1 A;  2KHH A;  2XF3 A;  3Q8X A;  2XSZ A;  3U61 A;  1N34 M;  2DXI A;  1W1Y A;  2UWX A;  3VDU A;  2FFF B;  4GH9 A;  4QHS A;  2DAG A;  5KQ8 A;  2CV0 A;  2Z8Y M;  2EKK A;  1XNR M;  4RKU F;  2V1C A;  2XH9 A;  3HGI A;  2LBC A;  2YFQ A;  1IN6 A;  5EXX A;  4CGY B;  3GLI B;  4GHL A;  3MJ5 A;  3SHG B;  2RGO A;  3WD3 A;  7CAT A;  2LVQ D;  4P17 A;  1N36 M;  3C9P A;  2I7N A;  2HHH M;  5FSW A;  5ITT A;  2JY7 A;  4MGZ E;  4BLC A;  1D0M A;  2HL7 A;  3A98 B;  1HR0 M;  2C98 A;  4Z2I A;  3LVW A;  4TUW A;  4B3M M;  1FJG M;  4B3S M;  1WGN A;  3C3E A;  2ZAM A;  4JN6 A;  3UZU A;  3FKE A;  1XXH E;  3VDP A;  2HAK A;  3AJI B;  3C3D A;  2FFJ A;  4B7F A;  1DO2 A;  4PDI A;  2ZTD A;  4KLN A;  2D49 A;  3GO8 A;  1PJT A;  4F1I A;  1NHG C;  3SYK A;  2YR0 A;  2IOU A;  4L8R C;  1R4G A;  1SXJ C;  4L4U A;  5EP4 A;  1TDH A;  2BWE A;  4Z6Y A;  3U6Q A;  1S3S A;  2E5L M;  1WHC A;  3FTE A;  4LJA A;  1E8B A;  4OJL A;  2C5R A;  4MB3 A;  1KYI A;  3VLF B;  3DOA A;  3B89 A;  2LHG A;  4JI5 M;  1I94 M;  4G4Q A;  4L78 A;  1L1Z A;  1HT1 E;  3WHL A;  4FD2 A;  3GPX A;  1HNX M;  2KNA A;  5EJC A;  4UN2 B;  2DAE A;  5A2Q S;  3U6D A;  2XD1 A;  2CRU A;  3J27 B;  2QP9 X;  2DAI A;  2R18 A;  2XZU A;  2CEA A;  2HCB A;  3U5Z B;  3I51 A;  1PM5 A;  1NNU C;  1YUE A;  4KOD A;  2JUJ A;  3SYL A;  4LF7 M;  1SG9 A;  4DR3 M;  4QHT A;  4IBB A;  1E6R A;  3H4M A;  3J80 S;  3GP1 A;  2CHV A;  1W1V A;  5L8R F;  1IY1 A;  5FTN A;  3TWM A;  3SMS A;  4MGI E;  2JZ0 A;  1SXJ A;  1ZMW A;  2ERC A;  5EP1 A;  3GLI A;  1E15 A;  2EJS A;  4M0W A;  1L2D A;  4DR5 M;  2Y2O A;  3FUT A;  3DFZ A;  3KP1 E;  3FUW A;  3M6A A;  1H0I A;  1O6I A;  1Q3B A;  2I7P A;  1T3T A;  1E6N A;  4HMD A;  3B74 A;  4GEW A;  3T1H M;  3HX3 A;  1WJ7 A;  1XC8 A;  1K82 A;  1QZM A;  4NY2 A;  1DGB A;  2LH0 A;  4LY6 A;  1OIP A;  3Q8G A;  3U6O A;  2Y21 A;  4GMQ A;  4R7G A;  1N77 A;  1YU3 A;  3KOZ E;  2RTS A;  2XSZ D;  4OUI A;  2C96 A;  2W82 A;  1OFH A;  1TF0 B;  3AOE A;  2C99 A;  4GIP A;  1GL6 A;  3B9P A;  1NNJ A;  4B08 A;  4LF9 M;  4JI7 M;  4G4N A;  4GKK M;  5EQT A;  5LMN M;  4FWD A;  2GQF A;  1L2B A;  4LF8 M;  3JAM S;  1IXS A;  4IBC A;  4LJ7 A;  4X65 M;  4DR2 M;  3SAS A;  3GLH B;  4NL4 H;  4XK8 F;  2XLJ A;  2Y2P A;  3WD2 A;  1UR9 A;  3SFZ A;  5FLX S;  1WXQ A;  4BB9 A;  3QAU A;  3HZJ A;  2CV2 A;  4Y28 F;  1HQC A;  1R5L A;  1NHW C;  1Z5A A;  2V6Z M;  5IZ7 D;  4NZ1 A;  1SXJ B;  4LGY A;  4DV2 M;  3N3F A;  4LG2 A;  3GPP A;  1CUK A;  3BXW A;  3ZC7 B;  2DWM A;  1XB2 B;  1WIV A;  3WD0 A;  3KDS E;  5LMU M;  1N33 M;  1NY5 A;  1V34 A;  3I4V A;  3K1J A;  1PJI A;  3JR5 A;  3K8Z A;  4MB4 A;  3KSJ A;  2F5O A;  2KEB A;  1P3Q Q;  3LQR A;  4RF0 A;  5E26 A;  3NWL A;  2MJ5 B;  3HHY A;  5H37 D;  1YLA A;  1IN8 A;  4QNL A;  2QPA A;  2Z3X A;  1RU3 A;  1PGY A;  4HLQ A;  2J7N A;  2F5Q A;  2B3T A;  3AOE C;  5DNY A;  1N32 M;  4LFB M;  1ORY B;  3MMP A;  5E6J A;  3UMM A;  1IY2 A;  1K3X A;  4I4L A;  4NZ3 A;  4NXM M;  3AKZ A;  1HT2 E;  4IBK A;  2XZF A;  3FUU A;  4DR6 M;  3AL0 C;  4DR1 M;  3EIE A;  4ITQ A;  1L8Q A;  2WSF F;  3CGW A;  4NSR A;  2DKL A;  3SAT A;  1JQJ C;  2DAK A;  1N75 A;  3BBZ A;  2X4A A;  4NOO B;  5ITX A;  5KO3 A;  1H8P A;  1BVS A;  3B7Z A;  2NQ8 C;  4GC9 A;  1QVR A;  1Q39 A;  1OIZ A;  2AHM A;  1QAO A;  1VEK A;  2L7H A;  3FE3 A;  3FRH A;  4RNA A;  4GC5 A;  1LTM A;  1OTR A;  3KW6 A;  3U60 B;  1GKI A;  4DUY M;  2M5Z A;  2D7E A;  3HHW A;  3HJS A;  4PT5 A;  3UJN A;  1WGL A;  5BR8 M;  4MGH A;  3I4Y A;  1OJL A;  5EXS A;  1IXZ A;  2R0I A;  2JNH A;  3TQS A;  3OTO M;  3RFW A;  2DHR A;  2LTU A;  1DGH A;  1EE8 A;  5DYG A;  4QOZ C;  4DV3 M;  2KRU A;  3KVW A;  4B7H A;  4W5W A;  3M0E A;  3QYB A;  4CHT B;  1XXH B;  3U6C A;  1QUS A;  1GJT A;  1TTE A;  2Z7J A;  1YU1 A;  1G4A E;  3D8L A;  3K92 A;  2G8L A;  3R8F A;  3FTC A;  2MRO B;  2XD5 A;  1Z5B A;  4ZPX A;  1H6U A;  2DZN B;  4KT0 F;  1QDR A;  1VEJ A;  3HWS A;  3FRI A;  1QAQ A;  2DWN A;  2UUC M;  4DUZ M;  1OAO C;  2CWB A;  3E9S A;  4LCB A;  3GLH A;  3GPU A;  1ZV1 A;  2P5T A;  3AV0 A;  2DWZ B;  2KRK A;  5ITU A;  4FWG A;  3T15 A;  4JI6 M;  1VDD A;  1PJQ A;  4IBI A;  3SMP A;  1OAI A;  3PVS A;  2R44 A;  2X8A A;  4AW4 A;  1K3W A;  2L4F A;  2QCU A;  1YU4 A;  1HNZ M;  1Y8G A;  2X49 A;  2DHY A;  3JR4 A;  2LVA A;  1AUA A;  4IBD A;  4M9X A;  3A45 A;  3GQ5 A;  4KHP M;  1OGB A;  3FYD A;  1MN3 A;  2LVN C;  2Z4R A;  3HU3 A;  4MH0 E;  5KQD A;  2FN2 A;  3NBX X;  4LZJ A;  3U6M A;  3VFD A;  1Z5C A;  5ITX E;  4OVZ B;  3GLG E;  1FNN A;  1XXH A;  5DYI A;  1XMQ M;  5FTJ A;  4K0K M;  3L2A A;  4DV6 M;  2HKJ A;  1JB0 F;  1IN7 A;  2BG1 A;  4QNM A;  4LF5 M;  3J7A S;  2G3Q A;  5EP2 A;  2DI0 A;  2UUA M;  2K47 A;  3MK6 A;  3GLF A;  3WD4 A;  3GQ3 A;  4OJ5 A;  3U60 A;  3PXG A;  2ZM6 M;  2LWX A;  2FH0 A;  2EUC A;  1C1K A;  1QYR A;  3TE6 A;  3A46 A;  4PD2 A;  2XGN A;  2KDL A;  5JI2 E;  1G41 A;  2R62 A;  1D2N A;  3M7P A;  2UXD M;  2CUZ A;  2CHQ A;  2KZU A;  1DGH B;  1GPF A;  2QEN A;  4L15 A;  2D7G A;  4WUR A;  4LF4 M;  4YY3 M;  2Y0Q A;  4CIZ A;  3FTD A;  1W5T A;  2L6O A;  4JI0 M;  2R46 A;  4QNR A;  3IHP A;  5JI3 E;  5C18 A;  4X64 M;  3L29 A;  2C9O A;  3LCU A;  3GLH E;  4AG5 A;  1PJS A;  4WP2 A;  1LV7 A;  3E21 A;  1ZMV A;  4LJ4 A;  5IWA M;  2LNH C;  4NRV A;  3L28 A;  2JZ1 A;  3L26 A;  2VII A;  2Y2K A;  1CK7 A;  4HMC A;  2F4V M;  3IG5 A;  2CFO A;  3SAW A;  1E9R A;  1Q3C A;  2FS1 A;  4X66 M;  4II7 A;  4AKI A;  1SXJ E;  1KS0 A;  2QNJ A;  4LJ8 A;  2UXB M;  2QQ8 A;  4NZ4 A;  4HL4 A;  4Q7J A;  4REZ A;  4IJF A;  2Y0T A;  4MGY E;  1H0G A;  2VF8 A;  3GLF B;  1XMO M;  1J09 A;  1EFU B;  3GRY A;  2J5Y A;  3NBI A;  1TR8 A;  3ZQJ A;  4DV4 M;  1JR3 D;  2VQE M;  4NYY A;  2Z4S A;  4OW0 A;  3W68 A;  2GNO A;  4DR7 M;  1V33 A;  2EKF A;  3B7N A;  5KPR A;  2JY6 B;  4MB7 A;  1OQY A;  4Z2G A;  3H4J A;  3AOG A;  2JP7 A;  2Y20 A;  3QYE A;  1IXR C;  3RGS A;  4JI1 M;  3J7B A;  1TH4 A;  4FCV A;  3U6S A;  4Z2K A;  1KFV A;  2L2D A;  2QZ4 A;  4OVZ A;  2OQ4 A;  2OOA A;  1TH3 A;  2D7H A;  4WW0 A;  1R7R A;  3MQL A;  3HJQ A;  1TGU A;  4FCT A;  3ZH9 B;  1R2Y A;  3B7Q A;  3VKH A;  3E46 A;  1HQY E;  1PDC A;  3TPZ A;  1W5S A;  3KOX E;  4M9S A;  2JE5 A;  2VQF M;  4OJP A;  2CP8 A;  4JI8 M;  3U6E A;  3TWL A;  4FVM A;  4Z2L A;  4OJ6 A;  1WR1 B;  5EP3 A;  3T6P A;  1IXS B;  3CTW B;  2QBY A;  1J7M A;  5FTL A;  1GVN A;  2DVW B;  1R6B X;  1Q02 A;  2RKO A;  4NXN M;  1TH2 A;  3UGJ A;  5ITR A;  4GHA A;  2LVO C;  4RF1 A;  2KW0 A; 
#chains in the Genus database with same CATH homology
 8CAT A;  4B3R M;  2KZS A;  1IN5 A;  3DA1 A;  3DZD A;  3SAR A;  4I8O A;  5F3W A;  2KXE A;  4R3D A;  3KXE C;  4GRI A;  3LMM A;  3KOY E;  5IRE B;  3HU1 A;  2F5S A;  2L7I A;  3L27 A;  2CHG A;  2KA6 B;  5KPZ A;  1ZAE A;  3HU2 A;  1E9S A;  2BNK A;  2FE8 A;  3KS4 A;  5KPT A;  1Z6T A;  2L09 A;  4QOS A;  3SHF A;  3W0F A;  4AKG A;  2ZAN A;  4FWH A;  4GIT A;  3KOW E;  1QAM A;  1I4W A;  4P16 A;  3RE8 A;  4LF6 M;  1J5E M;  4G6Z A;  4X62 M;  4LFC M;  2DZO B;  3CF6 E;  3HJ8 A;  3IG8 A;  4FW9 A;  1G8P A;  4AKH A;  1R2Z A;  4IJE A;  3J2P B;  1QQW A;  1DGG A;  1G59 A;  3FTF A;  1E32 A;  1YSY A;  1L2C A;  2XFS A;  3FUX A;  1XNQ M;  3L25 A;  3HHZ A;  3M7G A;  1TDZ A;  2O5R A;  1ZQ9 A;  1GL7 A;  4L16 A;  1IQP A;  3WHK A;  2JA2 A;  4EIW A;  4JXJ A;  2ZBK B;  1X37 A;  4JYA M;  2EO2 A;  4PDG A;  2EA0 A;  2LXE A;  2Y2L A;  4DV0 M;  1JR3 A;  5BPV A;  3KFU G;  5C1B A;  2H1R A;  3GRU A;  3FYC A;  1IBM M;  3WX7 A;  3ILK A;  1XHB A;  1YE9 A;  4OU7 A;  4LZZ A;  3VKG A;  1MU5 A;  3J81 S;  2OPF A;  4G4R A;  2UXC M;  3HHX A;  1UM8 A;  1IM2 A;  4CIS A;  1HNW M;  3PFI A;  1IN4 A;  1XWI A;  4D80 A;  4B3T M;  3KS8 A;  3R9X B;  2XEP A;  1NVM A;  4IBG A;  1YU0 A;  4NYU A;  3D8B A;  4MGK E;  3VK8 A;  5IT9 S;  1QAN A;  3PNV A;  5EXT A;  4MM3 B;  3GLG A;  3GRR A;  2M60 A;  1IBK M;  4B7G A;  4AQY M;  3QWL A;  3GPY A;  4D82 A;  2CE7 A;  5GKN A;  3E4R A;  2JCH A;  3A42 A;  4NRW A;  3U61 B;  4LJ9 A;  2R4J A;  3SC3 A;  3KP0 E;  4AI6 A;  2Y2J A;  1E94 E;  3W0L B;  4JI2 M;  3GRV A;  1OFI A;  3C58 A;  4I5S A;  4IBJ A;  3LQQ A;  4LFA M;  4NZ5 A;  2UUB M;  4LJ6 A;  2J7O A;  2Q2E B;  2R45 A;  4A3V B;  2Y2I A;  1GLN A;  2RGH A;  4AZF A;  3BOS A;  1G3I A;  4DV7 M;  3RGP A;  2YNM D;  4OJO A;  2F5N A;  1IY0 A;  5FTM A;  4DV1 M;  4JI4 M;  2DWL A;  3LVV A;  4BBA A;  4I81 A;  3K2L A;  3GQ4 A;  1NY6 A;  3SAU A;  3THG A;  2Y2M A;  3U6P A;  4Z8X A;  4IBF A;  4AG6 A;  1NSF A;  2R65 A;  4IBE A;  1NJG A;  1KSF X;  2XFT A;  3SAV A;  1IBL M;  4OJL A;  3HSH A;  1DGF A;  2BJW A;  2FNA A;  1DO0 A;  3AFH A;  3UK6 A;  3U6L A;  1Z59 A;  4LJ5 A;  4M9Z A;  2Y2H A;  2YQZ A;  4KO8 A;  5ITQ A;  2FOI C;  3FD9 A;  4DV5 M;  3CF0 A;  2ZAO A;  4OX9 M;  2Y2Q A;  3N3F A;  4G4O A;  2G5G X;  1N78 A;  1YU2 A;  4LGM A;  3KSX A;  4M0D A;  4YHH M;  3CF2 A;  3PNY A;  3T38 A;  1PJJ A;  2BJV A;  4XBO A;  4LRS A;  1YUB A;  4S12 A;  5EXP A;  3TL4 X;  4XGI A;  3MHV C;  3HKP A;  1MX0 A;  4FCW A;  3T1Y M;  3U5Z A;  2A5Y B;  1SXJ D;  3TWK A;  3SBJ A;  4DR4 M;  2V1U A;  5ITY A;  1L1T A;  4JV5 M;  3GLG B;  4PCZ A;  4NSO B;  4LRT A;  1NJF A;  2R4E A;  5FTK A;  4IIW A;  2UU9 M;  3VK7 A;  2C9C A;  3EIH A;  1J7K A;  3FUV A;  4D81 A;  2QBY B;  4GKJ M;  4JI3 M;  3HON A;  2F5P A;  3ZCB B;  2CV1 A;  2XF3 A;  3Q8X A;  3U61 A;  2XSZ A;  1N34 M;  2DXI A;  2UWX A;  3VDU A;  2FFF B;  4GH9 A;  4QHS A;  5KQ8 A;  2CV0 A;  1XNR M;  2V1C A;  2XH9 A;  3HGI A;  2YFQ A;  5EXX A;  1IN6 A;  3GLI B;  4CGY B;  4GHL A;  3MJ5 A;  3SHG B;  2RGO A;  7CAT A;  1N36 M;  2I7N A;  2HHH M;  5FSW A;  5ITT A;  4MGZ E;  4BLC A;  2HL7 A;  3A98 B;  1HR0 M;  2C98 A;  3LVW A;  4TUW A;  4B3M M;  1FJG M;  4B3S M;  2ZAM A;  4JN6 A;  3UZU A;  3FKE A;  3VDP A;  3AJI B;  2FFJ A;  4B7F A;  1DO2 A;  4PDI A;  4KLN A;  3GO8 A;  2IOU A;  1NHG C;  3SYK A;  2YR0 A;  4L8R C;  1SXJ C;  4L4U A;  5EP4 A;  4Z6Y A;  1TDH A;  3U6Q A;  2E5L M;  1S3S A;  3FTE A;  4LJA A;  2C5R A;  1KYI A;  3VLF B;  3DOA A;  4JI5 M;  1I94 M;  4G4Q A;  4L78 A;  1L1Z A;  1HT1 E;  3WHL A;  4FD2 A;  3GPX A;  1HNX M;  5EJC A;  5A2Q S;  3U6D A;  2XD1 A;  3J27 B;  2QP9 X;  2R18 A;  2XZU A;  2CEA A;  2HCB A;  3U5Z B;  3I51 A;  1PM5 A;  1NNU C;  1YUE A;  4KOD A;  3SYL A;  4LF7 M;  4DR3 M;  4QHT A;  4IBB A;  3H4M A;  3J80 S;  3GP1 A;  2CHV A;  1IY1 A;  5FTN A;  3TWM A;  3SMS A;  4MGI E;  1SXJ A;  2ERC A;  5EP1 A;  3GLI A;  4M0W A;  1L2D A;  4DR5 M;  2Y2O A;  3FUT A;  3KP1 E;  3DFZ A;  3FUW A;  3M6A A;  1Q3B A;  2I7P A;  1T3T A;  3T1H M;  1XC8 A;  1K82 A;  1QZM A;  4NY2 A;  1DGB A;  2LH0 A;  4LY6 A;  3U6O A;  2Y21 A;  4GMQ A;  4R7G A;  1N77 A;  1YU3 A;  3KOZ E;  2XSZ D;  4OUI A;  2C96 A;  2W82 A;  1OFH A;  3AOE A;  1NNJ A;  2C99 A;  4GIP A;  1GL6 A;  3B9P A;  4LF9 M;  4B08 A;  4GKK M;  4JI7 M;  4G4N A;  5EQT A;  5LMN M;  4FWD A;  1L2B A;  4LF8 M;  3JAM S;  4IBC A;  4LJ7 A;  4X65 M;  3SAS A;  4DR2 M;  3GLH B;  4NL4 H;  2XLJ A;  2Y2P A;  3SFZ A;  5FLX S;  1WXQ A;  4BB9 A;  3QAU A;  2CV2 A;  1HQC A;  2V6Z M;  1NHW C;  1Z5A A;  5IZ7 D;  4NZ1 A;  1SXJ B;  4LGY A;  4DV2 M;  4LG2 A;  3GPP A;  3ZC7 B;  2DWM A;  3KDS E;  5LMU M;  1N33 M;  1NY5 A;  3I4V A;  1PJI A;  3K1J A;  3JR5 A;  3K8Z A;  3KSJ A;  2F5O A;  2KEB A;  3LQR A;  4RF0 A;  5E26 A;  3HHY A;  3NWL A;  5H37 D;  4QNL A;  1IN8 A;  2QPA A;  2Z3X A;  4HLQ A;  2J7N A;  2F5Q A;  5DNY A;  3AOE C;  1N32 M;  4LFB M;  1ORY B;  5E6J A;  3UMM A;  1IY2 A;  1K3X A;  4I4L A;  4NZ3 A;  4NXM M;  3AKZ A;  1HT2 E;  4IBK A;  2XZF A;  3FUU A;  4DR6 M;  3AL0 C;  4DR1 M;  3EIE A;  4ITQ A;  1L8Q A;  4NSR A;  3SAT A;  1JQJ C;  1N75 A;  4NOO B;  2X4A A;  5ITX A;  5KO3 A;  2NQ8 C;  4GC9 A;  1QVR A;  1Q39 A;  2AHM A;  1QAO A;  2L7H A;  4RNA A;  3U60 B;  4GC5 A;  3KW6 A;  1GKI A;  4DUY M;  3HJS A;  2D7E A;  2M5Z A;  3HHW A;  4PT5 A;  3UJN A;  5BR8 M;  4MGH A;  3I4Y A;  1OJL A;  5EXS A;  1IXZ A;  3TQS A;  3OTO M;  3RFW A;  2DHR A;  1DGH A;  1EE8 A;  5DYG A;  4QOZ C;  4DV3 M;  2KRU A;  3KVW A;  4B7H A;  4W5W A;  3M0E A;  4CHT B;  3U6C A;  1XXH B;  1YU1 A;  2Z7J A;  3D8L A;  3K92 A;  1G4A E;  2G8L A;  3R8F A;  3FTC A;  2XD5 A;  1Z5B A;  4ZPX A;  1H6U A;  2DZN B;  2UUC M;  3HWS A;  2Y2N A;  2DWN A;  1QAQ A;  4DUZ M;  3E9S A;  4LCB A;  3GLH A;  3GPU A;  2P5T A;  3AV0 A;  2DWZ B;  2KRK A;  5ITU A;  4FWG A;  3T15 A;  4JI6 M;  1VDD A;  4IBI A;  3SMP A;  3PVS A;  2X8A A;  4AW4 A;  1K3W A;  2QCU A;  1YU4 A;  1HNZ M;  2X49 A;  3JR4 A;  4IBD A;  4M9X A;  3A45 A;  3GQ5 A;  4KHP M;  3FYD A;  3HU3 A;  2Z4R A;  5KQD A;  4LZJ A;  3U6M A;  3VFD A;  1Z5C A;  5ITX E;  4OVZ B;  1FNN A;  1XXH A;  5DYI A;  1XMQ M;  5FTJ A;  4K0K M;  3L2A A;  4DV6 M;  2HKJ A;  1IN7 A;  2BG1 A;  4QNM A;  4LF5 M;  3J7A S;  5EP2 A;  2UUA M;  2K47 A;  3MK6 A;  3GLF A;  3GQ3 A;  4OJ5 A;  3U60 A;  3PXG A;  2ZM6 M;  2LWX A;  2EUC A;  1C1K A;  1QYR A;  3TE6 A;  3A46 A;  4PD2 A;  2XGN A;  5JI2 E;  1G41 A;  2R62 A;  1D2N A;  2UXD M;  2CUZ A;  2CHQ A;  2KZU A;  1DGH B;  2QEN A;  4L15 A;  2D7G A;  4WUR A;  4LF4 M;  4YY3 M;  2Y0Q A;  3FTD A;  1W5T A;  2L6O A;  4JI0 M;  2R46 A;  4QNR A;  5JI3 E;  5C18 A;  4X64 M;  3L29 A;  2C9O A;  4AG5 A;  2Y2G A;  1LV7 A;  4LJ4 A;  5IWA M;  2LNH C;  4NRV A;  3L28 A;  3L26 A;  2VII A;  2Y2K A;  2F4V M;  3IG5 A;  2CFO A;  3SAW A;  1E9R A;  1Q3C A;  4X66 M;  4II7 A;  4AKI A;  1SXJ E;  4LJ8 A;  2UXB M;  4NZ4 A;  4HL4 A;  4REZ A;  4IJF A;  2Y0T A;  4MGY E;  3GLF B;  1XMO M;  1J09 A;  3GRY A;  3NBI A;  4DV4 M;  1JR3 D;  2VQE M;  4NYY A;  2Z4S A;  4OW0 A;  4DR7 M;  5KPR A;  4MB7 A;  3AOG A;  2Y20 A;  1IXR C;  3RGS A;  4JI1 M;  3J7B A;  1TH4 A;  4FCV A;  3U6S A;  1KFV A;  2QZ4 A;  4OVZ A;  2OQ4 A;  4WW0 A;  1TH3 A;  2D7H A;  1R7R A;  3HJQ A;  1TGU A;  4FCT A;  3ZH9 B;  1R2Y A;  3VKH A;  1HQY E;  2JE5 A;  3TPZ A;  1W5S A;  3KOX E;  4M9S A;  4OJP A;  2VQF M;  4JI8 M;  3U6E A;  3TWL A;  4FVM A;  4OJ6 A;  5EP3 A;  2QBY A;  1IXS B;  3CTW B;  5FTL A;  1GVN A;  2DVW B;  1R6B X;  2RKO A;  4NXN M;  1TH2 A;  3UGJ A;  5ITR A;  4GHA A;  4MH0 E;  4RF1 A;  2KW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...