4GHAA

Crystal structure of marburg virus vp35 rna binding domain bound to 12-bp dsrna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
pubmed doi rcsb
source organism Marburg virus - musoke, kenya, 1980
molecule tags Viral protein,rna binding protein/rna
molecule keywords Polymerase cofactor VP35
total genus 39
structure length 122
sequence length 122
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ghaA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ghaA02
3KS8A 4IJFA 4GHLA 4IBKA 4IJEA 4IBDA 3L29A 4GH9A 4LG2A 4GHAA 4IBFA 4IBJA 4IBEA 4IBCA 4IBIA 5BPVA 3L26A 3L27A 3FKEA 3L2AA 3L25A 4IBGA 4IBBA 3L28A 3KS4A
chains in the Genus database with same CATH superfamily
4FCTA 2QNJA 5C18A 2JZ1A 1VDDA 4B3RM 2Z4RA 1KFVA 1SXJD 2X49A 3H4MA 4QNMA 4DR2M 1OAIA 5ITXA 4YHHM 1E6ZA 3IECA 4Y28F 2R44A 1N33M 1R4GA 1KYIA 3EIHA 4TUWA 3GLHB 4HMCA 3FRHA 2LNHC 1H6UA 1ZQ9A 4Z8XA 2XZFA 2XSZA 4LCBA 2Y2LA 1CK7A 1IBMM 2QZ4A 2BWBA 3MMPA 2R4EA 2YNMD 2RTSA 1TGUA 3T6PA 2CV0A 1E9SA 1NV8A 1IN8A 3WD3A 2CE7A 2LXEA 4OVZB 4AZFA 1GLNA 4IBBA 1YU2A 4FWHA 3KDSE 2EUCA 2HL7A 2WZJA 2I7PA 4R71A 1W5SA 4GITA 1J7MA 5JI2E 1KSFX 3JAMS 1JR3A 2JZ0A 4QNRA 1DGHA 1QQWA 3GLGE 4S12A 2UWXA 4LGYA 4PDGA 1ZMUA 4LGMA 4FCWA 1CUKA 3VFDA 2Y2JA 5DNYA 3SYLA 1TDHA 2O5RA 4LJ8A 5EP3A 4Z2GA 4NSRA 5KPRA 2R65A 2K0BX 2KNZA 3B9PA 3SC3A 2BWEA 1ZAEA 2DAKA 1WHCA 1D0MA 3E21A 1QVRA 3KSJA 5H37D 3HU2A 4NXNM 2J7NA 3T1YM 2UXBM 5ITUA 1S3SA 3GQ4A 3I51A 2LHCA 2DHRA 2XD5A 3J7AS 1HNXM 2XSZD 1GKIA 3NBXX 2RGHA 5KQDA 4GC9A 5FLXS 3SFZA 3U6DA 4Z2KA 1I4WA 1WIVA 4IIWA 1IN5A 4NZ4A 4QNLA 1K3WA 1D0KA 3VK7A 4IJEA 1JQJC 1H8PA 2L4EA 2ZAMA 1DGGA 4YY3M 1OAOC 2MR9A 4GH9A 2V1CA 4LJ5A 1SXJA 2R6FA 3K9PA 3VKHA 3BXWA 4IBJA 3SMPA 2K47A 3IHPA 1QAMA 4LJ9A 4LFAM 3K8ZA 2D7HA 3GLGA 3T15A 1R2ZA 3MJ5A 4GRIA 1Z6TA 3L26A 1IY1A 3IG5A 3TPZA 3UGJA 4GIPA 4OU7A 2VQEM 1FNNA 1NHWC 3FUVA 2Y2NA 1Q39A 2CHVA 4D81A 2DZOB 4D82A 1E6NA 3HSHA 4L8RC 2KXEA 4X65M 1PGYA 3HGIA 4JI3M 1PJQA 1NNJA 2DZNB 4BB9A 3HONA 5EXTA 3DA1A 1PJTA 4XGIA 4DR5M 2ZANA 3EIEA 1LV7A 1QZEA 3C3DA 3W68A 4NXMM 1XHBA 5FTJA 4OW0A 1TH2A 1TR8A 1P3QQ 2XEPA 1J5EM 2BNKA 4DV2M 1O6IA 3MQLA 4MGKE 4JXJA 2ZAOA 1XXHA 4ZPXA 3RGPA 3B7ZA 4OX9M 3CGWA 3RFWA 4DV3M 2FFFB 3KOYE 3D8BA 1W1YA 1A5TA 4Z2IA 2J7OA 3FTCA 5LMUM 2X8AA 2WSEF 4DR1M 3KS8A 4OJ6A 1HT2E 2DVWB 3IG8A 1YSYA 5IREB 3GPUA 4W5WA 1NNUC 4DV6M 3TWLA 1W5TA 4GHLA 1UM8A 1KS0A 3U6CA 2W82A 4MB3A 2DWZB 4JN6A 4NZ3A 1DGFA 2HCBA 3GPXA 1TH4A 4GHAA 3JR5A 4WP2A 3WHKA 2DWMA 2LVAA 5FSWA 3SMSA 1T3TA 1Q3CA 4FVMA 4PT5A 3TE6A 1L2BA 2FE8A 3V76A 4JI4M 1YUBA 4DV1M 3J81S 4MGIE 3A45A 1GL6A 5LMNM 1IQPA 3M6AA 1IXZA 3J7BA 2L4FA 1YU3A 1CXWA 1EE8A 1IN4A 5EP1A 1G8PA 1XMOM 1GOIA 2OOBA 4DR4M 4LJAA 1IXSA 1QUTA 1V33A 2CRUA 4JI0M 1NJGA 3C58A 1G4AE 2QENA 3GO8A 1N34M 1G59A 1I94M 3PNVA 4RF0A 1OGGA 4ANRA 4LF5M 3KW6A 1T43A 2EKKA 3SHFA 1R6BX 3SATA 2VDBB 1T6OA 4MGZE 3B7QA 2JY5A 3SAWA 2DXIA 1YU4A 4G4QA 3WX7A 3TWMA 3ZC7B 1Q3BA 2V6ZM 3GLIA 3HU3A 1N75A 2KNAA 4LY6A 4IBCA 2DAGA 2JUJA 3D8LA 1R7RA 2I7NA 3ZH9B 4AKGA 2LHGA 3LVWA 4Z6YA 1ORYB 1Z5AA 3L27A 1GL7A 3A42A 7CATA 2KEBA 4DR6M 1Z59A 4IBGA 3GLFB 3GQ5A 1Y8GA 1IY0A 2H5XA 3MK6A 3PFIA 5E6JA 3I4YA 3KP0E 4PDIA 2VQFM 5IT9S 2BJVA 4P16A 2P5TA 3R8FA 2Y2HA 5ITTA 2HAKA 2LVQD 3C9PA 1EAKA 2JY8A 2OOAA 2QSFX 1NY5A 4GKKM 2F5NA 2DWNA 4KT0F 4XBOA 3SBJA 1OFIA 1K3XA 5FTMA 4IBDA 1L6JA 3HX3A 3K1JA 2CV2A 4RNAA 2APLA 3KOXE 2ERCA 3Q8GA 3RE8A 4FD2A 4A3VB 3GLFA 4AKHA 2GNOA 3THGA 4NYUA 2KA6B 3LQRA 2MJ5B 2K6BA 3CTWB 4REZA 3C3EA 2JCHA 4KODA 2B3TA 4LJ4A 2MGWA 4FWDA 4D80A 3SAUA 1MJGM 3TL4X 4RF1A 1E8BA 1C7YA 3GLGB 2D7GA 2L09A 3LMMA 4LF6M 4DR7M 2LBCA 2DAMA 1SXJB 3GLIB 4PCZA 3A46A 4JI6M 2F5PA 5EJCA 1N77A 4DV4M 4CISA 5KPZA 3E9SA 2DWLA 1E6RA 2CP8A 2DNAA 1E9RA 3FTEA 3GPYA 1TDZA 2KW0A 2N35A 2BG1A 3WD2A 1XXHE 1JB0F 4OJLA 2EKFA 4AQYM 1HR0M 1IXSB 1NSFA 4Q7JA 4AW4A 4IBFA 1FJGM 4WURA 1V92A 2C99A 3PNYA 1DO2A 5A2QS 2MH8A 2VF7A 3GRYA 2R45A 4B3SM 5GKNA 1SXJE 1GJTA 3CF0A 3I01M 5E26A 3TWKA 4CJ6A 1E15A 3FKEA 3VDPA 4JI7M 4RKUF 3JR4A 3FUTA 3VKGA 4I81A 1N32M 1XB2B 3WD1A 3WHLA 2Y2GA 1L1TA 4HMDA 3PXGA 4B7HA 4ITQA 2Y2KA 4NC6A 1OKSA 3K92A 3KS4A 1ZMWA 1NHGC 4K0KM 3A98B 1DGHB 4II7A 3FRIA 2F5QA 3GPPA 1RU3A 2WSCF 3FUUA 4NOOB 4Z2HA 1E88A 1OQYA 3AL0C 3AOEA 3FE3A 4NZ1A 4F2LA 1UFZA 1YUEA 1HNZM 1NY6A 2CUZA 1H0GA 3L29A 4LF8M 2CHGA 4L78A 5C1BA 4LJ7A 2VIIA 5EP2A 2Z3XA 2X4AA 2XFTA 2Y20A 1H0IA 1GJSA 1UR8A 1YLAA 2K9DA 1IM2A 1ZMVA 4NYYA 2L7IA 3E4RA 1XXHB 4LF4M 4LF7M 2JNHA 2XFSA 3U6SA 1V34A 1Z5CA 3GLHA 1JR3E 2NQ8C 2G3QA 4KHPM 3AFHA 2C98A 1X37A 3LVVA 1QO6A 4NRVA 2Q2EB 2KRUA 5ITYA 2Y2OA 2QQ8A 2LVOC 3QWLA 3HHZA 4P17A 3U6MA 2EO2A 1F4IA 3HJQA 3I4VA 1PJSA 5KO3A 1N36M 2JY6B 2OO9A 1Z5BA 3SASA 3FUXA 2RGOA 2G8LA 2CV1A 4QOZC 1L2CA 1WJ7A 4LF9M 4LG2A 3J2PB 4L15A 4IBEA 5EXSA 3N3FA 1TTEA 2V5OA 4M9XA 4EIWA 4B3MM 3M0EA 2LWXA 2Y0QA 4I4LA 4BLCA 3U61A 2RKOA 1ZV1A 1NJFA 4G4RA 2FOIC 4FCVA 4G4NA 1E94E 1AIWA 4QHTA 3KFUG 4LRTA 2G5GX 2AHMA 1EIJA 1R2YA 4GKJM 2UUBM 4CHTB 2DZLA 2O25A 3FTDA 1QDTA 2UUCM 2IOUA 4MH0E 2Y2PA 4CIZA 3F92A 4JI8M 4GEWA 4IBKA 4B7GA 4PD2A 5ITRA 1VEKA 1HQCA 2CFOA 1J09A 3UK6A 3LQQA 8CATA 4DR3M 2C96A 3U61B 2BJWA 3E46A 3AJIB 3QAUA 3AV0A 4MB5A 4OJPA 1EFUB 1PJIA 5EQTA 1OIPA 4HEOA 4DUYM 4Z2JA 2MROB 5L8RF 4CGYB 4X62M 2JWSA 3HZJA 4MB4A 1QANA 2QPAA 1HNWM 4AI6A 3CF6E 1YU1A 1QYRA 3W0FA 3VDUA 3BBZA 5DYIA 2LTUA 1XWIA 4GC5A 1GVNA 2F5SA 3VK8A 3HKPA 2Y2IA 2KHHA 1BVSA 1WGNA 2OPFA 3U6OA 1YE9A 5EXPA 3U6PA 4AKIA 4JYAM 1PRBA 1TH3A 2OQ4A 2V1UA 1PDCA 5JI3E 1NV9A 1VEGA 2FS1A 4M9ZA 3I04M 3SAVA 1ED7A 3LCUA 1N78A 3AOGA 3LW5F 4B08A 3LCVB 2R46A 2JP7A 1TF0B 4OJOA 4HMEA 1AIPC 5ITXE 3W67A 2DAIA 1QAQA 2XH9A 4WW0A 2E5LM 4X66M 2R62A 2XGNA 1L2DA 3R9XB 4LRSA 4JI1M 1XNRM 1OIZA 2UU9M 1OFHA 1D2NA 4JI2M 1WR1B 4HLQA 4LZZA 2VF8A 1G41A 2D7EA 4LFCM 5EP4A 3VLFB 3U5ZB 2FNAA 3QYBA 2R4JA 4HL4A 3WD0A 4DV7M 5FTLA 2QBYB 1HT1E 2CHQA 4L6V6 4OVZA 4AG5A 3T1HM 4OUIA 4LFBM 3OTOM 1IN6A 4MB7A 5DFLA 1K82A 2XD1A 2Y0TA 2L6OA 3GRVA 5FTKA 3L2AA 4B7FA 5IWAM 1D0LA 2H1RA 2QCUA 2DKLA 3KSXA 3ZCBB 3PVSA 2KNVA 5KPTA 1MN3A 1GABA 3M7GA 2A5YB 4M9SA 3M7PA 2HKJA 2Z7JA 3NBIA 3U6LA 2RRUA 3U60A 2JA2A 2R18A 1NO1A 1IBKM 2QBYA 2UXDM 3CF2A 2UXCM 1GXDA 1NVMA 1J7KA 1LTMA 1QAOA 4QOSA 3AKZA 3U5ZA 1IBLM 3W0LB 4L16A 2C5RA 1GO5A 4IJFA 3AOEC 4LJ6A 4I8OA 1MX0A 2Y2QA 4L4UA 1DO0A 4JI5M 4LZJA 1HJPA 3J27B 4UN2B 4NL4H 2FH0A 1SG9A 4I5SA 2LVPC 3SYKA 1DV0A 2HHHM 1XMQM 2C9OA 3FYCA 2L7HA 4MM3B 4QHSA 4R7GA 1C1KA 2EA0A 3DOAA 1OJLA 2R0IA 1VG5A 3HJ8A 4DV5M 2O01F 4FWGA 3B7NA 5FTNA 3FTFA 3MHVC 1QZMA 2LH0A 1MU5A 2LVNC 2WSFF 3FUWA 4KLNA 3UMMA 3GQ3A 2ZM6M 4DV0M 3L28A 2KZSA 2YQZA 2DAEA 3GLHE 3HU1A 3HJSA 3NWLA 4F1IA 4NRWA 1IN7A 1WGLA 3QYEA 4G4OA 1XC8A 1PM5A 1XNQM 1R5LA 2ZBKB 1HQYE 2DI0A 3K2LA 2D49A 2Y2MA 3GLIE 4M0DA 5BR8M 3HY5A 4FW9A 1W1TA 3WD4A 1E32A 2Z8YM 3DZDA 3UJNA 2F4VM 2C9CA 2ZTDA 3HHXA 4GMQA 2JY7A 3ILKA 1E6PA 5IZ7D 1GPFA 4NZ5A 4MGYE 3SARA 2DHYA 2XF3A 4XK8F 2L2DA 2HWJA 2UUAM 3Q8XA 5KQ8A 2KZUA 1OTRA 4R3DA 4NSOB 5BPVA 3RGSA 4JV5M 1IFYA 3L25A 3KVWA 2EJSA 4KO8A 1IXRC 1L8QA 1Q02A 2QP9X 2ZTCA 3BOSA 3KXEC 5EXXA 1AUAA 3GP1A 4OJ5A 1W1PA 2M5ZA 3HWSA 4BBAA 1VQ1A 3KOZE 4X64M 1G3IA 5F3WA 3U6QA 1JR3D 1SXJC 3K9OA 2KRKA 3FD9A 1PJJA 2KDLA 3UZUA 3J80S 2FN2A 2YFQA 1IY2A 3TQSA 4Z2LA 2Z4SA 4DUZM 2J5YA 3HHYA 1YU0A 2XZUA 2CWBA 2CEAA 3GLFE 4TX8A 4G3OA 5DYGA 3U60B 3FYDA 2DENA 3H4JA 4DBGB 2JXNA 3KOWE 3U6EA 1L1ZA 3GRUA 2F5OA 3HHWA 4MGHA 2JE5A 5ITQA 3T38A 1VEJA 4G6ZA 4IBIA 3ZQJA 1W1VA 1OGBA 2Y21A 3DFZA 4B3TM 1VDLA 3KP1E 2M60A 2QHOB 4NY2A 3GRRA 2FFJA 4AG6A 1QDRA 1UR9A 1WXQA 1DGBA 1G71A 2XLJA 4M0WA 3B74A 2YR0A 2GQFA 3B89A 1QUSA 3SHGB
chains in the Genus database with same CATH topology
4FCTA 5C18A 4B3RM 1VDDA 2Z4RA 1KFVA 1SXJD 2X49A 3H4MA 4QNMA 4DR2M 5ITXA 4YHHM 1N33M 1KYIA 3EIHA 4TUWA 3GLHB 2LNHC 1H6UA 1ZQ9A 4Z8XA 2XZFA 2XSZA 4LCBA 2Y2LA 1IBMM 2QZ4A 2R4EA 2YNMD 1TGUA 2CV0A 1E9SA 1IN8A 2CE7A 2LXEA 4AZFA 1GLNA 4IBBA 1YU2A 4FWHA 3KDSE 2EUCA 2HL7A 2I7PA 1W5SA 4GITA 5JI2E 1KSFX 3JAMS 1JR3A 4QNRA 1DGHA 1QQWA 4S12A 2UWXA 4LGYA 4PDGA 4LGMA 3VFDA 4FCWA 2Y2JA 5DNYA 3SYLA 1TDHA 2O5RA 4LJ8A 5EP3A 4NSRA 5KPRA 2R65A 3B9PA 3SC3A 1ZAEA 1QVRA 3KSJA 5H37D 3HU2A 4NXNM 2J7NA 3T1YM 2UXBM 5ITUA 1S3SA 3GQ4A 3I51A 2XD5A 2DHRA 3J7AS 1HNXM 2XSZD 1GKIA 2RGHA 5KQDA 4GC9A 5FLXS 3SFZA 3U6DA 1I4WA 4IIWA 1IN5A 4NZ4A 4QNLA 1K3WA 3VK7A 4IJEA 1JQJC 2ZAMA 1DGGA 4YY3M 3VKHA 4GH9A 2V1CA 4LJ5A 1SXJA 3SMPA 4IBJA 2K47A 4LJ9A 1QAMA 4LFAM 3GLGA 3K8ZA 2D7HA 3T15A 1R2ZA 3MJ5A 4GRIA 1Z6TA 3L26A 1IY1A 3IG5A 3TPZA 3UGJA 4GIPA 4OU7A 2VQEM 1FNNA 1NHWC 3FUVA 2Y2NA 1Q39A 2CHVA 4D81A 2DZOB 4D82A 3HSHA 4L8RC 2KXEA 4X65M 3HGIA 4JI3M 1NNJA 2DZNB 4BB9A 3HONA 5EXTA 3DA1A 4XGIA 4DR5M 2ZANA 3EIEA 1LV7A 4NXMM 1XHBA 5FTJA 4OW0A 1TH2A 2XEPA 1J5EM 2BNKA 4DV2M 4MGKE 4JXJA 2ZAOA 1XXHA 4ZPXA 3RGPA 4OX9M 3RFWA 4DV3M 2FFFB 3KOYE 3D8BA 2J7OA 3FTCA 5LMUM 2X8AA 4DR1M 3KS8A 4OJ6A 1HT2E 2DVWB 3IG8A 1YSYA 5IREB 3GPUA 4W5WA 1NNUC 4DV6M 3TWLA 1W5TA 4GHLA 1UM8A 3U6CA 2W82A 2DWZB 4JN6A 4NZ3A 1DGFA 2HCBA 3GPXA 1TH4A 4GHAA 3JR5A 2DWMA 3WHKA 5FSWA 3SMSA 1T3TA 1Q3CA 4FVMA 4PT5A 3TE6A 1L2BA 2FE8A 4JI4M 1YUBA 4DV1M 3J81S 4MGIE 3A45A 1GL6A 5LMNM 1IQPA 3M6AA 1IXZA 3J7BA 1YU3A 1EE8A 1IN4A 5EP1A 1G8PA 1XMOM 4DR4M 4LJAA 4JI0M 3C58A 1NJGA 1G59A 1G4AE 2QENA 3GO8A 1N34M 1I94M 3PNVA 4RF0A 4LF5M 3KW6A 3SHFA 3SATA 1R6BX 1YU4A 4MGZE 3SAWA 2DXIA 4G4QA 3WX7A 3TWMA 3ZC7B 1Q3BA 2V6ZM 3GLIA 3HU3A 1N75A 4LY6A 4IBCA 3D8LA 1R7RA 2I7NA 3ZH9B 4AKGA 3LVWA 4Z6YA 1ORYB 1Z5AA 3L27A 1GL7A 3A42A 7CATA 2KEBA 4DR6M 1Z59A 4IBGA 3GLFB 3GQ5A 3PFIA 1IY0A 3MK6A 5E6JA 3I4YA 3KP0E 4PDIA 2VQFM 5IT9S 2BJVA 4P16A 2P5TA 3R8FA 2Y2HA 5ITTA 1NY5A 4GKKM 2F5NA 2DWNA 4XBOA 3SBJA 1OFIA 1K3XA 5FTMA 4IBDA 3K1JA 2CV2A 4RNAA 3KOXE 2ERCA 3RE8A 4FD2A 4A3VB 3GLFA 4AKHA 4NYUA 3THGA 2KA6B 3LQRA 3CTWB 4REZA 2JCHA 4KODA 4LJ4A 4D80A 4FWDA 3SAUA 3TL4X 4RF1A 3GLGB 2D7GA 2L09A 3LMMA 4LF6M 4DR7M 3GLIB 1SXJB 4PCZA 3A46A 4JI6M 2F5PA 5EJCA 1N77A 4DV4M 4CISA 5KPZA 3E9SA 2DWLA 1E9RA 3FTEA 3GPYA 1TDZA 2KW0A 2BG1A 4OJLA 4AQYM 1HR0M 1IXSB 1NSFA 4AW4A 4IBFA 1FJGM 4WURA 2C99A 3PNYA 1DO2A 5A2QS 3GRYA 2R45A 4B3SM 5GKNA 1SXJE 3CF0A 5E26A 3TWKA 3FKEA 3VDPA 4JI7M 3JR4A 3FUTA 3VKGA 4I81A 1N32M 3WHLA 2Y2GA 1L1TA 3PXGA 4B7HA 4ITQA 2Y2KA 3K92A 3KS4A 1NHGC 4K0KM 3A98B 1DGHB 4II7A 2F5QA 3GPPA 3FUUA 4NOOB 3AL0C 3AOEA 4NZ1A 1YUEA 1HNZM 1NY6A 2CUZA 3L29A 4LF8M 2CHGA 4L78A 4LJ7A 2VIIA 5EP2A 2Z3XA 2X4AA 2XFTA 2Y20A 1IM2A 4NYYA 2L7IA 3E4RA 1XXHB 4LF4M 4LF7M 2XFSA 3U6SA 1Z5CA 3GLHA 4KHPM 2NQ8C 3AFHA 2C98A 1X37A 3LVVA 4NRVA 2Q2EB 2KRUA 5ITYA 2Y2OA 3QWLA 3HHZA 3U6MA 2EO2A 3HJQA 3I4VA 1N36M 5KO3A 1Z5BA 3SASA 3FUXA 2RGOA 2G8LA 2CV1A 4QOZC 1L2CA 4LF9M 4LG2A 3J2PB 4L15A 4IBEA 5EXSA 3N3FA 4M9XA 4EIWA 4B3MM 3M0EA 2LWXA 2Y0QA 4I4LA 4BLCA 3U61A 2RKOA 1NJFA 4G4RA 2FOIC 4FCVA 4G4NA 1E94E 4QHTA 3KFUG 4LRTA 2G5GX 2AHMA 1R2YA 4GKJM 2UUBM 4CHTB 3FTDA 2UUCM 2IOUA 4MH0E 2Y2PA 4JI8M 4B7GA 4IBKA 4PD2A 5ITRA 1HQCA 2CFOA 1J09A 3UK6A 3LQQA 8CATA 4DR3M 2C96A 3U61B 2BJWA 3AJIB 3QAUA 3AV0A 4OJPA 1PJIA 5EQTA 4DUYM 4CGYB 4X62M 1QANA 2QPAA 1HNWM 4AI6A 3CF6E 1YU1A 1QYRA 3W0FA 3VDUA 5DYIA 1XWIA 4GC5A 1GVNA 2F5SA 3VK8A 3HKPA 2Y2IA 3U6OA 2OPFA 1YE9A 5EXPA 3U6PA 4AKIA 4JYAM 2V1UA 1TH3A 2OQ4A 5JI3E 4M9ZA 3SAVA 1N78A 3AOGA 4B08A 2R46A 4OJOA 5ITXE 1QAQA 2XH9A 4WW0A 2E5LM 4X66M 2R62A 2XGNA 1L2DA 3R9XB 4LRSA 4JI1M 1XNRM 2UU9M 1D2NA 1OFHA 4JI2M 4HLQA 4LZZA 1G41A 2D7EA 4LFCM 5EP4A 3VLFB 3U5ZB 2FNAA 4HL4A 2R4JA 4DV7M 5FTLA 2QBYB 1HT1E 2CHQA 4OVZA 4AG5A 3T1HM 4OUIA 4LFBM 3OTOM 1IN6A 4MB7A 1K82A 2XD1A 2Y0TA 2L6OA 3GRVA 5FTKA 3L2AA 4B7FA 5IWAM 2QCUA 2H1RA 3KSXA 3ZCBB 3PVSA 5KPTA 3M7GA 2A5YB 4M9SA 2HKJA 2Z7JA 3NBIA 3U6LA 3U60A 2JA2A 2R18A 1IBKM 2QBYA 2UXDM 3CF2A 2UXCM 1NVMA 1J7KA 1QAOA 4QOSA 3AKZA 3U5ZA 1IBLM 3W0LB 4L16A 2C5RA 4IJFA 3AOEC 4LJ6A 4I8OA 1MX0A 2Y2QA 4L4UA 1DO0A 4JI5M 4LZJA 3J27B 4NL4H 4I5SA 3SYKA 2HHHM 1XMQM 2C9OA 3FYCA 2L7HA 4MM3B 4QHSA 4R7GA 1C1KA 2EA0A 3DOAA 1OJLA 3HJ8A 4DV5M 4FWGA 5FTNA 3FTFA 3MHVC 1QZMA 2LH0A 1MU5A 3FUWA 4KLNA 3GQ3A 3UMMA 2ZM6M 4DV0M 3L28A 2KZSA 2YQZA 3NWLA 4NRWA 3HU1A 3HJSA 1IN7A 4G4OA 1XNQM 1PM5A 1XC8A 2ZBKB 3K2LA 1HQYE 2Y2MA 4M0DA 5BR8M 4FW9A 1E32A 3DZDA 3UJNA 2F4VM 2C9CA 3HHXA 4GMQA 4NZ5A 3ILKA 5IZ7D 4MGYE 3SARA 2XF3A 2UUAM 3Q8XA 5KQ8A 2KZUA 4R3DA 4NSOB 5BPVA 3RGSA 4JV5M 3L25A 3KVWA 4KO8A 1IXRC 1L8QA 2QP9X 3BOSA 5EXXA 3KXEC 3GP1A 4OJ5A 2M5ZA 3HWSA 4BBAA 3KOZE 4X64M 5F3WA 1G3IA 3U6QA 1SXJC 1JR3D 2KRKA 3FD9A 1PJJA 3UZUA 3J80S 2YFQA 1IY2A 3TQSA 2Z4SA 4DUZM 3HHYA 1YU0A 2XZUA 2CEAA 5DYGA 3U60B 3FYDA 3U6EA 1L1ZA 2F5OA 3KOWE 3GRUA 3HHWA 4MGHA 2JE5A 5ITQA 3T38A 4G6ZA 4IBIA 2Y21A 3DFZA 4B3TM 3KP1E 2M60A 4NY2A 3GRRA 2FFJA 4AG6A 1WXQA 1DGBA 2XLJA 4M0WA 2YR0A 4OVZB 5C1BA 3SHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KS8 A;  4IJF A;  4GHL A;  4IBK A;  4IJE A;  4IBD A;  3L29 A;  4GH9 A;  4LG2 A;  4GHA A;  4IBF A;  4IBJ A;  4IBE A;  4IBC A;  4IBI A;  5BPV A;  3L26 A;  3L27 A;  3FKE A;  3L2A A;  3L25 A;  4IBG A;  4IBB A;  3L28 A;  3KS4 A; 
#chains in the Genus database with same CATH topology
 4FCT A;  2QNJ A;  5C18 A;  2JZ1 A;  1VDD A;  4B3R M;  2Z4R A;  1KFV A;  1SXJ D;  2X49 A;  3H4M A;  4QNM A;  4DR2 M;  1OAI A;  5ITX A;  4YHH M;  1E6Z A;  3IEC A;  4Y28 F;  2R44 A;  1N33 M;  1R4G A;  1KYI A;  3EIH A;  4TUW A;  3GLH B;  4HMC A;  3FRH A;  2LNH C;  1H6U A;  1ZQ9 A;  4Z8X A;  2XZF A;  2XSZ A;  4LCB A;  2Y2L A;  1CK7 A;  1IBM M;  2QZ4 A;  2BWB A;  3MMP A;  2R4E A;  2YNM D;  2RTS A;  1TGU A;  3T6P A;  2CV0 A;  1E9S A;  1NV8 A;  1IN8 A;  3WD3 A;  2CE7 A;  2LXE A;  4OVZ B;  4AZF A;  1GLN A;  4IBB A;  1YU2 A;  4FWH A;  3KDS E;  2EUC A;  2HL7 A;  2WZJ A;  2I7P A;  4R71 A;  1W5S A;  4GIT A;  1J7M A;  5JI2 E;  1KSF X;  3JAM S;  1JR3 A;  2JZ0 A;  4QNR A;  1DGH A;  1QQW A;  3GLG E;  4S12 A;  2UWX A;  4LGY A;  4PDG A;  1ZMU A;  4LGM A;  4FCW A;  1CUK A;  3VFD A;  2Y2J A;  5DNY A;  3SYL A;  1TDH A;  2O5R A;  4LJ8 A;  5EP3 A;  4Z2G A;  4NSR A;  5KPR A;  2R65 A;  2K0B X;  2KNZ A;  3B9P A;  3SC3 A;  2BWE A;  1ZAE A;  2DAK A;  1WHC A;  1D0M A;  3E21 A;  1QVR A;  3KSJ A;  5H37 D;  3HU2 A;  4NXN M;  2J7N A;  3T1Y M;  2UXB M;  5ITU A;  1S3S A;  3GQ4 A;  3I51 A;  2LHC A;  2DHR A;  2XD5 A;  3J7A S;  1HNX M;  2XSZ D;  1GKI A;  3NBX X;  2RGH A;  5KQD A;  4GC9 A;  5FLX S;  3SFZ A;  3U6D A;  4Z2K A;  1I4W A;  1WIV A;  4IIW A;  1IN5 A;  4NZ4 A;  4QNL A;  1K3W A;  1D0K A;  3VK7 A;  4IJE A;  1JQJ C;  1H8P A;  2L4E A;  2ZAM A;  1DGG A;  4YY3 M;  1OAO C;  2MR9 A;  4GH9 A;  2V1C A;  4LJ5 A;  1SXJ A;  2R6F A;  3K9P A;  3VKH A;  3BXW A;  4IBJ A;  3SMP A;  2K47 A;  3IHP A;  1QAM A;  4LJ9 A;  4LFA M;  3K8Z A;  2D7H A;  3GLG A;  3T15 A;  1R2Z A;  3MJ5 A;  4GRI A;  1Z6T A;  3L26 A;  1IY1 A;  3IG5 A;  3TPZ A;  3UGJ A;  4GIP A;  4OU7 A;  2VQE M;  1FNN A;  1NHW C;  3FUV A;  2Y2N A;  1Q39 A;  2CHV A;  4D81 A;  2DZO B;  4D82 A;  1E6N A;  3HSH A;  4L8R C;  2KXE A;  4X65 M;  1PGY A;  3HGI A;  4JI3 M;  1PJQ A;  1NNJ A;  2DZN B;  4BB9 A;  3HON A;  5EXT A;  3DA1 A;  1PJT A;  4XGI A;  4DR5 M;  2ZAN A;  3EIE A;  1LV7 A;  1QZE A;  3C3D A;  3W68 A;  4NXM M;  1XHB A;  5FTJ A;  4OW0 A;  1TH2 A;  1TR8 A;  1P3Q Q;  2XEP A;  1J5E M;  2BNK A;  4DV2 M;  1O6I A;  3MQL A;  4MGK E;  4JXJ A;  2ZAO A;  1XXH A;  4ZPX A;  3RGP A;  3B7Z A;  4OX9 M;  3CGW A;  3RFW A;  4DV3 M;  2FFF B;  3KOY E;  3D8B A;  1W1Y A;  1A5T A;  4Z2I A;  2J7O A;  3FTC A;  5LMU M;  2X8A A;  2WSE F;  4DR1 M;  3KS8 A;  4OJ6 A;  1HT2 E;  2DVW B;  3IG8 A;  1YSY A;  5IRE B;  3GPU A;  4W5W A;  1NNU C;  4DV6 M;  3TWL A;  1W5T A;  4GHL A;  1UM8 A;  1KS0 A;  3U6C A;  2W82 A;  4MB3 A;  2DWZ B;  4JN6 A;  4NZ3 A;  1DGF A;  2HCB A;  3GPX A;  1TH4 A;  4GHA A;  3JR5 A;  4WP2 A;  3WHK A;  2DWM A;  2LVA A;  5FSW A;  3SMS A;  1T3T A;  1Q3C A;  4FVM A;  4PT5 A;  3TE6 A;  1L2B A;  2FE8 A;  3V76 A;  4JI4 M;  1YUB A;  4DV1 M;  3J81 S;  4MGI E;  3A45 A;  1GL6 A;  5LMN M;  1IQP A;  3M6A A;  1IXZ A;  3J7B A;  2L4F A;  1YU3 A;  1CXW A;  1EE8 A;  1IN4 A;  5EP1 A;  1G8P A;  1XMO M;  1GOI A;  2OOB A;  4DR4 M;  4LJA A;  1IXS A;  1QUT A;  1V33 A;  2CRU A;  4JI0 M;  1NJG A;  3C58 A;  1G4A E;  2QEN A;  3GO8 A;  1N34 M;  1G59 A;  1I94 M;  3PNV A;  4RF0 A;  1OGG A;  4ANR A;  4LF5 M;  3KW6 A;  1T43 A;  2EKK A;  3SHF A;  1R6B X;  3SAT A;  2VDB B;  1T6O A;  4MGZ E;  3B7Q A;  2JY5 A;  3SAW A;  2DXI A;  1YU4 A;  4G4Q A;  3WX7 A;  3TWM A;  3ZC7 B;  1Q3B A;  2V6Z M;  3GLI A;  3HU3 A;  1N75 A;  2KNA A;  4LY6 A;  4IBC A;  2DAG A;  2JUJ A;  3D8L A;  1R7R A;  2I7N A;  3ZH9 B;  4AKG A;  2LHG A;  3LVW A;  4Z6Y A;  1ORY B;  1Z5A A;  3L27 A;  1GL7 A;  3A42 A;  7CAT A;  2KEB A;  4DR6 M;  1Z59 A;  4IBG A;  3GLF B;  3GQ5 A;  1Y8G A;  1IY0 A;  2H5X A;  3MK6 A;  3PFI A;  5E6J A;  3I4Y A;  3KP0 E;  4PDI A;  2VQF M;  5IT9 S;  2BJV A;  4P16 A;  2P5T A;  3R8F A;  2Y2H A;  5ITT A;  2HAK A;  2LVQ D;  3C9P A;  1EAK A;  2JY8 A;  2OOA A;  2QSF X;  1NY5 A;  4GKK M;  2F5N A;  2DWN A;  4KT0 F;  4XBO A;  3SBJ A;  1OFI A;  1K3X A;  5FTM A;  4IBD A;  1L6J A;  3HX3 A;  3K1J A;  2CV2 A;  4RNA A;  2APL A;  3KOX E;  2ERC A;  3Q8G A;  3RE8 A;  4FD2 A;  4A3V B;  3GLF A;  4AKH A;  2GNO A;  3THG A;  4NYU A;  2KA6 B;  3LQR A;  2MJ5 B;  2K6B A;  3CTW B;  4REZ A;  3C3E A;  2JCH A;  4KOD A;  2B3T A;  4LJ4 A;  2MGW A;  4FWD A;  4D80 A;  3SAU A;  1MJG M;  3TL4 X;  4RF1 A;  1E8B A;  1C7Y A;  3GLG B;  2D7G A;  2L09 A;  3LMM A;  4LF6 M;  4DR7 M;  2LBC A;  2DAM A;  1SXJ B;  3GLI B;  4PCZ A;  3A46 A;  4JI6 M;  2F5P A;  5EJC A;  1N77 A;  4DV4 M;  4CIS A;  5KPZ A;  3E9S A;  2DWL A;  1E6R A;  2CP8 A;  2DNA A;  1E9R A;  3FTE A;  3GPY A;  1TDZ A;  2KW0 A;  2N35 A;  2BG1 A;  3WD2 A;  1XXH E;  1JB0 F;  4OJL A;  2EKF A;  4AQY M;  1HR0 M;  1IXS B;  1NSF A;  4Q7J A;  4AW4 A;  4IBF A;  1FJG M;  4WUR A;  1V92 A;  2C99 A;  3PNY A;  1DO2 A;  5A2Q S;  2MH8 A;  2VF7 A;  3GRY A;  2R45 A;  4B3S M;  5GKN A;  1SXJ E;  1GJT A;  3CF0 A;  3I01 M;  5E26 A;  3TWK A;  4CJ6 A;  1E15 A;  3FKE A;  3VDP A;  4JI7 M;  4RKU F;  3JR4 A;  3FUT A;  3VKG A;  4I81 A;  1N32 M;  1XB2 B;  3WD1 A;  3WHL A;  2Y2G A;  1L1T A;  4HMD A;  3PXG A;  4B7H A;  4ITQ A;  2Y2K A;  4NC6 A;  1OKS A;  3K92 A;  3KS4 A;  1ZMW A;  1NHG C;  4K0K M;  3A98 B;  1DGH B;  4II7 A;  3FRI A;  2F5Q A;  3GPP A;  1RU3 A;  2WSC F;  3FUU A;  4NOO B;  4Z2H A;  1E88 A;  1OQY A;  3AL0 C;  3AOE A;  3FE3 A;  4NZ1 A;  4F2L A;  1UFZ A;  1YUE A;  1HNZ M;  1NY6 A;  2CUZ A;  1H0G A;  3L29 A;  4LF8 M;  2CHG A;  4L78 A;  5C1B A;  4LJ7 A;  2VII A;  5EP2 A;  2Z3X A;  2X4A A;  2XFT A;  2Y20 A;  1H0I A;  1GJS A;  1UR8 A;  1YLA A;  2K9D A;  1IM2 A;  1ZMV A;  4NYY A;  2L7I A;  3E4R A;  1XXH B;  4LF4 M;  4LF7 M;  2JNH A;  2XFS A;  3U6S A;  1V34 A;  1Z5C A;  3GLH A;  1JR3 E;  2NQ8 C;  2G3Q A;  4KHP M;  3AFH A;  2C98 A;  1X37 A;  3LVV A;  1QO6 A;  4NRV A;  2Q2E B;  2KRU A;  5ITY A;  2Y2O A;  2QQ8 A;  2LVO C;  3QWL A;  3HHZ A;  4P17 A;  3U6M A;  2EO2 A;  1F4I A;  3HJQ A;  3I4V A;  1PJS A;  5KO3 A;  1N36 M;  2JY6 B;  2OO9 A;  1Z5B A;  3SAS A;  3FUX A;  2RGO A;  2G8L A;  2CV1 A;  4QOZ C;  1L2C A;  1WJ7 A;  4LF9 M;  4LG2 A;  3J2P B;  4L15 A;  4IBE A;  5EXS A;  3N3F A;  1TTE A;  2V5O A;  4M9X A;  4EIW A;  4B3M M;  3M0E A;  2LWX A;  2Y0Q A;  4I4L A;  4BLC A;  3U61 A;  2RKO A;  1ZV1 A;  1NJF A;  4G4R A;  2FOI C;  4FCV A;  4G4N A;  1E94 E;  1AIW A;  4QHT A;  3KFU G;  4LRT A;  2G5G X;  2AHM A;  1EIJ A;  1R2Y A;  4GKJ M;  2UUB M;  4CHT B;  2DZL A;  2O25 A;  3FTD A;  1QDT A;  2UUC M;  2IOU A;  4MH0 E;  2Y2P A;  4CIZ A;  3F92 A;  4JI8 M;  4GEW A;  4IBK A;  4B7G A;  4PD2 A;  5ITR A;  1VEK A;  1HQC A;  2CFO A;  1J09 A;  3UK6 A;  3LQQ A;  8CAT A;  4DR3 M;  2C96 A;  3U61 B;  2BJW A;  3E46 A;  3AJI B;  3QAU A;  3AV0 A;  4MB5 A;  4OJP A;  1EFU B;  1PJI A;  5EQT A;  1OIP A;  4HEO A;  4DUY M;  4Z2J A;  2MRO B;  5L8R F;  4CGY B;  4X62 M;  2JWS A;  3HZJ A;  4MB4 A;  1QAN A;  2QPA A;  1HNW M;  4AI6 A;  3CF6 E;  1YU1 A;  1QYR A;  3W0F A;  3VDU A;  3BBZ A;  5DYI A;  2LTU A;  1XWI A;  4GC5 A;  1GVN A;  2F5S A;  3VK8 A;  3HKP A;  2Y2I A;  2KHH A;  1BVS A;  1WGN A;  2OPF A;  3U6O A;  1YE9 A;  5EXP A;  3U6P A;  4AKI A;  4JYA M;  1PRB A;  1TH3 A;  2OQ4 A;  2V1U A;  1PDC A;  5JI3 E;  1NV9 A;  1VEG A;  2FS1 A;  4M9Z A;  3I04 M;  3SAV A;  1ED7 A;  3LCU A;  1N78 A;  3AOG A;  3LW5 F;  4B08 A;  3LCV B;  2R46 A;  2JP7 A;  1TF0 B;  4OJO A;  4HME A;  1AIP C;  5ITX E;  3W67 A;  2DAI A;  1QAQ A;  2XH9 A;  4WW0 A;  2E5L M;  4X66 M;  2R62 A;  2XGN A;  1L2D A;  3R9X B;  4LRS A;  4JI1 M;  1XNR M;  1OIZ A;  2UU9 M;  1OFH A;  1D2N A;  4JI2 M;  1WR1 B;  4HLQ A;  4LZZ A;  2VF8 A;  1G41 A;  2D7E A;  4LFC M;  5EP4 A;  3VLF B;  3U5Z B;  2FNA A;  3QYB A;  2R4J A;  4HL4 A;  3WD0 A;  4DV7 M;  5FTL A;  2QBY B;  1HT1 E;  2CHQ A;  4L6V 6;  4OVZ A;  4AG5 A;  3T1H M;  4OUI A;  4LFB M;  3OTO M;  1IN6 A;  4MB7 A;  5DFL A;  1K82 A;  2XD1 A;  2Y0T A;  2L6O A;  3GRV A;  5FTK A;  3L2A A;  4B7F A;  5IWA M;  1D0L A;  2H1R A;  2QCU A;  2DKL A;  3KSX A;  3ZCB B;  3PVS A;  2KNV A;  5KPT A;  1MN3 A;  1GAB A;  3M7G A;  2A5Y B;  4M9S A;  3M7P A;  2HKJ A;  2Z7J A;  3NBI A;  3U6L A;  2RRU A;  3U60 A;  2JA2 A;  2R18 A;  1NO1 A;  1IBK M;  2QBY A;  2UXD M;  3CF2 A;  2UXC M;  1GXD A;  1NVM A;  1J7K A;  1LTM A;  1QAO A;  4QOS A;  3AKZ A;  3U5Z A;  1IBL M;  3W0L B;  4L16 A;  2C5R A;  1GO5 A;  4IJF A;  3AOE C;  4LJ6 A;  4I8O A;  1MX0 A;  2Y2Q A;  4L4U A;  1DO0 A;  4JI5 M;  4LZJ A;  1HJP A;  3J27 B;  4UN2 B;  4NL4 H;  2FH0 A;  1SG9 A;  4I5S A;  2LVP C;  3SYK A;  1DV0 A;  2HHH M;  1XMQ M;  2C9O A;  3FYC A;  2L7H A;  4MM3 B;  4QHS A;  4R7G A;  1C1K A;  2EA0 A;  3DOA A;  1OJL A;  2R0I A;  1VG5 A;  3HJ8 A;  4DV5 M;  2O01 F;  4FWG A;  3B7N A;  5FTN A;  3FTF A;  3MHV C;  1QZM A;  2LH0 A;  1MU5 A;  2LVN C;  2WSF F;  3FUW A;  4KLN A;  3UMM A;  3GQ3 A;  2ZM6 M;  4DV0 M;  3L28 A;  2KZS A;  2YQZ A;  2DAE A;  3GLH E;  3HU1 A;  3HJS A;  3NWL A;  4F1I A;  4NRW A;  1IN7 A;  1WGL A;  3QYE A;  4G4O A;  1XC8 A;  1PM5 A;  1XNQ M;  1R5L A;  2ZBK B;  1HQY E;  2DI0 A;  3K2L A;  2D49 A;  2Y2M A;  3GLI E;  4M0D A;  5BR8 M;  3HY5 A;  4FW9 A;  1W1T A;  3WD4 A;  1E32 A;  2Z8Y M;  3DZD A;  3UJN A;  2F4V M;  2C9C A;  2ZTD A;  3HHX A;  4GMQ A;  2JY7 A;  3ILK A;  1E6P A;  5IZ7 D;  1GPF A;  4NZ5 A;  4MGY E;  3SAR A;  2DHY A;  2XF3 A;  4XK8 F;  2L2D A;  2HWJ A;  2UUA M;  3Q8X A;  5KQ8 A;  2KZU A;  1OTR A;  4R3D A;  4NSO B;  5BPV A;  3RGS A;  4JV5 M;  1IFY A;  3L25 A;  3KVW A;  2EJS A;  4KO8 A;  1IXR C;  1L8Q A;  1Q02 A;  2QP9 X;  2ZTC A;  3BOS A;  3KXE C;  5EXX A;  1AUA A;  3GP1 A;  4OJ5 A;  1W1P A;  2M5Z A;  3HWS A;  4BBA A;  1VQ1 A;  3KOZ E;  4X64 M;  1G3I A;  5F3W A;  3U6Q A;  1JR3 D;  1SXJ C;  3K9O A;  2KRK A;  3FD9 A;  1PJJ A;  2KDL A;  3UZU A;  3J80 S;  2FN2 A;  2YFQ A;  1IY2 A;  3TQS A;  4Z2L A;  2Z4S A;  4DUZ M;  2J5Y A;  3HHY A;  1YU0 A;  2XZU A;  2CWB A;  2CEA A;  3GLF E;  4TX8 A;  4G3O A;  5DYG A;  3U60 B;  3FYD A;  2DEN A;  3H4J A;  4DBG B;  2JXN A;  3KOW E;  3U6E A;  1L1Z A;  3GRU A;  2F5O A;  3HHW A;  4MGH A;  2JE5 A;  5ITQ A;  3T38 A;  1VEJ A;  4G6Z A;  4IBI A;  3ZQJ A;  1W1V A;  1OGB A;  2Y21 A;  3DFZ A;  4B3T M;  1VDL A;  3KP1 E;  2M60 A;  2QHO B;  4NY2 A;  3GRR A;  2FFJ A;  4AG6 A;  1QDR A;  1UR9 A;  1WXQ A;  1DGB A;  1G71 A;  2XLJ A;  4M0W A;  3B74 A;  2YR0 A;  2GQF A;  3B89 A;  1QUS A;  3SHG B; 
#chains in the Genus database with same CATH homology
 4FCT A;  5C18 A;  4B3R M;  1VDD A;  2Z4R A;  1KFV A;  1SXJ D;  2X49 A;  3H4M A;  4QNM A;  4DR2 M;  5ITX A;  4YHH M;  1N33 M;  1KYI A;  3EIH A;  4TUW A;  3GLH B;  2LNH C;  1H6U A;  1ZQ9 A;  4Z8X A;  2XZF A;  2XSZ A;  4LCB A;  2Y2L A;  1IBM M;  2QZ4 A;  2R4E A;  2YNM D;  1TGU A;  2CV0 A;  1E9S A;  1IN8 A;  2CE7 A;  2LXE A;  4AZF A;  1GLN A;  4IBB A;  1YU2 A;  4FWH A;  3KDS E;  2EUC A;  2HL7 A;  2I7P A;  1W5S A;  4GIT A;  5JI2 E;  1KSF X;  3JAM S;  1JR3 A;  4QNR A;  1DGH A;  1QQW A;  4S12 A;  2UWX A;  4LGY A;  4PDG A;  4LGM A;  3VFD A;  4FCW A;  2Y2J A;  5DNY A;  3SYL A;  1TDH A;  2O5R A;  4LJ8 A;  5EP3 A;  4NSR A;  5KPR A;  2R65 A;  3B9P A;  3SC3 A;  1ZAE A;  1QVR A;  3KSJ A;  5H37 D;  3HU2 A;  4NXN M;  2J7N A;  3T1Y M;  2UXB M;  5ITU A;  1S3S A;  3GQ4 A;  3I51 A;  2XD5 A;  2DHR A;  3J7A S;  1HNX M;  2XSZ D;  1GKI A;  2RGH A;  5KQD A;  4GC9 A;  5FLX S;  3SFZ A;  3U6D A;  1I4W A;  4IIW A;  1IN5 A;  4NZ4 A;  4QNL A;  1K3W A;  3VK7 A;  4IJE A;  1JQJ C;  2ZAM A;  1DGG A;  4YY3 M;  3VKH A;  4GH9 A;  2V1C A;  4LJ5 A;  1SXJ A;  3SMP A;  4IBJ A;  2K47 A;  4LJ9 A;  1QAM A;  4LFA M;  3GLG A;  3K8Z A;  2D7H A;  3T15 A;  1R2Z A;  3MJ5 A;  4GRI A;  1Z6T A;  3L26 A;  1IY1 A;  3IG5 A;  3TPZ A;  3UGJ A;  4GIP A;  4OU7 A;  2VQE M;  1FNN A;  1NHW C;  3FUV A;  2Y2N A;  1Q39 A;  2CHV A;  4D81 A;  2DZO B;  4D82 A;  3HSH A;  4L8R C;  2KXE A;  4X65 M;  3HGI A;  4JI3 M;  1NNJ A;  2DZN B;  4BB9 A;  3HON A;  5EXT A;  3DA1 A;  4XGI A;  4DR5 M;  2ZAN A;  3EIE A;  1LV7 A;  4NXM M;  1XHB A;  5FTJ A;  4OW0 A;  1TH2 A;  2XEP A;  1J5E M;  2BNK A;  4DV2 M;  4MGK E;  4JXJ A;  2ZAO A;  1XXH A;  4ZPX A;  3RGP A;  4OX9 M;  3RFW A;  4DV3 M;  2FFF B;  3KOY E;  3D8B A;  2J7O A;  3FTC A;  5LMU M;  2X8A A;  4DR1 M;  3KS8 A;  4OJ6 A;  1HT2 E;  2DVW B;  3IG8 A;  1YSY A;  5IRE B;  3GPU A;  4W5W A;  1NNU C;  4DV6 M;  3TWL A;  1W5T A;  4GHL A;  1UM8 A;  3U6C A;  2W82 A;  2DWZ B;  4JN6 A;  4NZ3 A;  1DGF A;  2HCB A;  3GPX A;  1TH4 A;  4GHA A;  3JR5 A;  2DWM A;  3WHK A;  5FSW A;  3SMS A;  1T3T A;  1Q3C A;  4FVM A;  4PT5 A;  3TE6 A;  1L2B A;  2FE8 A;  4JI4 M;  1YUB A;  4DV1 M;  3J81 S;  4MGI E;  3A45 A;  1GL6 A;  5LMN M;  1IQP A;  3M6A A;  1IXZ A;  3J7B A;  1YU3 A;  1EE8 A;  1IN4 A;  5EP1 A;  1G8P A;  1XMO M;  4DR4 M;  4LJA A;  4JI0 M;  3C58 A;  1NJG A;  1G59 A;  1G4A E;  2QEN A;  3GO8 A;  1N34 M;  1I94 M;  3PNV A;  4RF0 A;  4LF5 M;  3KW6 A;  3SHF A;  3SAT A;  1R6B X;  1YU4 A;  4MGZ E;  3SAW A;  2DXI A;  4G4Q A;  3WX7 A;  3TWM A;  3ZC7 B;  1Q3B A;  2V6Z M;  3GLI A;  3HU3 A;  1N75 A;  4LY6 A;  4IBC A;  3D8L A;  1R7R A;  2I7N A;  3ZH9 B;  4AKG A;  3LVW A;  4Z6Y A;  1ORY B;  1Z5A A;  3L27 A;  1GL7 A;  3A42 A;  7CAT A;  2KEB A;  4DR6 M;  1Z59 A;  4IBG A;  3GLF B;  3GQ5 A;  3PFI A;  1IY0 A;  3MK6 A;  5E6J A;  3I4Y A;  3KP0 E;  4PDI A;  2VQF M;  5IT9 S;  2BJV A;  4P16 A;  2P5T A;  3R8F A;  2Y2H A;  5ITT A;  1NY5 A;  4GKK M;  2F5N A;  2DWN A;  4XBO A;  3SBJ A;  1OFI A;  1K3X A;  5FTM A;  4IBD A;  3K1J A;  2CV2 A;  4RNA A;  3KOX E;  2ERC A;  3RE8 A;  4FD2 A;  4A3V B;  3GLF A;  4AKH A;  4NYU A;  3THG A;  2KA6 B;  3LQR A;  3CTW B;  4REZ A;  2JCH A;  4KOD A;  4LJ4 A;  4D80 A;  4FWD A;  3SAU A;  3TL4 X;  4RF1 A;  3GLG B;  2D7G A;  2L09 A;  3LMM A;  4LF6 M;  4DR7 M;  3GLI B;  1SXJ B;  4PCZ A;  3A46 A;  4JI6 M;  2F5P A;  5EJC A;  1N77 A;  4DV4 M;  4CIS A;  5KPZ A;  3E9S A;  2DWL A;  1E9R A;  3FTE A;  3GPY A;  1TDZ A;  2KW0 A;  2BG1 A;  4OJL A;  4AQY M;  1HR0 M;  1IXS B;  1NSF A;  4AW4 A;  4IBF A;  1FJG M;  4WUR A;  2C99 A;  3PNY A;  1DO2 A;  5A2Q S;  3GRY A;  2R45 A;  4B3S M;  5GKN A;  1SXJ E;  3CF0 A;  5E26 A;  3TWK A;  3FKE A;  3VDP A;  4JI7 M;  3JR4 A;  3FUT A;  3VKG A;  4I81 A;  1N32 M;  3WHL A;  2Y2G A;  1L1T A;  3PXG A;  4B7H A;  4ITQ A;  2Y2K A;  3K92 A;  3KS4 A;  1NHG C;  4K0K M;  3A98 B;  1DGH B;  4II7 A;  2F5Q A;  3GPP A;  3FUU A;  4NOO B;  3AL0 C;  3AOE A;  4NZ1 A;  1YUE A;  1HNZ M;  1NY6 A;  2CUZ A;  3L29 A;  4LF8 M;  2CHG A;  4L78 A;  4LJ7 A;  2VII A;  5EP2 A;  2Z3X A;  2X4A A;  2XFT A;  2Y20 A;  1IM2 A;  4NYY A;  2L7I A;  3E4R A;  1XXH B;  4LF4 M;  4LF7 M;  2XFS A;  3U6S A;  1Z5C A;  3GLH A;  4KHP M;  2NQ8 C;  3AFH A;  2C98 A;  1X37 A;  3LVV A;  4NRV A;  2Q2E B;  2KRU A;  5ITY A;  2Y2O A;  3QWL A;  3HHZ A;  3U6M A;  2EO2 A;  3HJQ A;  3I4V A;  1N36 M;  5KO3 A;  1Z5B A;  3SAS A;  3FUX A;  2RGO A;  2G8L A;  2CV1 A;  4QOZ C;  1L2C A;  4LF9 M;  4LG2 A;  3J2P B;  4L15 A;  4IBE A;  5EXS A;  3N3F A;  4M9X A;  4EIW A;  4B3M M;  3M0E A;  2LWX A;  2Y0Q A;  4I4L A;  4BLC A;  3U61 A;  2RKO A;  1NJF A;  4G4R A;  2FOI C;  4FCV A;  4G4N A;  1E94 E;  4QHT A;  3KFU G;  4LRT A;  2G5G X;  2AHM A;  1R2Y A;  4GKJ M;  2UUB M;  4CHT B;  3FTD A;  2UUC M;  2IOU A;  4MH0 E;  2Y2P A;  4JI8 M;  4B7G A;  4IBK A;  4PD2 A;  5ITR A;  1HQC A;  2CFO A;  1J09 A;  3UK6 A;  3LQQ A;  8CAT A;  4DR3 M;  2C96 A;  3U61 B;  2BJW A;  3AJI B;  3QAU A;  3AV0 A;  4OJP A;  1PJI A;  5EQT A;  4DUY M;  4CGY B;  4X62 M;  1QAN A;  2QPA A;  1HNW M;  4AI6 A;  3CF6 E;  1YU1 A;  1QYR A;  3W0F A;  3VDU A;  5DYI A;  1XWI A;  4GC5 A;  1GVN A;  2F5S A;  3VK8 A;  3HKP A;  2Y2I A;  3U6O A;  2OPF A;  1YE9 A;  5EXP A;  3U6P A;  4AKI A;  4JYA M;  2V1U A;  1TH3 A;  2OQ4 A;  5JI3 E;  4M9Z A;  3SAV A;  1N78 A;  3AOG A;  4B08 A;  2R46 A;  4OJO A;  5ITX E;  1QAQ A;  2XH9 A;  4WW0 A;  2E5L M;  4X66 M;  2R62 A;  2XGN A;  1L2D A;  3R9X B;  4LRS A;  4JI1 M;  1XNR M;  2UU9 M;  1D2N A;  1OFH A;  4JI2 M;  4HLQ A;  4LZZ A;  1G41 A;  2D7E A;  4LFC M;  5EP4 A;  3VLF B;  3U5Z B;  2FNA A;  4HL4 A;  2R4J A;  4DV7 M;  5FTL A;  2QBY B;  1HT1 E;  2CHQ A;  4OVZ A;  4AG5 A;  3T1H M;  4OUI A;  4LFB M;  3OTO M;  1IN6 A;  4MB7 A;  1K82 A;  2XD1 A;  2Y0T A;  2L6O A;  3GRV A;  5FTK A;  3L2A A;  4B7F A;  5IWA M;  2QCU A;  2H1R A;  3KSX A;  3ZCB B;  3PVS A;  5KPT A;  3M7G A;  2A5Y B;  4M9S A;  2HKJ A;  2Z7J A;  3NBI A;  3U6L A;  3U60 A;  2JA2 A;  2R18 A;  1IBK M;  2QBY A;  2UXD M;  3CF2 A;  2UXC M;  1NVM A;  1J7K A;  1QAO A;  4QOS A;  3AKZ A;  3U5Z A;  1IBL M;  3W0L B;  4L16 A;  2C5R A;  4IJF A;  3AOE C;  4LJ6 A;  4I8O A;  1MX0 A;  2Y2Q A;  4L4U A;  1DO0 A;  4JI5 M;  4LZJ A;  3J27 B;  4NL4 H;  4I5S A;  3SYK A;  2HHH M;  1XMQ M;  2C9O A;  3FYC A;  2L7H A;  4MM3 B;  4QHS A;  4R7G A;  1C1K A;  2EA0 A;  3DOA A;  1OJL A;  3HJ8 A;  4DV5 M;  4FWG A;  5FTN A;  3FTF A;  3MHV C;  1QZM A;  2LH0 A;  1MU5 A;  3FUW A;  4KLN A;  3GQ3 A;  3UMM A;  2ZM6 M;  4DV0 M;  3L28 A;  2KZS A;  2YQZ A;  3NWL A;  4NRW A;  3HU1 A;  3HJS A;  1IN7 A;  4G4O A;  1XNQ M;  1PM5 A;  1XC8 A;  2ZBK B;  3K2L A;  1HQY E;  2Y2M A;  4M0D A;  5BR8 M;  4FW9 A;  1E32 A;  3DZD A;  3UJN A;  2F4V M;  2C9C A;  3HHX A;  4GMQ A;  4NZ5 A;  3ILK A;  5IZ7 D;  4MGY E;  3SAR A;  2XF3 A;  2UUA M;  3Q8X A;  5KQ8 A;  2KZU A;  4R3D A;  4NSO B;  5BPV A;  3RGS A;  4JV5 M;  3L25 A;  3KVW A;  4KO8 A;  1IXR C;  1L8Q A;  2QP9 X;  3BOS A;  5EXX A;  3KXE C;  3GP1 A;  4OJ5 A;  2M5Z A;  3HWS A;  4BBA A;  3KOZ E;  4X64 M;  5F3W A;  1G3I A;  3U6Q A;  1SXJ C;  1JR3 D;  2KRK A;  3FD9 A;  1PJJ A;  3UZU A;  3J80 S;  2YFQ A;  1IY2 A;  3TQS A;  2Z4S A;  4DUZ M;  3HHY A;  1YU0 A;  2XZU A;  2CEA A;  5DYG A;  3U60 B;  3FYD A;  3U6E A;  1L1Z A;  2F5O A;  3KOW E;  3GRU A;  3HHW A;  4MGH A;  2JE5 A;  5ITQ A;  3T38 A;  4G6Z A;  4IBI A;  2Y21 A;  3DFZ A;  4B3T M;  3KP1 E;  2M60 A;  4NY2 A;  3GRR A;  2FFJ A;  4AG6 A;  1WXQ A;  1DGB A;  2XLJ A;  4M0W A;  2YR0 A;  4OVZ B;  5C1B A;  3SHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...