4GHJA

1.75 angstrom crystal structure of transcriptional regulator ftom vibrio vulnificus.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
KHVTAAALAEEIGDRLKQARLNRDLTQSEVAEIAGIARKTVLNAEKGKVQLDIMIAILMALDLTEQIDLFIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.75 Angstrom Crystal Structure of Transcriptional Regulator ftom Vibrio vulnificus.
rcsb
source organism Vibrio vulnificus
molecule tags Transcription
molecule keywords Probable transcriptional regulator
total genus 22
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4ghjA00
1R69A 3PXPA 2EBYA 1POUA 1IC8A 3ZHIA 3QF3A 4PU4C 3VK0A 3F51A 3R1FA 2LYLA 4O8BA 3OQNA 2FJRA 2BJCA 2B5AA 2AWIA 4PU8A 1CJGA 1JFSA 1RPEL 2CSFA 2O4AA 1ADRA 2LYQA 4I6RA 1QQAA 1ZZ6A 2KEIA 2OR1L 3H5TA 2XCJA 1PNRA 4IWRA 2ICPA 3B7HA 2XSDC 1QQBA 2KPJA 1LQCA 2MQKA 4X4HA 1OSLA 2JVLA 2XJ3A 1RZRA 3ZHMA 3QQ6A 2IV1A 4J1XA 1ZZ7A 3HZIB 1YSEA 5A7LA 4I6UA 4YG7B 1ZZBA 3G5GA 3FYMA 2XI8A 4F8DA 3CROL 1UXDA 3MLFA 2AXUA 2CROA 3SCGA 3L1PA 3OQOA 2L8NA 2PUEA 2A6CA 3OQMA 3U3WA 1O4XA 4MCTA 5K98B 1WETA 2LYRA 3UFDA 3GN5A 2GRLA 3BS3A 1OCTC 4I6TA 1ZS4A 1PRVA 2LYPA 2IVQA 2AXZA 2AUWA 2R63A 4NDWA 4OB4A 1WH6A 3ZKCA 3QYXA 3QWGA 2PIJA 2XIUA 2GRMA 2D5VA 2PUGA 2HINA 1B0NA 2LYSA 2KEJA 3DNVB 2PUDA 3KXAA 1XWRA 1PRUA 4Z58A 2IVGA 1S7EA 4GQMA 1Y9QA 1DW9A 2IUOA 1JH9A 1LMB3 3GBFA 1WIZA 2PPXA 3SCFA 2O49A 2IU7A 2PUCA 1QP4A 1RIOA 1ZZCA 1X2LA 2EF8A 2EWTA 3SCHA 4YG4A 1JWLA 4MCXA 1LCCA 1ZZ9A 2OFYA 4Y42A 2HSGA 4X4EA 2WUSR 2LCVA 1LCDA 2H8RA 3OMTA 1BDIA 3CLCA 1Y7YA 1ZUGA 4JCXA 3JXCL 3D1NI 2MEZA 1ZVVA 3CECA 1UTXA 4X4CA 2PUFA 4X4BA 2O38A 2LYJA 4X4GA 1L1MA 1VPWA 1NERA 1X57A 4GHJA 1QPZA 1ZAYA 2IVBA 4Z5HA 2JCGA 1E3OC 1ZZ8A 2AW6A 3KJXA 1HF0A 2GZUA 3RZZA 4Z5CA 4YARA 4YG1A 2BNMA 3S8QA 1JFTA 2ICTA 1QP0A 4PU3C 3JXDL 1LLIA 1DWKA 4FN3A 3G7DA 2PE5A 3GN5B 3OP9A 4FBIA 2L49A 4Z59A 3TRBA 1CQTA 1NEQA 1RZRD 3JXBC 1EFAA 1UXCA 3FMYA 1SQ8A 3KZ3A 2PUBA 1WH8A 4IA8A 3EUSA 4Z5DA 4J1WA 4JQDA 3FYAA 4PU7A 2AXVA 2LYKA 1QP7A 3F52A 3F6WA 4JCYA 3LFPA 4X4DA 1BDHA 1ZPQA 3O9XA 3IVPA 4I8TA 1R63A 2BNOA 1AU7A 3BD1A 2R1JL 3BDNA 3LISA 2WIUB 1PERL 4X4IA 2PUAA 2KEKA 1RZSA 4YBAA 1PRAA 4X4FA 2BNNA 1GT0C 2KZ8A 4IVZA
chains in the Genus database with same CATH superfamily
5DRYA 2MXDA 3R1FA 3OQNA 3A9YA 4PU8A 2V3CC 1CJGA 1ADRA 2LYQA 3GUUA 3GZDC 3H5TA 2XCJA 4ER7A 2ICPA 2XXPA 3ME5A 3OKZA 1QB2A 4I6UA 3G5GA 3MLFA 2AXUA 3L1PA 5DTQA 2GRLA 1OCTC 4I6TA 2LYPA 2AXZA 4OB4A 3QWGA 1B0NA 2LYSA 2KEJA 3QFIA 2PXLA 4GQMA 1DULA 2IUOA 1LMB3 4Q2JA 2O49A 2IU7A 1ZZCA 1LCCA 2OFYA 4X4EA 4HRAA 4JCXA 3JXCL 3D1NI 4X4CA 4EK9A 2PUFA 5DSXA 4X4BA 1QPZA 5GAGi 1E3OC 3UWPA 2GZUA 3RZZA 3SX0A 4ER0A 3JXDL 3G7DA 3NZLA 4EKGA 1NEQA 1RZRD 1EFAA 1UXCA 1WH8A 4JQDA 2LYKA 1BDHA 3NDBB 1AU7A 3R09A 3BDNA 2WIUB 2LNMA 1PERL 2PUAA 1RZSA 4YBAA 4IVZA 2YBDA 1POUA 1IC8A 4PU4C 3F51A 2FJRA 2BJCA 2J7WA 3QOWA 4I6RA 4ER5A 1QQAA 2KEIA 2ODRD 3B7HA 2JVLA 3QQ6A 2IV1A 4J1XA 3HZIB 1YSEA 5A7LA 1ZZBA 3FYMA 4F8DA 2CROA 3SCGA 3OQMA 1O4XA 5K98B 2LYRA 1PRVA 2LLVA 3QYXA 3SR4A 3TEPA 2XIUA 2PXUA 2PUGA 2PUDA 1XWRA 4Z58A 1Y9QA 1DW9A 2HCNA 2PPXA 3SCFA 1RIOA 4YG4A 1JWLA 3SCHA 3GZDA 2FFHA 1LCDA 2PXTA 4DE8A 2MEZA 5DTRA 1UTXA 1X57A 2IVBA 3KJXA 2AW6A 1HF0A 3OWQA 4YARA 4YG1A 3KL4A 4PU3C 4FN3A 3GN5B 4FBIA 4EQZA 1SQ8A 3KZ3A 4IA8A 4Z5DA 2AXVA 1QP7A 3F6WA 4X4DA 1ZPQA 3O9XA 2BNOA 3ZPXA 3NROA 2KEKA 4X4FA 4WVLA 3TELA 5DRTA 2EBYA 3ZHIA 2LYLA 5GAHi 2XXQA 2B5AA 2AWIA 2VEOA 1RPEL 1ZZ6A 2OR1L 3LQXA 1QQBA 2KPJA 2PXKA 1LQCA 2MQKA 4X4HA 3ZHMA 4YG7B 2PXBA 4EZIA 2PUEA 4MCTA 3GN5A 2IVQA 2AUWA 1WH6A 3ZKCA 2HCSA 2PIJA 2HINA 3DNVB 3KXAA 1MFQC 1S7EA 1HQ1A 2PUCA 1QP4A 2JQEA 3A9XA 4MCXA 4Y42A 2WUSR 2H8RA 3TFLA 3CLCA 3OMTA 2LLWA 1Y7YA 1ZUGA 1ZVVA 2PXQA 2O38A 4X4GA 1VPWA 3NXHA 1NERA 3QOXA 1ZAYA 2JCGA 1ZZ8A 3G0TA 2BNMA 3S8QA 1JFTA 1QP0A 1LLIA 4ER3A 1DWKA 3OP9A 2L49A 4Z59A 3TRBA 1CQTA 3JXBC 2PXEA 2PXFA 3FMYA 3EUSA 3F52A 2L1PA 1R63A 3BD1A 2R1JL 3LISA 1PRAA 2PXVA 1R69A 3PXPA 5DTMA 3QF3A 1U2ZA 2XXAA 3VK0A 4ER6A 4O8BA 2M4HA 1NW3A 1JFSA 2O4AA 2CSFA 1PNRA 4IWRA 2XSDC 1OSLA 2XJ3A 1RZRA 2PXPA 1ZZ7A 2XI8A 3CROL 1UXDA 3OQOA 2L8NA 2A6CA 3U3WA 1WETA 3UFDA 3BS3A 1ZS4A 2J7UA 3M9LA 2R63A 4NDWA 4OBMA 5JUWA 2HFZA 2GRMA 2D5VA 1PRUA 4EKIA 2IVGA 3VWSA 3A9ZA 1JH9A 3GBFA 1WIZA 1X2LA 2EF8A 2PXDA 2EWTA 1ZZ9A 2HSGA 2LCVA 1BDIA 3PE5A 3CECA 2LYJA 1L1MA 3MEJA 4GHJA 4Z5HA 4Z5CA 4DE9A 2ICTA 2PE5A 5DT2A 3DM5A 2PUBA 4J1WA 3FYAA 4PU7A 4JCYA 3LFPA 1QZXA 3IVPA 4I8TA 3GZCA 4X4IA 2BNNA 1GT0C 2KZ8A
chains in the Genus database with same CATH topology
1R69A 3PXPA 2EBYA 1POUA 1IC8A 3ZHIA 3QF3A 4PU4C 3VK0A 3F51A 3R1FA 2LYLA 4O8BA 3OQNA 2FJRA 2BJCA 2B5AA 2AWIA 4PU8A 1CJGA 1JFSA 1RPEL 2CSFA 2O4AA 1ADRA 2LYQA 4I6RA 1QQAA 1ZZ6A 2KEIA 2OR1L 3H5TA 2XCJA 1PNRA 4IWRA 2ICPA 3B7HA 2XSDC 1QQBA 2KPJA 1LQCA 2MQKA 4X4HA 1OSLA 2JVLA 2XJ3A 1RZRA 3ZHMA 3QQ6A 2IV1A 4J1XA 1ZZ7A 3HZIB 1YSEA 5A7LA 4I6UA 4YG7B 1ZZBA 3G5GA 3FYMA 2XI8A 4F8DA 3CROL 1UXDA 3MLFA 2AXUA 2CROA 3SCGA 3L1PA 3OQOA 2L8NA 2PUEA 2A6CA 3OQMA 3U3WA 1O4XA 4MCTA 5K98B 1WETA 2LYRA 3UFDA 3GN5A 2GRLA 3BS3A 1OCTC 4I6TA 1ZS4A 1PRVA 2LYPA 2IVQA 2AXZA 2AUWA 2R63A 4NDWA 4OB4A 1WH6A 3ZKCA 3QYXA 3QWGA 2PIJA 2XIUA 2GRMA 2D5VA 2PUGA 2HINA 1B0NA 2LYSA 2KEJA 3DNVB 2PUDA 3KXAA 1XWRA 1PRUA 4Z58A 2IVGA 1S7EA 4GQMA 1Y9QA 1DW9A 2IUOA 1JH9A 1LMB3 3GBFA 1WIZA 2PPXA 3SCFA 2O49A 2IU7A 2PUCA 1QP4A 1RIOA 1ZZCA 1X2LA 2EF8A 2EWTA 3SCHA 4YG4A 1JWLA 4MCXA 1LCCA 1ZZ9A 2OFYA 4Y42A 2HSGA 4X4EA 2WUSR 2LCVA 1LCDA 2H8RA 3OMTA 1BDIA 3CLCA 1Y7YA 1ZUGA 4JCXA 3JXCL 3D1NI 2MEZA 1ZVVA 3CECA 1UTXA 4X4CA 2PUFA 4X4BA 2O38A 2LYJA 4X4GA 1L1MA 1VPWA 1NERA 1X57A 4GHJA 1QPZA 1ZAYA 2IVBA 4Z5HA 2JCGA 1E3OC 1ZZ8A 2AW6A 3KJXA 1HF0A 2GZUA 3RZZA 4Z5CA 4YARA 4YG1A 2BNMA 3S8QA 1JFTA 2ICTA 1QP0A 4PU3C 3JXDL 1LLIA 1DWKA 4FN3A 3G7DA 2PE5A 3GN5B 3OP9A 4FBIA 2L49A 4Z59A 3TRBA 1CQTA 1NEQA 1RZRD 3JXBC 1EFAA 1UXCA 3FMYA 1SQ8A 3KZ3A 2PUBA 1WH8A 4IA8A 3EUSA 4Z5DA 4J1WA 4JQDA 3FYAA 4PU7A 2AXVA 2LYKA 1QP7A 3F52A 3F6WA 4JCYA 3LFPA 4X4DA 1BDHA 1ZPQA 3O9XA 3IVPA 4I8TA 1R63A 2BNOA 1AU7A 3BD1A 2R1JL 3BDNA 3LISA 2WIUB 1PERL 4X4IA 2PUAA 2KEKA 1RZSA 4YBAA 1PRAA 4X4FA 2BNNA 1GT0C 2KZ8A 4IVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R69 A;  3PXP A;  2EBY A;  1POU A;  1IC8 A;  3ZHI A;  3QF3 A;  4PU4 C;  3VK0 A;  3F51 A;  3R1F A;  2LYL A;  4O8B A;  3OQN A;  2FJR A;  2BJC A;  2B5A A;  2AWI A;  4PU8 A;  1CJG A;  1JFS A;  1RPE L;  2CSF A;  2O4A A;  1ADR A;  2LYQ A;  4I6R A;  1QQA A;  1ZZ6 A;  2KEI A;  2OR1 L;  3H5T A;  2XCJ A;  1PNR A;  4IWR A;  2ICP A;  3B7H A;  2XSD C;  1QQB A;  2KPJ A;  1LQC A;  2MQK A;  4X4H A;  1OSL A;  2JVL A;  2XJ3 A;  1RZR A;  3ZHM A;  3QQ6 A;  2IV1 A;  4J1X A;  1ZZ7 A;  3HZI B;  1YSE A;  5A7L A;  4I6U A;  4YG7 B;  1ZZB A;  3G5G A;  3FYM A;  2XI8 A;  4F8D A;  3CRO L;  1UXD A;  3MLF A;  2AXU A;  2CRO A;  3SCG A;  3L1P A;  3OQO A;  2L8N A;  2PUE A;  2A6C A;  3OQM A;  3U3W A;  1O4X A;  4MCT A;  5K98 B;  1WET A;  2LYR A;  3UFD A;  3GN5 A;  2GRL A;  3BS3 A;  1OCT C;  4I6T A;  1ZS4 A;  1PRV A;  2LYP A;  2IVQ A;  2AXZ A;  2AUW A;  2R63 A;  4NDW A;  4OB4 A;  1WH6 A;  3ZKC A;  3QYX A;  3QWG A;  2PIJ A;  2XIU A;  2GRM A;  2D5V A;  2PUG A;  2HIN A;  1B0N A;  2LYS A;  2KEJ A;  3DNV B;  2PUD A;  3KXA A;  1XWR A;  1PRU A;  4Z58 A;  2IVG A;  1S7E A;  4GQM A;  1Y9Q A;  1DW9 A;  2IUO A;  1JH9 A;  1LMB 3;  3GBF A;  1WIZ A;  2PPX A;  3SCF A;  2O49 A;  2IU7 A;  2PUC A;  1QP4 A;  1RIO A;  1ZZC A;  1X2L A;  2EF8 A;  2EWT A;  3SCH A;  4YG4 A;  1JWL A;  4MCX A;  1LCC A;  1ZZ9 A;  2OFY A;  4Y42 A;  2HSG A;  4X4E A;  2WUS R;  2LCV A;  1LCD A;  2H8R A;  3OMT A;  1BDI A;  3CLC A;  1Y7Y A;  1ZUG A;  4JCX A;  3JXC L;  3D1N I;  2MEZ A;  1ZVV A;  3CEC A;  1UTX A;  4X4C A;  2PUF A;  4X4B A;  2O38 A;  2LYJ A;  4X4G A;  1L1M A;  1VPW A;  1NER A;  1X57 A;  4GHJ A;  1QPZ A;  1ZAY A;  2IVB A;  4Z5H A;  2JCG A;  1E3O C;  1ZZ8 A;  2AW6 A;  3KJX A;  1HF0 A;  2GZU A;  3RZZ A;  4Z5C A;  4YAR A;  4YG1 A;  2BNM A;  3S8Q A;  1JFT A;  2ICT A;  1QP0 A;  4PU3 C;  3JXD L;  1LLI A;  1DWK A;  4FN3 A;  3G7D A;  2PE5 A;  3GN5 B;  3OP9 A;  4FBI A;  2L49 A;  4Z59 A;  3TRB A;  1CQT A;  1NEQ A;  1RZR D;  3JXB C;  1EFA A;  1UXC A;  3FMY A;  1SQ8 A;  3KZ3 A;  2PUB A;  1WH8 A;  4IA8 A;  3EUS A;  4Z5D A;  4J1W A;  4JQD A;  3FYA A;  4PU7 A;  2AXV A;  2LYK A;  1QP7 A;  3F52 A;  3F6W A;  4JCY A;  3LFP A;  4X4D A;  1BDH A;  1ZPQ A;  3O9X A;  3IVP A;  4I8T A;  1R63 A;  2BNO A;  1AU7 A;  3BD1 A;  2R1J L;  3BDN A;  3LIS A;  2WIU B;  1PER L;  4X4I A;  2PUA A;  2KEK A;  1RZS A;  4YBA A;  1PRA A;  4X4F A;  2BNN A;  1GT0 C;  2KZ8 A;  4IVZ A; 
#chains in the Genus database with same CATH topology
 5DRY A;  2MXD A;  3R1F A;  3OQN A;  3A9Y A;  4PU8 A;  2V3C C;  1CJG A;  1ADR A;  2LYQ A;  3GUU A;  3GZD C;  3H5T A;  2XCJ A;  4ER7 A;  2ICP A;  2XXP A;  3ME5 A;  3OKZ A;  1QB2 A;  4I6U A;  3G5G A;  3MLF A;  2AXU A;  3L1P A;  5DTQ A;  2GRL A;  1OCT C;  4I6T A;  2LYP A;  2AXZ A;  4OB4 A;  3QWG A;  1B0N A;  2LYS A;  2KEJ A;  3QFI A;  2PXL A;  4GQM A;  1DUL A;  2IUO A;  1LMB 3;  4Q2J A;  2O49 A;  2IU7 A;  1ZZC A;  1LCC A;  2OFY A;  4X4E A;  4HRA A;  4JCX A;  3JXC L;  3D1N I;  4X4C A;  4EK9 A;  2PUF A;  5DSX A;  4X4B A;  1QPZ A;  5GAG i;  1E3O C;  3UWP A;  2GZU A;  3RZZ A;  3SX0 A;  4ER0 A;  3JXD L;  3G7D A;  3NZL A;  4EKG A;  1NEQ A;  1RZR D;  1EFA A;  1UXC A;  1WH8 A;  4JQD A;  2LYK A;  1BDH A;  3NDB B;  1AU7 A;  3R09 A;  3BDN A;  2WIU B;  2LNM A;  1PER L;  2PUA A;  1RZS A;  4YBA A;  4IVZ A;  2YBD A;  1POU A;  1IC8 A;  4PU4 C;  3F51 A;  2FJR A;  2BJC A;  2J7W A;  3QOW A;  4I6R A;  4ER5 A;  1QQA A;  2KEI A;  2ODR D;  3B7H A;  2JVL A;  3QQ6 A;  2IV1 A;  4J1X A;  3HZI B;  1YSE A;  5A7L A;  1ZZB A;  3FYM A;  4F8D A;  2CRO A;  3SCG A;  3OQM A;  1O4X A;  5K98 B;  2LYR A;  1PRV A;  2LLV A;  3QYX A;  3SR4 A;  3TEP A;  2XIU A;  2PXU A;  2PUG A;  2PUD A;  1XWR A;  4Z58 A;  1Y9Q A;  1DW9 A;  2HCN A;  2PPX A;  3SCF A;  1RIO A;  4YG4 A;  1JWL A;  3SCH A;  3GZD A;  2FFH A;  1LCD A;  2PXT A;  4DE8 A;  2MEZ A;  5DTR A;  1UTX A;  1X57 A;  2IVB A;  3KJX A;  2AW6 A;  1HF0 A;  3OWQ A;  4YAR A;  4YG1 A;  3KL4 A;  4PU3 C;  4FN3 A;  3GN5 B;  4FBI A;  4EQZ A;  1SQ8 A;  3KZ3 A;  4IA8 A;  4Z5D A;  2AXV A;  1QP7 A;  3F6W A;  4X4D A;  1ZPQ A;  3O9X A;  2BNO A;  3ZPX A;  3NRO A;  2KEK A;  4X4F A;  4WVL A;  3TEL A;  5DRT A;  2EBY A;  3ZHI A;  2LYL A;  5GAH i;  2XXQ A;  2B5A A;  2AWI A;  2VEO A;  1RPE L;  1ZZ6 A;  2OR1 L;  3LQX A;  1QQB A;  2KPJ A;  2PXK A;  1LQC A;  2MQK A;  4X4H A;  3ZHM A;  4YG7 B;  2PXB A;  4EZI A;  2PUE A;  4MCT A;  3GN5 A;  2IVQ A;  2AUW A;  1WH6 A;  3ZKC A;  2HCS A;  2PIJ A;  2HIN A;  3DNV B;  3KXA A;  1MFQ C;  1S7E A;  1HQ1 A;  2PUC A;  1QP4 A;  2JQE A;  3A9X A;  4MCX A;  4Y42 A;  2WUS R;  2H8R A;  3TFL A;  3CLC A;  3OMT A;  2LLW A;  1Y7Y A;  1ZUG A;  1ZVV A;  2PXQ A;  2O38 A;  4X4G A;  1VPW A;  3NXH A;  1NER A;  3QOX A;  1ZAY A;  2JCG A;  1ZZ8 A;  3G0T A;  2BNM A;  3S8Q A;  1JFT A;  1QP0 A;  1LLI A;  4ER3 A;  1DWK A;  3OP9 A;  2L49 A;  4Z59 A;  3TRB A;  1CQT A;  3JXB C;  2PXE A;  2PXF A;  3FMY A;  3EUS A;  3F52 A;  2L1P A;  1R63 A;  3BD1 A;  2R1J L;  3LIS A;  1PRA A;  2PXV A;  1R69 A;  3PXP A;  5DTM A;  3QF3 A;  1U2Z A;  2XXA A;  3VK0 A;  4ER6 A;  4O8B A;  2M4H A;  1NW3 A;  1JFS A;  2O4A A;  2CSF A;  1PNR A;  4IWR A;  2XSD C;  1OSL A;  2XJ3 A;  1RZR A;  2PXP A;  1ZZ7 A;  2XI8 A;  3CRO L;  1UXD A;  3OQO A;  2L8N A;  2A6C A;  3U3W A;  1WET A;  3UFD A;  3BS3 A;  1ZS4 A;  2J7U A;  3M9L A;  2R63 A;  4NDW A;  4OBM A;  5JUW A;  2HFZ A;  2GRM A;  2D5V A;  1PRU A;  4EKI A;  2IVG A;  3VWS A;  3A9Z A;  1JH9 A;  3GBF A;  1WIZ A;  1X2L A;  2EF8 A;  2PXD A;  2EWT A;  1ZZ9 A;  2HSG A;  2LCV A;  1BDI A;  3PE5 A;  3CEC A;  2LYJ A;  1L1M A;  3MEJ A;  4GHJ A;  4Z5H A;  4Z5C A;  4DE9 A;  2ICT A;  2PE5 A;  5DT2 A;  3DM5 A;  2PUB A;  4J1W A;  3FYA A;  4PU7 A;  4JCY A;  3LFP A;  1QZX A;  3IVP A;  4I8T A;  3GZC A;  4X4I A;  2BNN A;  1GT0 C;  2KZ8 A; 
#chains in the Genus database with same CATH homology
 1R69 A;  3PXP A;  2EBY A;  1POU A;  1IC8 A;  3ZHI A;  3QF3 A;  4PU4 C;  3VK0 A;  3F51 A;  3R1F A;  2LYL A;  4O8B A;  3OQN A;  2FJR A;  2BJC A;  2B5A A;  2AWI A;  4PU8 A;  1CJG A;  1JFS A;  1RPE L;  2CSF A;  2O4A A;  1ADR A;  2LYQ A;  4I6R A;  1QQA A;  1ZZ6 A;  2KEI A;  2OR1 L;  3H5T A;  2XCJ A;  1PNR A;  4IWR A;  2ICP A;  3B7H A;  2XSD C;  1QQB A;  2KPJ A;  1LQC A;  2MQK A;  4X4H A;  1OSL A;  2JVL A;  2XJ3 A;  1RZR A;  3ZHM A;  3QQ6 A;  2IV1 A;  4J1X A;  1ZZ7 A;  3HZI B;  1YSE A;  5A7L A;  4I6U A;  4YG7 B;  1ZZB A;  3G5G A;  3FYM A;  2XI8 A;  4F8D A;  3CRO L;  1UXD A;  3MLF A;  2AXU A;  2CRO A;  3SCG A;  3L1P A;  3OQO A;  2L8N A;  2PUE A;  2A6C A;  3OQM A;  3U3W A;  1O4X A;  4MCT A;  5K98 B;  1WET A;  2LYR A;  3UFD A;  3GN5 A;  2GRL A;  3BS3 A;  1OCT C;  4I6T A;  1ZS4 A;  1PRV A;  2LYP A;  2IVQ A;  2AXZ A;  2AUW A;  2R63 A;  4NDW A;  4OB4 A;  1WH6 A;  3ZKC A;  3QYX A;  3QWG A;  2PIJ A;  2XIU A;  2GRM A;  2D5V A;  2PUG A;  2HIN A;  1B0N A;  2LYS A;  2KEJ A;  3DNV B;  2PUD A;  3KXA A;  1XWR A;  1PRU A;  4Z58 A;  2IVG A;  1S7E A;  4GQM A;  1Y9Q A;  1DW9 A;  2IUO A;  1JH9 A;  1LMB 3;  3GBF A;  1WIZ A;  2PPX A;  3SCF A;  2O49 A;  2IU7 A;  2PUC A;  1QP4 A;  1RIO A;  1ZZC A;  1X2L A;  2EF8 A;  2EWT A;  3SCH A;  4YG4 A;  1JWL A;  4MCX A;  1LCC A;  1ZZ9 A;  2OFY A;  4Y42 A;  2HSG A;  4X4E A;  2WUS R;  2LCV A;  1LCD A;  2H8R A;  3OMT A;  1BDI A;  3CLC A;  1Y7Y A;  1ZUG A;  4JCX A;  3JXC L;  3D1N I;  2MEZ A;  1ZVV A;  3CEC A;  1UTX A;  4X4C A;  2PUF A;  4X4B A;  2O38 A;  2LYJ A;  4X4G A;  1L1M A;  1VPW A;  1NER A;  1X57 A;  4GHJ A;  1QPZ A;  1ZAY A;  2IVB A;  4Z5H A;  2JCG A;  1E3O C;  1ZZ8 A;  2AW6 A;  3KJX A;  1HF0 A;  2GZU A;  3RZZ A;  4Z5C A;  4YAR A;  4YG1 A;  2BNM A;  3S8Q A;  1JFT A;  2ICT A;  1QP0 A;  4PU3 C;  3JXD L;  1LLI A;  1DWK A;  4FN3 A;  3G7D A;  2PE5 A;  3GN5 B;  3OP9 A;  4FBI A;  2L49 A;  4Z59 A;  3TRB A;  1CQT A;  1NEQ A;  1RZR D;  3JXB C;  1EFA A;  1UXC A;  3FMY A;  1SQ8 A;  3KZ3 A;  2PUB A;  1WH8 A;  4IA8 A;  3EUS A;  4Z5D A;  4J1W A;  4JQD A;  3FYA A;  4PU7 A;  2AXV A;  2LYK A;  1QP7 A;  3F52 A;  3F6W A;  4JCY A;  3LFP A;  4X4D A;  1BDH A;  1ZPQ A;  3O9X A;  3IVP A;  4I8T A;  1R63 A;  2BNO A;  1AU7 A;  3BD1 A;  2R1J L;  3BDN A;  3LIS A;  2WIU B;  1PER L;  4X4I A;  2PUA A;  2KEK A;  1RZS A;  4YBA A;  1PRA A;  4X4F A;  2BNN A;  1GT0 C;  2KZ8 A;  4IVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...