4GHLA

Structural basis for marburg virus vp35 mediate immune evasion mechanisms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFMGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for Marburg virus VP35-mediated immune evasion mechanisms.
pubmed doi rcsb
source organism Lake victoria marburgvirus
molecule tags Transcription, viral protein/rna
molecule keywords short palindromic RNA AGACAGCAUAUGCUGUCU
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ghlA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ghlA02
4IBFA 3L29A 4IBJA 3KS4A 4GH9A 3L2AA 4GHLA 4IBKA 3L25A 3L27A 4IJFA 5BPVA 4IBIA 4IJEA 3FKEA 4IBCA 3L28A 3L26A 3KS8A 4IBDA 4IBBA 4IBGA 4GHAA 4IBEA 4LG2A
chains in the Genus database with same CATH superfamily
1Q02A 3GLIE 1NNUC 4LJ8A 3AV0A 2DHRA 3LCUA 4PD2A 3KS4A 1QAQA 2LVQD 2RGOA 1XB2B 3UK6A 2Y20A 2VF8A 2F5PA 4OJOA 2LVAA 3NBXX 4GHLA 2DXIA 1L1ZA 2XD1A 1L6JA 3J27B 4GITA 3U61A 3AFHA 2EUCA 1YUEA 3TE6A 1NHWC 3GLHE 5KQDA 3GO8A 4JI8M 4K0KM 4NYYA 4DV6M 4DV3M 1VDLA 2X8AA 4IBCA 3WHLA 1V34A 4CHTB 4AKIA 1L2BA 3N3FA 4Z2GA 2R45A 1GL6A 2KRUA 3GLHB 2BG1A 3WHKA 3C58A 1TR8A 4LGYA 2KNVA 2J7OA 3DFZA 3TQSA 1S3SA 1IN5A 2J5YA 4LFAM 1N75A 2C5RA 4IBEA 4QHTA 3U6MA 2VIIA 3SAWA 3HHYA 4Y28F 3MHVC 1HJPA 3T38A 1N34M 2R44A 4I4LA 4LF5M 3WD0A 2UUAM 4NRWA 3TPZA 1JR3E 3DZDA 1K3XA 3U6LA 2DWNA 3GPYA 3D8BA 3HJQA 4JN6A 4CIZA 2C9CA 2Q2EB 3RE8A 2CHQA 2Y2HA 2H5XA 3DOAA 4AQYM 3J7BA 3TWMA 4XBOA 3I4YA 2RGHA 1YU1A 2QP9X 1HQYE 4DV7M 3FKEA 1PDCA 4MGIE 4OJ6A 1J7KA 1AIWA 2F5QA 3L26A 3FYDA 4TX8A 1T3TA 2QCUA 1IN4A 1LTMA 2C98A 2YFQA 1J7MA 1E94E 1PJSA 3MJ5A 1YE9A 5LMNM 4DV5M 4LF7M 5FLXS 3E4RA 3TL4X 1Q3CA 2WSEF 3GQ3A 3SMPA 3E46A 3KDSE 5EP1A 1OTRA 1VEKA 3SYLA 3HGIA 4OJ5A 4QOSA 3FUTA 5ITXA 4AI6A 3R8FA 2UXDM 4MGYE 1O6IA 4L6V6 2JA2A 1HNZM 4NY2A 3L2AA 4BBAA 1L2CA 1IXSB 4L16A 2KHHA 1OIZA 1NNJA 1YU4A 4MB7A 1IFYA 1C1KA 3B7QA 4HLQA 3AKZA 3ILKA 3B7ZA 3SMSA 3AOEA 3K92A 3KOZE 4LJAA 4DV4M 3RGSA 3SASA 4L8RC 2XH9A 3HHWA 2XLJA 1GPFA 1Q39A 1XMOM 2DI0A 1NSFA 3E9SA 4LF4M 3W67A 3WD4A 3KOYE 3HX3A 3VDUA 2CWBA 1TDZA 1ED7A 2JUJA 2DWMA 5ITYA 1R6BX 3IG5A 3K9OA 3B9PA 2FE8A 3KVWA 3I01M 4PDIA 3CGWA 2MR9A 2YNMD 2XFTA 2HHHM 2G8LA 3JR5A 2WSCF 3GLHA 3D8LA 2W82A 1FNNA 3FYCA 3VDPA 2FN2A 4LJ9A 3PNVA 2WSFF 1QVRA 2DAKA 4OJPA 2LHCA 2EJSA 5JI2E 3VKHA 2JZ0A 2D7GA 3L28A 2DZNB 2LXEA 2Y0TA 3PVSA 4IBDA 4KODA 4OW0A 2OQ4A 4I81A 2CP8A 3W0FA 5DNYA 4R3DA 3HKPA 4PCZA 1XXHA 3OTOM 3PNYA 3SATA 4B3TM 1TH4A 4QOZC 2Y2OA 3HONA 1CUKA 1K3WA 1QANA 1XC8A 4JYAM 4PDGA 5ITRA 3K9PA 1QDTA 1AUAA 4OVZB 1E6NA 1L1TA 2WZJA 1NJFA 1YU2A 2C96A 2R62A 5H37D 2UWXA 1OFHA 4NSRA 1E8BA 4NXNM 3U6EA 1C7YA 2Y2QA 4LFCM 2OPFA 2XZFA 1EIJA 4NZ1A 1OGGA 3E21A 1PGYA 3FTDA 4LRTA 5DYGA 4D80A 2UXBM 1IN8A 3FRHA 2JWSA 1W1TA 2JY8A 1F4IA 3U6SA 2CV0A 3GLIB 1Z5CA 2KDLA 5BR8M 2OO9A 1OKSA 4FWDA 4MGKE 4GRIA 4JI3M 5F3WA 2V5OA 1QYRA 4P17A 1Z6TA 4S12A 3LMMA 1SG9A 4FCTA 1XHBA 2J7NA 1WR1B 2RKOA 4M0DA 2KXEA 1D2NA 3J80S 1OAIA 5EP2A 3AJIB 5FTNA 1A5TA 3HZJA 3T6PA 3UMMA 3U60A 4A3VB 4X65M 4LFBM 2XD5A 3FTEA 4Z2JA 4AKGA 2Z8YM 4CJ6A 2VQFM 4JI2M 2N35A 2F5NA 2JNHA 5ITQA 3W68A 3IECA 3GPPA 3GLFA 4Q7JA 2X4AA 4B3RM 2HKJA 2LBCA 2CV1A 4RF1A 4FCVA 1VEJA 4Z2IA 1VEGA 3CF2A 2M5ZA 1NJGA 2V1UA 4QNRA 2EA0A 1IBKM 1E9RA 1GL7A 1NY5A 4NRVA 3BOSA 3HHZA 5LMUM 3FTCA 3U5ZB 4L4UA 1QAOA 4OX9M 1CK7A 3L29A 2KNAA 3C3EA 4G6ZA 4M9SA 4EIWA 1J5EM 2KRKA 4JI5M 3U6QA 3H4MA 1G4AE 3VK8A 2R4EA 2DWLA 1JR3A 1T43A 4X62M 4ANRA 1OIPA 4G4RA 5EXXA 3SBJA 2CEAA 3KP1E 4XK8F 2CHGA 3HJSA 1GABA 4KT0F 2Y2GA 1NV8A 2V6ZM 4DBGB 4LZJA 4Z6YA 1QZMA 2FFJA 5KPRA 2I7NA 4YY3M 1SXJA 1QQWA 1AIPC 1LV7A 5EXSA 4OVZA 1QO6A 5KPZA 2Z4RA 3B74A 1E32A 4WW0A 1R4GA 1EAKA 1TTEA 2MGWA 4NYUA 2K0BX 4MH0E 4ITQA 2Y2LA 4LF8M 3GRRA 3K1JA 2M60A 4R7GA 1D0KA 2MROB 2ZTDA 2EKFA 1N36M 2HAKA 1W1VA 4GH9A 3AL0C 1TH3A 5DFLA 3FRIA 4L78A 3J81S 2JXNA 3T1YM 5C18A 2LTUA 3SHGB 1W1PA 3LVWA 2P5TA 1VDDA 4LZZA 3FUVA 3T15A 2Y0QA 4IIWA 2UXCM 1UFZA 1YLAA 2MH8A 3CF0A 1GXDA 2DZLA 2XF3A 5L8RF 4DV2M 1WGLA 4FW9A 4F2LA 4L15A 4GC9A 4MB3A 2CUZA 4HL4A 4GMQA 3SARA 3NBIA 4IBBA 1L8QA 5E26A 2FH0A 3A46A 2Y2JA 2XGNA 2F4VM 4GHAA 2QNJA 3K8ZA 5KPTA 2JY5A 1HT2E 2BJVA 4JI6M 1N78A 2YR0A 2FNAA 8CATA 3GLGE 1PJTA 5ITTA 2Z3XA 2Z4SA 2EKKA 3SYKA 2D7HA 5DYIA 1PM5A 3FD9A 1ORYB 2XSZA 3GLFE 1IY2A 3CF6E 3LQRA 2L09A 5EP3A 4JI1M 4LF6M 1JR3D 1X37A 4W5WA 3U5ZA 3WD3A 1E88A 1H0IA 2CFOA 3EIHA 3I4VA 3VLFB 1OQYA 1VG5A 1G3IA 5EXPA 3QYEA 3ZCBB 5ITUA 1ZMVA 2DHYA 4AG6A 3FUWA 4QNLA 1IN7A 1W1YA 1NVMA 4ZPXA 3M6AA 2DAMA 2Y2NA 1HR0M 2L6OA 4DR2M 3LVVA 1HNXM 3WD1A 4IBFA 3TWKA 3GP1A 2EO2A 3U6PA 2RTSA 1Y8GA 1YSYA 3RGPA 4LJ5A 1L2DA 4I8OA 1WXQA 1E9SA 1OJLA 3GPXA 3R9XB 1ZMUA 3FUXA 4FD2A 1DV0A 1TH2A 4DR1M 2A5YB 3IHPA 4IJFA 2DAEA 1GLNA 2DNAA 1JB0F 5BPVA 3FTFA 1NV9A 4IBIA 3JR4A 2BNKA 4LF9M 1E6ZA 1QDRA 1QUTA 2QPAA 2ERCA 3J2PB 4X64M 1HQCA 2QZ4A 3HWSA 4PT5A 3FUUA 5JI3E 1XWIA 3VKGA 3BXWA 1ZMWA 4FCWA 4DV0M 2JE5A 4DR7M 4KLNA 2D49A 2UU9M 1V92A 3V76A 2K47A 2MJ5B 2QBYA 4JXJA 2L4FA 3SAUA 1OFIA 3M0EA 4TUWA 1WHCA 4GEWA 2FS1A 4BLCA 4HMEA 2ZANA 5EQTA 1XMQM 1YU3A 1J09A 1K82A 2R0IA 4P16A 3CTWB 1IY1A 2CHVA 2Z7JA 2LH0A 4KO8A 1WJ7A 4NSOB 2OOBA 1IQPA 3LCVB 4NL4H 1MN3A 1DGFA 4QHSA 3H4JA 4MB4A 4LJ6A 1DGBA 4G3OA 3PXGA 3KS8A 4DR6M 1TDHA 2KW0A 3EIEA 5FTJA 1ZAEA 4I5SA 4YHHM 4HMDA 3GLGB 2ZM6M 2JZ1A 3C3DA 1WGNA 1N32M 1G41A 4CGYB 1N33M 1PJQA 3QYBA 4GC5A 4Z2LA 5IREB 1EE8A 2APLA 4LJ7A 1MJGM 2F5OA 1YU0A 3HHXA 2QQ8A 1H0GA 3LW5F 4NZ5A 3T1HM 3SC3A 1E15A 1CXWA 4D81A 2L2DA 1UR9A 2JP7A 3THGA 4D82A 4XGIA 2VF7A 3L27A 3SAVA 4CISA 2E5LM 3MMPA 1HNWM 2V1CA 2I7PA 3KFUG 3A45A 3F92A 4JI7M 4NC6A 1FJGM 5IT9S 4R71A 3QWLA 1NO1A 1XNRM 2DAGA 3BBZA 4NOOB 3QAUA 2H1RA 3KSJA 3KOXE 1KSFX 2O25A 1SXJD 2KZSA 4LY6A 3HU3A 5IZ7D 1GJTA 4UN2B 3W0LB 4AW4A 4F1IA 4GKKM 3GRUA 4DUZM 1SXJE 4LCBA 5FTKA 5A2QS 4WURA 5GKNA 2DENA 2LWXA 2BWEA 3KSXA 1PJIA 1W5SA 3WD2A 4Z2HA 2KA6B 2CRUA 2NQ8C 4BB9A 1R2ZA 7CATA 4JI4M 2R46A 4NZ4A 1ZV1A 1I94M 1GOIA 4Z8XA 4MB5A 1GVNA 4JV5M 1H8PA 3GRYA 2Y2KA 3KW6A 3L25A 4RKUF 4FWGA 4B7HA 3HSHA 1PJJA 1XXHB 1Z5BA 3B7NA 3DA1A 2HCBA 3AOGA 2QBYB 2R65A 2Y2IA 1YUBA 5FTMA 2KZUA 1E6RA 5FTLA 1KYIA 4REZA 1G71A 1T6OA 1MU5A 1DGGA 2C99A 2LNHC 4X66M 2QSFX 5ITXE 1TF0B 5EP4A 2LVNC 2K6BA 3IG8A 2L7HA 4DR5M 1V33A 2CV2A 2JCHA 4OUIA 2QHOB 3PFIA 4Z2KA 1OAOC 3GLFB 2FFFB 4MGZE 2ZAOA 1R2YA 2IOUA 2QENA 2BWBA 3SFZA 4G4OA 3MQLA 1G8PA 3WX7A 4JI0M 4M0WA 5KO3A 4B3SM 3ZQJA 1MX0A 1GJSA 5C1BA 1OGBA 2O5RA 3HU2A 4FVMA 3LQQA 3RFWA 3GLGA 3GLIA 1IBLM 2OOAA 4G4QA 2XEPA 3U6DA 1UR8A 1EFUB 1QUSA 2GQFA 3KP0E 2C9OA 3VK7A 1DGHA 2JY6B 2UUBM 4AKHA 2DVWB 1SXJC 1GO5A 1G59A 2HWJA 1WIVA 4RNAA 4QNMA 5IWAM 2FOIC 3B89A 2Y2PA 3MK6A 4HMCA 4OU7A 1H6UA 2YQZA 3M7PA 2R6FA 3KOWE 2AHMA 3JAMS 3U60B 2LVOC 1IXRC 2D7EA 3U61B 1R5LA 2DZOB 3I04M 3ZH9B 1DO0A 3GQ4A 4LJ4A 5EXTA 1ZQ9A 4B7FA 1GKIA 4B08A 3GQ5A 4B7GA 4GIPA 1IBMM 1XNQM 4NZ3A 1I4WA 2L7IA 3M7GA 4LGMA 1QAMA 4M9ZA 4LRSA 4IBKA 4DR4M 4II7A 1QZEA 1IY0A 1VQ1A 2CE7A 4DUYM 4KHPM 2XSZD 5EJCA 1W5TA 2X49A 2R18A 1IM2A 2L4EA 2R4JA 3ZC7B 3I51A 1IN6A 3C9PA 2ZTCA 3HU1A 3Q8XA 4GKJM 3U6CA 1XXHE 4MGHA 4RF0A 4AZFA 4WP2A 4DV1M 4DR3M 2F5SA 4IBGA 4OJLA 2B3TA 3UJNA 3AOEC 3GRVA 2K9DA 4FWHA 4LG2A 2KEBA 4NXMM 1PRBA 2Y2MA 3KXEC 2DKLA 5FSWA 1D0MA 1IXZA 2LHGA 1UM8A 2ZBKB 2DAIA 3A42A 3K2LA 3NWLA 2Y21A 2UUCM 3J7AS 4IBJA 3A98B 2O01F 3HJ8A 2ZAMA 1HT1E 1SXJB 2DWZB 1N77A 1Z5AA 1Z59A 4HEOA 3U6OA 2G3QA 2BJWA 2GNOA 3VFDA 3GPUA 1D0LA 3SHFA 4M9XA 1RU3A 1Q3BA 5KQ8A 4IJEA 1KS0A 2G5GX 1BVSA 1NHGC 3TWLA 1NY6A 1P3QQ 2LVPC 1DO2A 2HL7A 2KNZA 4AG5A 1IXSA 1TGUA 2XZUA 4B3MM 3Q8GA 1E6PA 3HY5A 2XFSA 4G4NA 2JY7A 4MM3B 1JQJC 3UZUA 2RRUA 2VDBB 3FE3A 3UGJA 1R7RA 1DGHB 5E6JA 1KFVA 2VQEM
chains in the Genus database with same CATH topology
1NNUC 4LJ8A 3AV0A 2DHRA 4PD2A 3KS4A 1QAQA 2RGOA 3UK6A 2Y20A 4OJOA 2F5PA 4GHLA 2DXIA 1L1ZA 2XD1A 3J27B 4GITA 3U61A 3AFHA 2EUCA 1YUEA 3TE6A 1NHWC 5KQDA 3GO8A 4JI8M 4K0KM 4NYYA 4DV6M 4DV3M 2X8AA 4IBCA 3WHLA 4CHTB 4AKIA 3N3FA 1L2BA 2R45A 1GL6A 2KRUA 3GLHB 2BG1A 3WHKA 3C58A 4LGYA 3DFZA 2J7OA 3TQSA 1S3SA 1IN5A 2C5RA 4LFAM 1N75A 4IBEA 4QHTA 3U6MA 2VIIA 3SAWA 3HHYA 3MHVC 3T38A 1N34M 4I4LA 4LF5M 2UUAM 4NRWA 3TPZA 3DZDA 1K3XA 3U6LA 2DWNA 3GPYA 3D8BA 3HJQA 4JN6A 2C9CA 2Q2EB 3RE8A 2CHQA 2Y2HA 3DOAA 4AQYM 3J7BA 3TWMA 4XBOA 3I4YA 2RGHA 1YU1A 2QP9X 1HQYE 4DV7M 3FKEA 4OJ6A 4MGIE 1J7KA 2F5QA 3L26A 3FYDA 1T3TA 2QCUA 1IN4A 2C98A 2YFQA 1E94E 3MJ5A 5LMNM 1YE9A 4DV5M 4LF7M 5FLXS 3E4RA 3TL4X 1Q3CA 3GQ3A 3SMPA 3KDSE 5EP1A 3SYLA 3HGIA 4OJ5A 4QOSA 3FUTA 5ITXA 3R8FA 2UXDM 4MGYE 2JA2A 1HNZM 4NY2A 3L2AA 4BBAA 1L2CA 1IXSB 4L16A 1NNJA 1YU4A 4MB7A 1C1KA 4HLQA 3AKZA 3ILKA 3SMSA 3KOZE 3AOEA 3K92A 4LJAA 4DV4M 3RGSA 3SASA 4L8RC 2XH9A 3HHWA 2XLJA 1Q39A 1XMOM 1NSFA 3E9SA 4LF4M 3KOYE 3VDUA 1TDZA 2DWMA 5ITYA 1R6BX 3IG5A 3B9PA 2FE8A 3KVWA 4PDIA 2YNMD 2XFTA 2HHHM 2G8LA 3JR5A 3GLHA 3D8LA 2W82A 1FNNA 3FYCA 3VDPA 4LJ9A 3PNVA 1QVRA 4OJPA 5JI2E 3VKHA 3L28A 2D7GA 3PVSA 2DZNB 2LXEA 2Y0TA 4IBDA 4KODA 4OW0A 2OQ4A 4I81A 3W0FA 5DNYA 4R3DA 3HKPA 4PCZA 1XXHA 3OTOM 3PNYA 3SATA 4B3TM 1TH4A 4QOZC 2Y2OA 3HONA 1K3WA 1QANA 1XC8A 4JYAM 4PDGA 5ITRA 4OVZB 1L1TA 1NJFA 1YU2A 2C96A 2R62A 5H37D 2UWXA 1OFHA 4NSRA 4NXNM 3U6EA 2Y2QA 4LFCM 2OPFA 2XZFA 4NZ1A 5DYGA 4LRTA 3FTDA 4D80A 2UXBM 1IN8A 3U6SA 2CV0A 3GLIB 1Z5CA 5BR8M 4FWDA 4MGKE 4GRIA 4JI3M 5F3WA 1QYRA 1Z6TA 4S12A 3LMMA 4FCTA 1XHBA 2J7NA 2RKOA 4M0DA 2KXEA 1D2NA 3J80S 5FTNA 5EP2A 3AJIB 3UMMA 4LFBM 3U60A 4A3VB 4X65M 2XD5A 3FTEA 4AKGA 2VQFM 4JI2M 2F5NA 5ITQA 3GPPA 3GLFA 2X4AA 4B3RM 2HKJA 2CV1A 4RF1A 4FCVA 3CF2A 2M5ZA 1NJGA 2V1UA 4QNRA 2EA0A 1IBKM 1E9RA 1GL7A 1NY5A 4NRVA 3BOSA 3HHZA 5LMUM 3FTCA 3U5ZB 4L4UA 1QAOA 4OX9M 3L29A 4G6ZA 4EIWA 4M9SA 1J5EM 2KRKA 4JI5M 3U6QA 3H4MA 1G4AE 3VK8A 2R4EA 2DWLA 1JR3A 4X62M 4G4RA 5EXXA 3SBJA 2CEAA 3KP1E 2CHGA 3HJSA 2Y2GA 2V6ZM 4LZJA 4Z6YA 1QZMA 2FFJA 5KPRA 2I7NA 4YY3M 1SXJA 1QQWA 1LV7A 5EXSA 4OVZA 5KPZA 2Z4RA 4WW0A 1E32A 4NYUA 4MH0E 4ITQA 2Y2LA 4LF8M 3GRRA 3K1JA 2M60A 4R7GA 1N36M 4GH9A 3AL0C 1TH3A 4L78A 3J81S 3T1YM 5C18A 3SHGB 3LVWA 2P5TA 1VDDA 4LZZA 3FUVA 3T15A 2Y0QA 4IIWA 2UXCM 3CF0A 4DV2M 2XF3A 4FW9A 4L15A 4GC9A 2CUZA 4HL4A 4GMQA 3SARA 3NBIA 4IBBA 1L8QA 5E26A 3A46A 2Y2JA 2XGNA 2F4VM 4GHAA 3K8ZA 5KPTA 1HT2E 2BJVA 4JI6M 1N78A 2YR0A 2FNAA 8CATA 5ITTA 2Z3XA 2Z4SA 3SYKA 2D7HA 5DYIA 1PM5A 3FD9A 1ORYB 2XSZA 1IY2A 3CF6E 3LQRA 2L09A 5EP3A 4JI1M 4LF6M 1JR3D 1X37A 4W5WA 3U5ZA 2CFOA 3EIHA 3I4VA 3VLFB 1G3IA 5EXPA 3ZCBB 5ITUA 4AG6A 3FUWA 4QNLA 1IN7A 1NVMA 4ZPXA 3M6AA 2Y2NA 1HR0M 2L6OA 4DR2M 3LVVA 1HNXM 4IBFA 3TWKA 3GP1A 2EO2A 3U6PA 1YSYA 3RGPA 4LJ5A 1L2DA 4I8OA 1WXQA 1E9SA 1OJLA 3GPXA 3R9XB 3FUXA 4FD2A 1TH2A 4DR1M 2A5YB 4IJFA 1GLNA 5BPVA 3FTFA 3JR4A 4IBIA 2BNKA 4LF9M 2QPAA 2ERCA 3J2PB 4X64M 1HQCA 2QZ4A 3HWSA 4PT5A 3FUUA 5JI3E 1XWIA 3VKGA 4DV0M 4FCWA 2JE5A 4DR7M 4KLNA 2UU9M 2K47A 2QBYA 4JXJA 3SAUA 1OFIA 3M0EA 4TUWA 4BLCA 2ZANA 5EQTA 1XMQM 1YU3A 1J09A 1K82A 4P16A 3CTWB 1IY1A 2CHVA 2Z7JA 2LH0A 4KO8A 4NSOB 1IQPA 4NL4H 1DGFA 4QHSA 4LJ6A 1DGBA 3PXGA 3KS8A 4DR6M 1TDHA 2KW0A 3EIEA 5FTJA 1ZAEA 4I5SA 4YHHM 3GLGB 2ZM6M 1N32M 1G41A 4CGYB 1N33M 4GC5A 5IREB 1EE8A 4LJ7A 2F5OA 1YU0A 3HHXA 4NZ5A 3T1HM 3SC3A 4D81A 3THGA 4D82A 4XGIA 3L27A 3SAVA 4CISA 2E5LM 1HNWM 2V1CA 2I7PA 3KFUG 3A45A 4JI7M 1FJGM 5IT9S 3QWLA 1XNRM 4NOOB 3QAUA 2H1RA 3KSJA 3KOXE 1KSFX 4AI6A 1SXJD 2KZSA 4LY6A 3HU3A 5IZ7D 3W0LB 4AW4A 3GQ5A 4GKKM 3GRUA 4DUZM 1SXJE 4LCBA 5FTKA 5A2QS 4WURA 5GKNA 2LWXA 3KSXA 1PJIA 1W5SA 2KA6B 2NQ8C 4BB9A 1R2ZA 4JI4M 7CATA 2R46A 4NZ4A 1I94M 4Z8XA 1GVNA 4JV5M 3GRYA 2Y2KA 3KW6A 3L25A 4FWGA 4B7HA 3HSHA 1PJJA 1XXHB 1Z5BA 3DA1A 2HCBA 3AOGA 2QBYB 2R65A 2Y2IA 1YUBA 5FTMA 2KZUA 5FTLA 1KYIA 4REZA 1MU5A 1DGGA 2C99A 2LNHC 4X66M 5ITXE 5EP4A 3IG8A 2L7HA 4DR5M 2CV2A 2JCHA 4OUIA 3PFIA 3GLFB 2FFFB 4MGZE 2ZAOA 1R2YA 2IOUA 2QENA 3SFZA 4G4OA 1G8PA 3WX7A 4JI0M 4M0WA 5KO3A 4B3SM 1MX0A 5C1BA 2O5RA 3HU2A 4FVMA 3LQQA 3RFWA 3GLGA 3GLIA 1IBLM 4G4QA 2XEPA 3U6DA 3KP0E 3VK7A 2C9OA 1DGHA 2UUBM 4AKHA 2DVWB 1SXJC 1G59A 4RNAA 4QNMA 5IWAM 2FOIC 2Y2PA 3MK6A 4OU7A 1H6UA 2YQZA 3KOWE 2AHMA 3JAMS 3U60B 1IXRC 2D7EA 3U61B 2DZOB 3ZH9B 1DO0A 3GQ4A 4LJ4A 5EXTA 1ZQ9A 4B7FA 1GKIA 4B08A 1IBMM 4B7GA 4GIPA 1XNQM 4NZ3A 1I4WA 2L7IA 3M7GA 4LGMA 1QAMA 4M9ZA 4LRSA 4IBKA 4DR4M 4II7A 1IY0A 2CE7A 4DUYM 4KHPM 2XSZD 5EJCA 1W5TA 2X49A 2R18A 1IM2A 2R4JA 3ZC7B 3I51A 1IN6A 3HU1A 3Q8XA 4GKJM 3U6CA 4MGHA 4RF0A 4AZFA 4DV1M 4DR3M 2F5SA 4IBGA 4OJLA 3UJNA 3AOEC 3GRVA 4NXMM 4FWHA 4LG2A 2KEBA 2Y2MA 3KXEC 5FSWA 1IXZA 1UM8A 2ZBKB 3A42A 3K2LA 3NWLA 2Y21A 2UUCM 3J7AS 4IBJA 3A98B 3HJ8A 2ZAMA 1HT1E 1SXJB 2DWZB 1N77A 1Z5AA 1Z59A 3U6OA 2BJWA 3VFDA 3GPUA 3SHFA 4M9XA 5KQ8A 1Q3BA 4IJEA 2G5GX 1NHGC 3TWLA 1NY6A 1DO2A 2HL7A 4AG5A 1TGUA 2XZUA 4B3MM 2XFSA 4G4NA 4MM3B 1JQJC 3UZUA 3UGJA 1R7RA 1DGHB 5E6JA 1KFVA 2VQEM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBF A;  3L29 A;  4IBJ A;  3KS4 A;  4GH9 A;  3L2A A;  4GHL A;  4IBK A;  3L25 A;  3L27 A;  4IJF A;  5BPV A;  4IBI A;  4IJE A;  3FKE A;  4IBC A;  3L28 A;  3L26 A;  3KS8 A;  4IBD A;  4IBB A;  4IBG A;  4GHA A;  4IBE A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 1Q02 A;  3GLI E;  1NNU C;  4LJ8 A;  3AV0 A;  2DHR A;  3LCU A;  4PD2 A;  3KS4 A;  1QAQ A;  2LVQ D;  2RGO A;  1XB2 B;  3UK6 A;  2Y20 A;  2VF8 A;  2F5P A;  4OJO A;  2LVA A;  3NBX X;  4GHL A;  2DXI A;  1L1Z A;  2XD1 A;  1L6J A;  3J27 B;  4GIT A;  3U61 A;  3AFH A;  2EUC A;  1YUE A;  3TE6 A;  1NHW C;  3GLH E;  5KQD A;  3GO8 A;  4JI8 M;  4K0K M;  4NYY A;  4DV6 M;  4DV3 M;  1VDL A;  2X8A A;  4IBC A;  3WHL A;  1V34 A;  4CHT B;  4AKI A;  1L2B A;  3N3F A;  4Z2G A;  2R45 A;  1GL6 A;  2KRU A;  3GLH B;  2BG1 A;  3WHK A;  3C58 A;  1TR8 A;  4LGY A;  2KNV A;  2J7O A;  3DFZ A;  3TQS A;  1S3S A;  1IN5 A;  2J5Y A;  4LFA M;  1N75 A;  2C5R A;  4IBE A;  4QHT A;  3U6M A;  2VII A;  3SAW A;  3HHY A;  4Y28 F;  3MHV C;  1HJP A;  3T38 A;  1N34 M;  2R44 A;  4I4L A;  4LF5 M;  3WD0 A;  2UUA M;  4NRW A;  3TPZ A;  1JR3 E;  3DZD A;  1K3X A;  3U6L A;  2DWN A;  3GPY A;  3D8B A;  3HJQ A;  4JN6 A;  4CIZ A;  2C9C A;  2Q2E B;  3RE8 A;  2CHQ A;  2Y2H A;  2H5X A;  3DOA A;  4AQY M;  3J7B A;  3TWM A;  4XBO A;  3I4Y A;  2RGH A;  1YU1 A;  2QP9 X;  1HQY E;  4DV7 M;  3FKE A;  1PDC A;  4MGI E;  4OJ6 A;  1J7K A;  1AIW A;  2F5Q A;  3L26 A;  3FYD A;  4TX8 A;  1T3T A;  2QCU A;  1IN4 A;  1LTM A;  2C98 A;  2YFQ A;  1J7M A;  1E94 E;  1PJS A;  3MJ5 A;  1YE9 A;  5LMN M;  4DV5 M;  4LF7 M;  5FLX S;  3E4R A;  3TL4 X;  1Q3C A;  2WSE F;  3GQ3 A;  3SMP A;  3E46 A;  3KDS E;  5EP1 A;  1OTR A;  1VEK A;  3SYL A;  3HGI A;  4OJ5 A;  4QOS A;  3FUT A;  5ITX A;  4AI6 A;  3R8F A;  2UXD M;  4MGY E;  1O6I A;  4L6V 6;  2JA2 A;  1HNZ M;  4NY2 A;  3L2A A;  4BBA A;  1L2C A;  1IXS B;  4L16 A;  2KHH A;  1OIZ A;  1NNJ A;  1YU4 A;  4MB7 A;  1IFY A;  1C1K A;  3B7Q A;  4HLQ A;  3AKZ A;  3ILK A;  3B7Z A;  3SMS A;  3AOE A;  3K92 A;  3KOZ E;  4LJA A;  4DV4 M;  3RGS A;  3SAS A;  4L8R C;  2XH9 A;  3HHW A;  2XLJ A;  1GPF A;  1Q39 A;  1XMO M;  2DI0 A;  1NSF A;  3E9S A;  4LF4 M;  3W67 A;  3WD4 A;  3KOY E;  3HX3 A;  3VDU A;  2CWB A;  1TDZ A;  1ED7 A;  2JUJ A;  2DWM A;  5ITY A;  1R6B X;  3IG5 A;  3K9O A;  3B9P A;  2FE8 A;  3KVW A;  3I01 M;  4PDI A;  3CGW A;  2MR9 A;  2YNM D;  2XFT A;  2HHH M;  2G8L A;  3JR5 A;  2WSC F;  3GLH A;  3D8L A;  2W82 A;  1FNN A;  3FYC A;  3VDP A;  2FN2 A;  4LJ9 A;  3PNV A;  2WSF F;  1QVR A;  2DAK A;  4OJP A;  2LHC A;  2EJS A;  5JI2 E;  3VKH A;  2JZ0 A;  2D7G A;  3L28 A;  2DZN B;  2LXE A;  2Y0T A;  3PVS A;  4IBD A;  4KOD A;  4OW0 A;  2OQ4 A;  4I81 A;  2CP8 A;  3W0F A;  5DNY A;  4R3D A;  3HKP A;  4PCZ A;  1XXH A;  3OTO M;  3PNY A;  3SAT A;  4B3T M;  1TH4 A;  4QOZ C;  2Y2O A;  3HON A;  1CUK A;  1K3W A;  1QAN A;  1XC8 A;  4JYA M;  4PDG A;  5ITR A;  3K9P A;  1QDT A;  1AUA A;  4OVZ B;  1E6N A;  1L1T A;  2WZJ A;  1NJF A;  1YU2 A;  2C96 A;  2R62 A;  5H37 D;  2UWX A;  1OFH A;  4NSR A;  1E8B A;  4NXN M;  3U6E A;  1C7Y A;  2Y2Q A;  4LFC M;  2OPF A;  2XZF A;  1EIJ A;  4NZ1 A;  1OGG A;  3E21 A;  1PGY A;  3FTD A;  4LRT A;  5DYG A;  4D80 A;  2UXB M;  1IN8 A;  3FRH A;  2JWS A;  1W1T A;  2JY8 A;  1F4I A;  3U6S A;  2CV0 A;  3GLI B;  1Z5C A;  2KDL A;  5BR8 M;  2OO9 A;  1OKS A;  4FWD A;  4MGK E;  4GRI A;  4JI3 M;  5F3W A;  2V5O A;  1QYR A;  4P17 A;  1Z6T A;  4S12 A;  3LMM A;  1SG9 A;  4FCT A;  1XHB A;  2J7N A;  1WR1 B;  2RKO A;  4M0D A;  2KXE A;  1D2N A;  3J80 S;  1OAI A;  5EP2 A;  3AJI B;  5FTN A;  1A5T A;  3HZJ A;  3T6P A;  3UMM A;  3U60 A;  4A3V B;  4X65 M;  4LFB M;  2XD5 A;  3FTE A;  4Z2J A;  4AKG A;  2Z8Y M;  4CJ6 A;  2VQF M;  4JI2 M;  2N35 A;  2F5N A;  2JNH A;  5ITQ A;  3W68 A;  3IEC A;  3GPP A;  3GLF A;  4Q7J A;  2X4A A;  4B3R M;  2HKJ A;  2LBC A;  2CV1 A;  4RF1 A;  4FCV A;  1VEJ A;  4Z2I A;  1VEG A;  3CF2 A;  2M5Z A;  1NJG A;  2V1U A;  4QNR A;  2EA0 A;  1IBK M;  1E9R A;  1GL7 A;  1NY5 A;  4NRV A;  3BOS A;  3HHZ A;  5LMU M;  3FTC A;  3U5Z B;  4L4U A;  1QAO A;  4OX9 M;  1CK7 A;  3L29 A;  2KNA A;  3C3E A;  4G6Z A;  4M9S A;  4EIW A;  1J5E M;  2KRK A;  4JI5 M;  3U6Q A;  3H4M A;  1G4A E;  3VK8 A;  2R4E A;  2DWL A;  1JR3 A;  1T43 A;  4X62 M;  4ANR A;  1OIP A;  4G4R A;  5EXX A;  3SBJ A;  2CEA A;  3KP1 E;  4XK8 F;  2CHG A;  3HJS A;  1GAB A;  4KT0 F;  2Y2G A;  1NV8 A;  2V6Z M;  4DBG B;  4LZJ A;  4Z6Y A;  1QZM A;  2FFJ A;  5KPR A;  2I7N A;  4YY3 M;  1SXJ A;  1QQW A;  1AIP C;  1LV7 A;  5EXS A;  4OVZ A;  1QO6 A;  5KPZ A;  2Z4R A;  3B74 A;  1E32 A;  4WW0 A;  1R4G A;  1EAK A;  1TTE A;  2MGW A;  4NYU A;  2K0B X;  4MH0 E;  4ITQ A;  2Y2L A;  4LF8 M;  3GRR A;  3K1J A;  2M60 A;  4R7G A;  1D0K A;  2MRO B;  2ZTD A;  2EKF A;  1N36 M;  2HAK A;  1W1V A;  4GH9 A;  3AL0 C;  1TH3 A;  5DFL A;  3FRI A;  4L78 A;  3J81 S;  2JXN A;  3T1Y M;  5C18 A;  2LTU A;  3SHG B;  1W1P A;  3LVW A;  2P5T A;  1VDD A;  4LZZ A;  3FUV A;  3T15 A;  2Y0Q A;  4IIW A;  2UXC M;  1UFZ A;  1YLA A;  2MH8 A;  3CF0 A;  1GXD A;  2DZL A;  2XF3 A;  5L8R F;  4DV2 M;  1WGL A;  4FW9 A;  4F2L A;  4L15 A;  4GC9 A;  4MB3 A;  2CUZ A;  4HL4 A;  4GMQ A;  3SAR A;  3NBI A;  4IBB A;  1L8Q A;  5E26 A;  2FH0 A;  3A46 A;  2Y2J A;  2XGN A;  2F4V M;  4GHA A;  2QNJ A;  3K8Z A;  5KPT A;  2JY5 A;  1HT2 E;  2BJV A;  4JI6 M;  1N78 A;  2YR0 A;  2FNA A;  8CAT A;  3GLG E;  1PJT A;  5ITT A;  2Z3X A;  2Z4S A;  2EKK A;  3SYK A;  2D7H A;  5DYI A;  1PM5 A;  3FD9 A;  1ORY B;  2XSZ A;  3GLF E;  1IY2 A;  3CF6 E;  3LQR A;  2L09 A;  5EP3 A;  4JI1 M;  4LF6 M;  1JR3 D;  1X37 A;  4W5W A;  3U5Z A;  3WD3 A;  1E88 A;  1H0I A;  2CFO A;  3EIH A;  3I4V A;  3VLF B;  1OQY A;  1VG5 A;  1G3I A;  5EXP A;  3QYE A;  3ZCB B;  5ITU A;  1ZMV A;  2DHY A;  4AG6 A;  3FUW A;  4QNL A;  1IN7 A;  1W1Y A;  1NVM A;  4ZPX A;  3M6A A;  2DAM A;  2Y2N A;  1HR0 M;  2L6O A;  4DR2 M;  3LVV A;  1HNX M;  3WD1 A;  4IBF A;  3TWK A;  3GP1 A;  2EO2 A;  3U6P A;  2RTS A;  1Y8G A;  1YSY A;  3RGP A;  4LJ5 A;  1L2D A;  4I8O A;  1WXQ A;  1E9S A;  1OJL A;  3GPX A;  3R9X B;  1ZMU A;  3FUX A;  4FD2 A;  1DV0 A;  1TH2 A;  4DR1 M;  2A5Y B;  3IHP A;  4IJF A;  2DAE A;  1GLN A;  2DNA A;  1JB0 F;  5BPV A;  3FTF A;  1NV9 A;  4IBI A;  3JR4 A;  2BNK A;  4LF9 M;  1E6Z A;  1QDR A;  1QUT A;  2QPA A;  2ERC A;  3J2P B;  4X64 M;  1HQC A;  2QZ4 A;  3HWS A;  4PT5 A;  3FUU A;  5JI3 E;  1XWI A;  3VKG A;  3BXW A;  1ZMW A;  4FCW A;  4DV0 M;  2JE5 A;  4DR7 M;  4KLN A;  2D49 A;  2UU9 M;  1V92 A;  3V76 A;  2K47 A;  2MJ5 B;  2QBY A;  4JXJ A;  2L4F A;  3SAU A;  1OFI A;  3M0E A;  4TUW A;  1WHC A;  4GEW A;  2FS1 A;  4BLC A;  4HME A;  2ZAN A;  5EQT A;  1XMQ M;  1YU3 A;  1J09 A;  1K82 A;  2R0I A;  4P16 A;  3CTW B;  1IY1 A;  2CHV A;  2Z7J A;  2LH0 A;  4KO8 A;  1WJ7 A;  4NSO B;  2OOB A;  1IQP A;  3LCV B;  4NL4 H;  1MN3 A;  1DGF A;  4QHS A;  3H4J A;  4MB4 A;  4LJ6 A;  1DGB A;  4G3O A;  3PXG A;  3KS8 A;  4DR6 M;  1TDH A;  2KW0 A;  3EIE A;  5FTJ A;  1ZAE A;  4I5S A;  4YHH M;  4HMD A;  3GLG B;  2ZM6 M;  2JZ1 A;  3C3D A;  1WGN A;  1N32 M;  1G41 A;  4CGY B;  1N33 M;  1PJQ A;  3QYB A;  4GC5 A;  4Z2L A;  5IRE B;  1EE8 A;  2APL A;  4LJ7 A;  1MJG M;  2F5O A;  1YU0 A;  3HHX A;  2QQ8 A;  1H0G A;  3LW5 F;  4NZ5 A;  3T1H M;  3SC3 A;  1E15 A;  1CXW A;  4D81 A;  2L2D A;  1UR9 A;  2JP7 A;  3THG A;  4D82 A;  4XGI A;  2VF7 A;  3L27 A;  3SAV A;  4CIS A;  2E5L M;  3MMP A;  1HNW M;  2V1C A;  2I7P A;  3KFU G;  3A45 A;  3F92 A;  4JI7 M;  4NC6 A;  1FJG M;  5IT9 S;  4R71 A;  3QWL A;  1NO1 A;  1XNR M;  2DAG A;  3BBZ A;  4NOO B;  3QAU A;  2H1R A;  3KSJ A;  3KOX E;  1KSF X;  2O25 A;  1SXJ D;  2KZS A;  4LY6 A;  3HU3 A;  5IZ7 D;  1GJT A;  4UN2 B;  3W0L B;  4AW4 A;  4F1I A;  4GKK M;  3GRU A;  4DUZ M;  1SXJ E;  4LCB A;  5FTK A;  5A2Q S;  4WUR A;  5GKN A;  2DEN A;  2LWX A;  2BWE A;  3KSX A;  1PJI A;  1W5S A;  3WD2 A;  4Z2H A;  2KA6 B;  2CRU A;  2NQ8 C;  4BB9 A;  1R2Z A;  7CAT A;  4JI4 M;  2R46 A;  4NZ4 A;  1ZV1 A;  1I94 M;  1GOI A;  4Z8X A;  4MB5 A;  1GVN A;  4JV5 M;  1H8P A;  3GRY A;  2Y2K A;  3KW6 A;  3L25 A;  4RKU F;  4FWG A;  4B7H A;  3HSH A;  1PJJ A;  1XXH B;  1Z5B A;  3B7N A;  3DA1 A;  2HCB A;  3AOG A;  2QBY B;  2R65 A;  2Y2I A;  1YUB A;  5FTM A;  2KZU A;  1E6R A;  5FTL A;  1KYI A;  4REZ A;  1G71 A;  1T6O A;  1MU5 A;  1DGG A;  2C99 A;  2LNH C;  4X66 M;  2QSF X;  5ITX E;  1TF0 B;  5EP4 A;  2LVN C;  2K6B A;  3IG8 A;  2L7H A;  4DR5 M;  1V33 A;  2CV2 A;  2JCH A;  4OUI A;  2QHO B;  3PFI A;  4Z2K A;  1OAO C;  3GLF B;  2FFF B;  4MGZ E;  2ZAO A;  1R2Y A;  2IOU A;  2QEN A;  2BWB A;  3SFZ A;  4G4O A;  3MQL A;  1G8P A;  3WX7 A;  4JI0 M;  4M0W A;  5KO3 A;  4B3S M;  3ZQJ A;  1MX0 A;  1GJS A;  5C1B A;  1OGB A;  2O5R A;  3HU2 A;  4FVM A;  3LQQ A;  3RFW A;  3GLG A;  3GLI A;  1IBL M;  2OOA A;  4G4Q A;  2XEP A;  3U6D A;  1UR8 A;  1EFU B;  1QUS A;  2GQF A;  3KP0 E;  2C9O A;  3VK7 A;  1DGH A;  2JY6 B;  2UUB M;  4AKH A;  2DVW B;  1SXJ C;  1GO5 A;  1G59 A;  2HWJ A;  1WIV A;  4RNA A;  4QNM A;  5IWA M;  2FOI C;  3B89 A;  2Y2P A;  3MK6 A;  4HMC A;  4OU7 A;  1H6U A;  2YQZ A;  3M7P A;  2R6F A;  3KOW E;  2AHM A;  3JAM S;  3U60 B;  2LVO C;  1IXR C;  2D7E A;  3U61 B;  1R5L A;  2DZO B;  3I04 M;  3ZH9 B;  1DO0 A;  3GQ4 A;  4LJ4 A;  5EXT A;  1ZQ9 A;  4B7F A;  1GKI A;  4B08 A;  3GQ5 A;  4B7G A;  4GIP A;  1IBM M;  1XNQ M;  4NZ3 A;  1I4W A;  2L7I A;  3M7G A;  4LGM A;  1QAM A;  4M9Z A;  4LRS A;  4IBK A;  4DR4 M;  4II7 A;  1QZE A;  1IY0 A;  1VQ1 A;  2CE7 A;  4DUY M;  4KHP M;  2XSZ D;  5EJC A;  1W5T A;  2X49 A;  2R18 A;  1IM2 A;  2L4E A;  2R4J A;  3ZC7 B;  3I51 A;  1IN6 A;  3C9P A;  2ZTC A;  3HU1 A;  3Q8X A;  4GKJ M;  3U6C A;  1XXH E;  4MGH A;  4RF0 A;  4AZF A;  4WP2 A;  4DV1 M;  4DR3 M;  2F5S A;  4IBG A;  4OJL A;  2B3T A;  3UJN A;  3AOE C;  3GRV A;  2K9D A;  4FWH A;  4LG2 A;  2KEB A;  4NXM M;  1PRB A;  2Y2M A;  3KXE C;  2DKL A;  5FSW A;  1D0M A;  1IXZ A;  2LHG A;  1UM8 A;  2ZBK B;  2DAI A;  3A42 A;  3K2L A;  3NWL A;  2Y21 A;  2UUC M;  3J7A S;  4IBJ A;  3A98 B;  2O01 F;  3HJ8 A;  2ZAM A;  1HT1 E;  1SXJ B;  2DWZ B;  1N77 A;  1Z5A A;  1Z59 A;  4HEO A;  3U6O A;  2G3Q A;  2BJW A;  2GNO A;  3VFD A;  3GPU A;  1D0L A;  3SHF A;  4M9X A;  1RU3 A;  1Q3B A;  5KQ8 A;  4IJE A;  1KS0 A;  2G5G X;  1BVS A;  1NHG C;  3TWL A;  1NY6 A;  1P3Q Q;  2LVP C;  1DO2 A;  2HL7 A;  2KNZ A;  4AG5 A;  1IXS A;  1TGU A;  2XZU A;  4B3M M;  3Q8G A;  1E6P A;  3HY5 A;  2XFS A;  4G4N A;  2JY7 A;  4MM3 B;  1JQJ C;  3UZU A;  2RRU A;  2VDB B;  3FE3 A;  3UGJ A;  1R7R A;  1DGH B;  5E6J A;  1KFV A;  2VQE M; 
#chains in the Genus database with same CATH homology
 1NNU C;  4LJ8 A;  3AV0 A;  2DHR A;  4PD2 A;  3KS4 A;  1QAQ A;  2RGO A;  3UK6 A;  2Y20 A;  4OJO A;  2F5P A;  4GHL A;  2DXI A;  1L1Z A;  2XD1 A;  3J27 B;  4GIT A;  3U61 A;  3AFH A;  2EUC A;  1YUE A;  3TE6 A;  1NHW C;  5KQD A;  3GO8 A;  4JI8 M;  4K0K M;  4NYY A;  4DV6 M;  4DV3 M;  2X8A A;  4IBC A;  3WHL A;  4CHT B;  4AKI A;  3N3F A;  1L2B A;  2R45 A;  1GL6 A;  2KRU A;  3GLH B;  2BG1 A;  3WHK A;  3C58 A;  4LGY A;  3DFZ A;  2J7O A;  3TQS A;  1S3S A;  1IN5 A;  2C5R A;  4LFA M;  1N75 A;  4IBE A;  4QHT A;  3U6M A;  2VII A;  3SAW A;  3HHY A;  3MHV C;  3T38 A;  1N34 M;  4I4L A;  4LF5 M;  2UUA M;  4NRW A;  3TPZ A;  3DZD A;  1K3X A;  3U6L A;  2DWN A;  3GPY A;  3D8B A;  3HJQ A;  4JN6 A;  2C9C A;  2Q2E B;  3RE8 A;  2CHQ A;  2Y2H A;  3DOA A;  4AQY M;  3J7B A;  3TWM A;  4XBO A;  3I4Y A;  2RGH A;  1YU1 A;  2QP9 X;  1HQY E;  4DV7 M;  3FKE A;  4OJ6 A;  4MGI E;  1J7K A;  2F5Q A;  3L26 A;  3FYD A;  1T3T A;  2QCU A;  1IN4 A;  2C98 A;  2YFQ A;  1E94 E;  3MJ5 A;  5LMN M;  1YE9 A;  4DV5 M;  4LF7 M;  5FLX S;  3E4R A;  3TL4 X;  1Q3C A;  3GQ3 A;  3SMP A;  3KDS E;  5EP1 A;  3SYL A;  3HGI A;  4OJ5 A;  4QOS A;  3FUT A;  5ITX A;  3R8F A;  2UXD M;  4MGY E;  2JA2 A;  1HNZ M;  4NY2 A;  3L2A A;  4BBA A;  1L2C A;  1IXS B;  4L16 A;  1NNJ A;  1YU4 A;  4MB7 A;  1C1K A;  4HLQ A;  3AKZ A;  3ILK A;  3SMS A;  3KOZ E;  3AOE A;  3K92 A;  4LJA A;  4DV4 M;  3RGS A;  3SAS A;  4L8R C;  2XH9 A;  3HHW A;  2XLJ A;  1Q39 A;  1XMO M;  1NSF A;  3E9S A;  4LF4 M;  3KOY E;  3VDU A;  1TDZ A;  2DWM A;  5ITY A;  1R6B X;  3IG5 A;  3B9P A;  2FE8 A;  3KVW A;  4PDI A;  2YNM D;  2XFT A;  2HHH M;  2G8L A;  3JR5 A;  3GLH A;  3D8L A;  2W82 A;  1FNN A;  3FYC A;  3VDP A;  4LJ9 A;  3PNV A;  1QVR A;  4OJP A;  5JI2 E;  3VKH A;  3L28 A;  2D7G A;  3PVS A;  2DZN B;  2LXE A;  2Y0T A;  4IBD A;  4KOD A;  4OW0 A;  2OQ4 A;  4I81 A;  3W0F A;  5DNY A;  4R3D A;  3HKP A;  4PCZ A;  1XXH A;  3OTO M;  3PNY A;  3SAT A;  4B3T M;  1TH4 A;  4QOZ C;  2Y2O A;  3HON A;  1K3W A;  1QAN A;  1XC8 A;  4JYA M;  4PDG A;  5ITR A;  4OVZ B;  1L1T A;  1NJF A;  1YU2 A;  2C96 A;  2R62 A;  5H37 D;  2UWX A;  1OFH A;  4NSR A;  4NXN M;  3U6E A;  2Y2Q A;  4LFC M;  2OPF A;  2XZF A;  4NZ1 A;  5DYG A;  4LRT A;  3FTD A;  4D80 A;  2UXB M;  1IN8 A;  3U6S A;  2CV0 A;  3GLI B;  1Z5C A;  5BR8 M;  4FWD A;  4MGK E;  4GRI A;  4JI3 M;  5F3W A;  1QYR A;  1Z6T A;  4S12 A;  3LMM A;  4FCT A;  1XHB A;  2J7N A;  2RKO A;  4M0D A;  2KXE A;  1D2N A;  3J80 S;  5FTN A;  5EP2 A;  3AJI B;  3UMM A;  4LFB M;  3U60 A;  4A3V B;  4X65 M;  2XD5 A;  3FTE A;  4AKG A;  2VQF M;  4JI2 M;  2F5N A;  5ITQ A;  3GPP A;  3GLF A;  2X4A A;  4B3R M;  2HKJ A;  2CV1 A;  4RF1 A;  4FCV A;  3CF2 A;  2M5Z A;  1NJG A;  2V1U A;  4QNR A;  2EA0 A;  1IBK M;  1E9R A;  1GL7 A;  1NY5 A;  4NRV A;  3BOS A;  3HHZ A;  5LMU M;  3FTC A;  3U5Z B;  4L4U A;  1QAO A;  4OX9 M;  3L29 A;  4G6Z A;  4EIW A;  4M9S A;  1J5E M;  2KRK A;  4JI5 M;  3U6Q A;  3H4M A;  1G4A E;  3VK8 A;  2R4E A;  2DWL A;  1JR3 A;  4X62 M;  4G4R A;  5EXX A;  3SBJ A;  2CEA A;  3KP1 E;  2CHG A;  3HJS A;  2Y2G A;  2V6Z M;  4LZJ A;  4Z6Y A;  1QZM A;  2FFJ A;  5KPR A;  2I7N A;  4YY3 M;  1SXJ A;  1QQW A;  1LV7 A;  5EXS A;  4OVZ A;  5KPZ A;  2Z4R A;  4WW0 A;  1E32 A;  4NYU A;  4MH0 E;  4ITQ A;  2Y2L A;  4LF8 M;  3GRR A;  3K1J A;  2M60 A;  4R7G A;  1N36 M;  4GH9 A;  3AL0 C;  1TH3 A;  4L78 A;  3J81 S;  3T1Y M;  5C18 A;  3SHG B;  3LVW A;  2P5T A;  1VDD A;  4LZZ A;  3FUV A;  3T15 A;  2Y0Q A;  4IIW A;  2UXC M;  3CF0 A;  4DV2 M;  2XF3 A;  4FW9 A;  4L15 A;  4GC9 A;  2CUZ A;  4HL4 A;  4GMQ A;  3SAR A;  3NBI A;  4IBB A;  1L8Q A;  5E26 A;  3A46 A;  2Y2J A;  2XGN A;  2F4V M;  4GHA A;  3K8Z A;  5KPT A;  1HT2 E;  2BJV A;  4JI6 M;  1N78 A;  2YR0 A;  2FNA A;  8CAT A;  5ITT A;  2Z3X A;  2Z4S A;  3SYK A;  2D7H A;  5DYI A;  1PM5 A;  3FD9 A;  1ORY B;  2XSZ A;  1IY2 A;  3CF6 E;  3LQR A;  2L09 A;  5EP3 A;  4JI1 M;  4LF6 M;  1JR3 D;  1X37 A;  4W5W A;  3U5Z A;  2CFO A;  3EIH A;  3I4V A;  3VLF B;  1G3I A;  5EXP A;  3ZCB B;  5ITU A;  4AG6 A;  3FUW A;  4QNL A;  1IN7 A;  1NVM A;  4ZPX A;  3M6A A;  2Y2N A;  1HR0 M;  2L6O A;  4DR2 M;  3LVV A;  1HNX M;  4IBF A;  3TWK A;  3GP1 A;  2EO2 A;  3U6P A;  1YSY A;  3RGP A;  4LJ5 A;  1L2D A;  4I8O A;  1WXQ A;  1E9S A;  1OJL A;  3GPX A;  3R9X B;  3FUX A;  4FD2 A;  1TH2 A;  4DR1 M;  2A5Y B;  4IJF A;  1GLN A;  5BPV A;  3FTF A;  3JR4 A;  4IBI A;  2BNK A;  4LF9 M;  2QPA A;  2ERC A;  3J2P B;  4X64 M;  1HQC A;  2QZ4 A;  3HWS A;  4PT5 A;  3FUU A;  5JI3 E;  1XWI A;  3VKG A;  4DV0 M;  4FCW A;  2JE5 A;  4DR7 M;  4KLN A;  2UU9 M;  2K47 A;  2QBY A;  4JXJ A;  3SAU A;  1OFI A;  3M0E A;  4TUW A;  4BLC A;  2ZAN A;  5EQT A;  1XMQ M;  1YU3 A;  1J09 A;  1K82 A;  4P16 A;  3CTW B;  1IY1 A;  2CHV A;  2Z7J A;  2LH0 A;  4KO8 A;  4NSO B;  1IQP A;  4NL4 H;  1DGF A;  4QHS A;  4LJ6 A;  1DGB A;  3PXG A;  3KS8 A;  4DR6 M;  1TDH A;  2KW0 A;  3EIE A;  5FTJ A;  1ZAE A;  4I5S A;  4YHH M;  3GLG B;  2ZM6 M;  1N32 M;  1G41 A;  4CGY B;  1N33 M;  4GC5 A;  5IRE B;  1EE8 A;  4LJ7 A;  2F5O A;  1YU0 A;  3HHX A;  4NZ5 A;  3T1H M;  3SC3 A;  4D81 A;  3THG A;  4D82 A;  4XGI A;  3L27 A;  3SAV A;  4CIS A;  2E5L M;  1HNW M;  2V1C A;  2I7P A;  3KFU G;  3A45 A;  4JI7 M;  1FJG M;  5IT9 S;  3QWL A;  1XNR M;  4NOO B;  3QAU A;  2H1R A;  3KSJ A;  3KOX E;  1KSF X;  4AI6 A;  1SXJ D;  2KZS A;  4LY6 A;  3HU3 A;  5IZ7 D;  3W0L B;  4AW4 A;  3GQ5 A;  4GKK M;  3GRU A;  4DUZ M;  1SXJ E;  4LCB A;  5FTK A;  5A2Q S;  4WUR A;  5GKN A;  2LWX A;  3KSX A;  1PJI A;  1W5S A;  2KA6 B;  2NQ8 C;  4BB9 A;  1R2Z A;  4JI4 M;  7CAT A;  2R46 A;  4NZ4 A;  1I94 M;  4Z8X A;  1GVN A;  4JV5 M;  3GRY A;  2Y2K A;  3KW6 A;  3L25 A;  4FWG A;  4B7H A;  3HSH A;  1PJJ A;  1XXH B;  1Z5B A;  3DA1 A;  2HCB A;  3AOG A;  2QBY B;  2R65 A;  2Y2I A;  1YUB A;  5FTM A;  2KZU A;  5FTL A;  1KYI A;  4REZ A;  1MU5 A;  1DGG A;  2C99 A;  2LNH C;  4X66 M;  5ITX E;  5EP4 A;  3IG8 A;  2L7H A;  4DR5 M;  2CV2 A;  2JCH A;  4OUI A;  3PFI A;  3GLF B;  2FFF B;  4MGZ E;  2ZAO A;  1R2Y A;  2IOU A;  2QEN A;  3SFZ A;  4G4O A;  1G8P A;  3WX7 A;  4JI0 M;  4M0W A;  5KO3 A;  4B3S M;  1MX0 A;  5C1B A;  2O5R A;  3HU2 A;  4FVM A;  3LQQ A;  3RFW A;  3GLG A;  3GLI A;  1IBL M;  4G4Q A;  2XEP A;  3U6D A;  3KP0 E;  3VK7 A;  2C9O A;  1DGH A;  2UUB M;  4AKH A;  2DVW B;  1SXJ C;  1G59 A;  4RNA A;  4QNM A;  5IWA M;  2FOI C;  2Y2P A;  3MK6 A;  4OU7 A;  1H6U A;  2YQZ A;  3KOW E;  2AHM A;  3JAM S;  3U60 B;  1IXR C;  2D7E A;  3U61 B;  2DZO B;  3ZH9 B;  1DO0 A;  3GQ4 A;  4LJ4 A;  5EXT A;  1ZQ9 A;  4B7F A;  1GKI A;  4B08 A;  1IBM M;  4B7G A;  4GIP A;  1XNQ M;  4NZ3 A;  1I4W A;  2L7I A;  3M7G A;  4LGM A;  1QAM A;  4M9Z A;  4LRS A;  4IBK A;  4DR4 M;  4II7 A;  1IY0 A;  2CE7 A;  4DUY M;  4KHP M;  2XSZ D;  5EJC A;  1W5T A;  2X49 A;  2R18 A;  1IM2 A;  2R4J A;  3ZC7 B;  3I51 A;  1IN6 A;  3HU1 A;  3Q8X A;  4GKJ M;  3U6C A;  4MGH A;  4RF0 A;  4AZF A;  4DV1 M;  4DR3 M;  2F5S A;  4IBG A;  4OJL A;  3UJN A;  3AOE C;  3GRV A;  4NXM M;  4FWH A;  4LG2 A;  2KEB A;  2Y2M A;  3KXE C;  5FSW A;  1IXZ A;  1UM8 A;  2ZBK B;  3A42 A;  3K2L A;  3NWL A;  2Y21 A;  2UUC M;  3J7A S;  4IBJ A;  3A98 B;  3HJ8 A;  2ZAM A;  1HT1 E;  1SXJ B;  2DWZ B;  1N77 A;  1Z5A A;  1Z59 A;  3U6O A;  2BJW A;  3VFD A;  3GPU A;  3SHF A;  4M9X A;  5KQ8 A;  1Q3B A;  4IJE A;  2G5G X;  1NHG C;  3TWL A;  1NY6 A;  1DO2 A;  2HL7 A;  4AG5 A;  1TGU A;  2XZU A;  4B3M M;  2XFS A;  4G4N A;  4MM3 B;  1JQJ C;  3UZU A;  3UGJ A;  1R7R A;  1DGH B;  5E6J A;  1KFV A;  2VQE M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...