4GHLA

Structural basis for marburg virus vp35 mediate immune evasion mechanisms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFMGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords short palindromic RNA AGACAGCAUAUGCUGUCU
publication title Structural basis for Marburg virus VP35-mediated immune evasion mechanisms.
pubmed doi rcsb
source organism Lake victoria marburgvirus
molecule tags Transcription, viral protein/rna
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ghlA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ghlA02
4IBEA 4GH9A 4IBKA 3L29A 3L27A 4IJEA 3KS8A 4GHLA 4GHAA 4IJFA 3L26A 4IBBA 4IBDA 3L25A 3KS4A 3FKEA 3L2AA 4LG2A 4IBGA 4IBIA 4IBCA 3L28A 4IBJA 5BPVA 4IBFA
chains in the Genus database with same CATH superfamily
3GP1A 3AKZA 2QZ4A 2R65A 4TX8A 2LHCA 1VDDA 1NY5A 1HNWM 1KS0A 1O6IA 2L7HA 2WSEF 4GIPA 4B7HA 5ITUA 3GPYA 3VK7A 3FUTA 4WP2A 3VKHA 1OAOC 1W1VA 3HKPA 1QDTA 1E6PA 1J7MA 1YU2A 2R4JA 2A5YB 4QNMA 4MGIE 1R6BX 3MJ5A 2Z4SA 1IY1A 3ILKA 4YHHM 2RGOA 4Q7JA 2R44A 2XD1A 1ZMVA 4NZ4A 5KO3A 4Z6YA 2QCUA 2FS1A 2OO9A 2Z4RA 4MB4A 1E88A 3CF0A 1IY0A 4IBJA 3HHZA 2DWNA 1SG9A 3FRHA 4Z8XA 3I01M 1IBMM 3K2LA 1NY6A 4NXMM 2EO2A 1NHGC 3A46A 2DWLA 4X65M 4LY6A 4F1IA 4DR7M 1YU3A 5DFLA 2FFFB 4DR6M 1OIZA 3TPZA 1OGGA 1W1TA 2LVQD 2C98A 4GH9A 1K82A 3T38A 1R7RA 4QNRA 4MB5A 1Z5AA 3D8BA 2ZM6M 2Y2PA 2YNMD 4JI6M 2L2DA 3KS8A 1XB2B 3GLHE 3PFIA 2M5ZA 2DHRA 3U60B 4HMCA 4NZ1A 1SXJD 2CV2A 1GPFA 5FTJA 1SXJE 2DAKA 1L2DA 4P16A 1VDLA 3U6CA 3GRRA 2I7PA 3HWSA 2D49A 1TDHA 2ZTCA 3E46A 4D81A 4DR4M 1PM5A 4HMEA 1VEKA 4OJLA 3I04M 2EJSA 3L28A 1AUAA 1DO2A 3CF2A 3VFDA 3U6SA 1XXHA 3ZC7B 1DGFA 1Z59A 5EP4A 2VDBB 4XK8F 3B74A 3U61A 2RTSA 3IG8A 1J5EM 1GXDA 1WHCA 5DNYA 2UUBM 4LGYA 2X49A 1N78A 4DV3M 1IXRC 2CEAA 2V6ZM 2KA6B 3K9PA 4JV5M 2C9OA 1DO0A 1LTMA 2H1RA 2QQ8A 4NRWA 2L6OA 4NYUA 4FVMA 4JI0M 5FSWA 4AKHA 4D80A 1OGBA 1ZV1A 4ZPXA 3MHVC 1PJSA 4RKUF 2QP9X 3FTDA 4B08A 1GVNA 2JY8A 5JI3E 4IBDA 4LF9M 2AHMA 2ZAOA 4NSOB 3GLFE 1D0MA 1D0LA 1IN6A 1IXSB 4LF7M 2DI0A 4Z2JA 1VEJA 3HU1A 2APLA 3I4VA 4NL4H 3KP1E 2VF7A 5LMNM 3GPUA 4L6V6 4OUIA 1YE9A 1R2ZA 3C3DA 1E6NA 2R62A 2JY5A 3SMSA 1QZMA 4PT5A 3U6DA 1R5LA 2L4FA 4B3SM 3AL0C 2HCBA 1UR9A 3CF6E 5FTKA 3J7AS 3T15A 3WD3A 4IJEA 1NJFA 1QUTA 2L4EA 3GQ4A 2DAIA 3PVSA 1IFYA 3GLHA 4PDGA 4GHAA 4NOOB 1ZMWA 2HHHM 2V1CA 1T3TA 3FUXA 1ED7A 2L7IA 4XGIA 1NV9A 3FE3A 2H5XA 2Y2JA 2MJ5B 2R4EA 5JI2E 4IBGA 2RRUA 1GLNA 3GLIA 3QAUA 2JNHA 2Y2OA 2Y2IA 1EE8A 1DGHA 2QBYB 5BR8M 4KO8A 5EXTA 3WD0A 1L1ZA 5FTNA 2Q2EB 3KOYE 3SMPA 3IECA 1GKIA 3TWMA 4MB7A 4PCZA 1HQYE 1KSFX 2XFTA 2G5GX 1T6OA 2YFQA 1XWIA 2CUZA 2J5YA 5C1BA 2G8LA 3UK6A 4D82A 3JAMS 4Z2IA 4HMDA 2KXEA 2DZLA 2DZNB 2XFSA 1ZMUA 2YR0A 3SATA 2Y20A 1Y8GA 4JXJA 4A3VB 1N32M 3LQRA 3OTOM 2IOUA 4NY2A 1K3WA 2JP7A 3E9SA 3JR5A 2Y2KA 4DV1M 2VQEM 2R45A 4LF6M 3KVWA 2CHVA 3W67A 4TUWA 1XHBA 1G3IA 3HGIA 1MN3A 2WSFF 1MJGM 8CATA 1N34M 2OQ4A 3WHLA 4JI3M 4MB3A 1Z6TA 3SYLA 3TWKA 4LFCM 3LCUA 4G4RA 2JZ0A 3RGPA 1G71A 1PJTA 4IJFA 5F3WA 4NXNM 4M0DA 5KQDA 4JI1M 3T6PA 1IXZA 2QNJA 2ZTDA 4MGYE 3RFWA 4Z2GA 2K6BA 4I81A 1QUSA 2N35A 1SXJC 4L78A 1L1TA 4W5WA 5ITXE 3L2AA 2LHGA 3KOZE 1A5TA 2ZAMA 4P17A 4WW0A 3I51A 2OPFA 4RF0A 4LJAA 4LZZA 2O01F 1VEGA 4X62M 2Z8YM 2WSCF 2P5TA 2DWZB 3Q8XA 5EP2A 1FNNA 2LTUA 1OIPA 2J7NA 1IN8A 2LXEA 2QHOB 2XSZA 4AG6A 4ANRA 3GQ5A 2UU9M 1V33A 4IBEA 3TWLA 4CHTB 4LCBA 2XZFA 5KQ8A 2OOAA 2LVPC 1XXHB 1YLAA 3L27A 3LMMA 1GL7A 4I5SA 3ZH9B 4MGZE 3SC3A 3GQ3A 2F5OA 4NZ5A 3U61B 2Y2HA 1Q3BA 2MH8A 3GLGB 3SAVA 1PJIA 1PRBA 1QDRA 3VKGA 3GPPA 3Q8GA 3DZDA 1GJSA 1IY2A 4G4QA 1E32A 4F2LA 1L8QA 2DWMA 1JQJC 2BG1A 3UZUA 1NNUC 1NJGA 3A45A 3A42A 4XBOA 1IBKM 4LJ9A 3SYKA 1HNZM 4B3RM 4BB9A 1QAOA 4LFAM 1HT1E 4MGHA 4QOZC 3U6LA 2CE7A 5ITQA 3GRYA 3K9OA 1C1KA 3GLGA 1QZEA 3SARA 1DGBA 3A98B 3JR4A 2JXNA 3NWLA 4DUZM 2DENA 1HR0M 4AKIA 5E26A 2R0IA 1WIVA 1QANA 2EKKA 3GRUA 3IHPA 5FTMA 4G3OA 1T43A 5ITTA 1GO5A 3AOGA 2LVAA 1GJTA 1JR3D 3HHWA 3H4JA 1JR3E 3AJIB 3HU3A 2QENA 4PDIA 4DV6M 3K8ZA 3NBXX 4JI4M 2MROB 1IQPA 3C58A 2R18A 1N33M 1OFHA 3F92A 4Z2KA 4NYYA 3QYEA 1V34A 2DZOB 4DV0M 3KOXE 2DHYA 1QQWA 3I4YA 3FTEA 5LMUM 4LRTA 1KYIA 4RNAA 4QHTA 1H0GA 2LH0A 4ITQA 4CGYB 3EIHA 1HNXM 1E8BA 1W1PA 2RGHA 3LVWA 3GLHB 1NSFA 3KW6A 4LJ5A 3U5ZA 3PNYA 3KFUG 4JYAM 2BJVA 1N36M 1OTRA 4HL4A 4LFBM 1EFUB 1I4WA 3BXWA 3DA1A 2Y21A 3RGSA 4JI7M 3T1YM 1XNRM 1YU1A 2DXIA 2I7NA 3GLIB 2KRUA 3AOEA 1H6UA 3KOWE 1IN4A 1OKSA 1QYRA 1N75A 4GEWA 4AQYM 2UUAM 1DGHB 1PDCA 1EAKA 4GHLA 4AI6A 2ERCA 2K47A 2F5NA 3WX7A 1P3QQ 3LVVA 1WJ7A 1GOIA 1E15A 2FFJA 2JZ1A 2BNKA 1IN5A 2BJWA 3H4MA 4G6ZA 4IBBA 4R3DA 5KPZA 3B7ZA 3SFZA 1Z5CA 2D7GA 5DYIA 4X64M 4OU7A 1K3XA 5IWAM 1YUEA 1SXJA 3FKEA 2E5LM 2DKLA 2KZUA 3UJNA 4G4OA 2V5OA 4II7A 2LNHC 4Z2HA 4AG5A 3M0EA 3HSHA 1TTEA 3GRVA 3GO8A 2KW0A 3D8LA 1QAMA 3CGWA 1YSYA 2XD5A 1Q3CA 2JWSA 3KDSE 4CJ6A 3R9XB 1W5SA 1PJQA 1TH3A 2HL7A 3HJQA 1Q39A 4L4UA 4DV2M 2K9DA 4M0WA 1CXWA 2CHQA 2FH0A 2JE5A 2FE8A 2DAEA 5IREB 3THGA 4R71A 2F4VM 1FJGM 1EIJA 1KFVA 1NO1A 3QYBA 3HZJA 1E6RA 3L25A 3AV0A 4DBGB 1TR8A 2DVWB 3KXEC 4HLQA 3IG5A 1XMOM 4LG2A 1GL6A 4IBIA 4JI2M 3GLFA 3MMPA 4JI5M 1OFIA 4MM3B 4DR5M 4NRVA 5BPVA 2UXDM 3LQQA 1WGLA 2XGNA 3HJ8A 2EA0A 3T1HM 1HJPA 3WHKA 2KDLA 2VIIA 4OJ5A 4WURA 3KSJA 2NQ8C 2LVOC 4B3MM 4RF1A 4OJOA 3TL4X 5KPRA 3AOEC 1DGGA 2EKFA 1HT2E 1E9SA 4DUYM 2F5SA 1Q02A 4G4NA 3AFHA 3ZQJA 1RU3A 2BWBA 2LVNC 3UMMA 3KP0E 3BBZA 4KLNA 1XXHE 2KNZA 5EP3A 3EIEA 2Z3XA 4GITA 4FCVA 1OAIA 3U6PA 1NNJA 4DR1M 1TDZA 4LJ6A 1S3SA 2L09A 5E6JA 5C18A 5A2QS 4IIWA 3SAUA 4K0KM 1OJLA 2O25A 3C9PA 3FYCA 3DOAA 2EUCA 2C96A 4JN6A 1H0IA 2CFOA 4QHSA 4X66M 2Y2MA 2KEBA 3PXGA 5ITRA 3WD1A 3B7NA 1X37A 3ZCBB 2V1UA 3HHYA 1OQYA 2C99A 2QSFX 3M7GA 2LWXA 4FWGA 4NC6A 2QPAA 3GPXA 4DR3M 4LF4M 2KRKA 2C9CA 4LGMA 5L8RF 1AIPC 5KPTA 3HONA 1E94E 4FD2A 2R46A 4KT0F 1W1YA 2YQZA 4S12A 2MGWA 1D2NA 4B7GA 4L8RC 2LBCA 4LF5M 2UXBM 4GMQA 3W0FA 1BVSA 2FNAA 4QNLA 4M9ZA 2F5PA 1TH4A 4REZA 5EQTA 3UGJA 4AW4A 4OJ6A 2Y2GA 2KHHA 4DR2M 1L6JA 1YU4A 3QWLA 3HHXA 1J09A 1I94M 3FUWA 2ZBKB 1IM2A 3VDUA 4M9SA 3VK8A 3RE8A 3PNVA 4FW9A 4OW0A 1W5TA 2K0BX 3FRIA 1G4AE 2ZANA 2MR9A 3J80S 1E6ZA 4HEOA 3DFZA 3U6QA 4JI8M 2Y0TA 3U5ZB 1J7KA 2HKJA 3FD9A 3J7BA 4LJ8A 4FWDA 4B7FA 4OX9M 3FTCA 1UR8A 2X4AA 2DAMA 3CTWB 5GKNA 2DAGA 3KS4A 3GLIE 3TQSA 4CISA 3SBJA 3U6OA 1L2BA 2UWXA 1ZQ9A 2R6FA 3FUUA 4LJ7A 4MGKE 5H37D 1D0KA 1UM8A 3HJSA 4FCWA 5EXXA 2Y2LA 2GNOA 4GKKM 1GABA 1XMQM 2VF8A 5ITXA 1L2CA 4FCTA 1IBLM 3U60A 2Y2QA 3J81S 1LV7A 2CRUA 3NBIA 3J2PB 5EJCA 3M7PA 1TGUA 1VQ1A 1IN7A 1SXJB 3VDPA 2Y0QA 2M60A 4LRSA 2CP8A 1V92A 3SHGB 2HAKA 3L29A 4M9XA 3SAWA 4Z2LA 4DV5M 2BWEA 1R2YA 1G41A 1Z5BA 4EIWA 2KNAA 2W82A 2JY7A 1NVMA 3WD2A 1CK7A 3MQLA 4AKGA 3HX3A 4AZFA 4NZ3A 4GC5A 1XNQM 1G8PA 4CIZA 2RKOA 3K1JA 4Y28F 4KHPM 2JUJA 2CV0A 4R7GA 1YUBA 2G3QA 1PJJA 4LJ4A 4IBCA 4GC9A 4L15A 1QAQA 1R4GA 3BOSA 2JA2A 4B3TM 3C3EA 5IZ7D 4YY3M 3TE6A 4UN2B 2WZJA 5DYGA 2FOIC 2Y2NA 1G59A 2O5RA 3W68A 2XZUA 2XH9A 4IBKA 3J27B 3B9PA 3U6MA 3GLFB 2C5RA 1N77A 2CHGA 1QVRA 3SHFA 5EP1A 2OOBA 3N3FA 1DV0A 1IXSA 2F5QA 3V76A 3FYDA 1TF0B 2DNAA 1JR3A 2FN2A 4LF8M 3M6AA 4NSRA 4DV7M 3E21A 3B89A 4GRIA 1MX0A 2HWJA 4OVZB 1ORYB 2CV1A 2GQFA 2UUCM 1HQCA 2XSZD 4L16A 3B7QA 1VG5A 5FTLA 2KZSA 2XF3A 1WGNA 3MK6A 2X8AA 3W0LB 1UFZA 2VQFM 3K92A 4LZJA 4BBAA 2CWBA 4I4LA 1CUKA 2B3TA 4GKJM 1NV8A 4MH0E 4PD2A 2Z7JA 2D7HA 1WXQA 1F4IA 3LCVB 3R8FA 4FWHA 1YU0A 1ZAEA 5IT9S 3VLFB 3SASA 7CATA 5EXPA 5ITYA 2JY6B 1TH2A 2XEPA 3LW5F 1WR1B 4OVZA 3FTFA 2D7EA 3WD4A 4QOSA 3HU2A 2XLJA 4DV4M 2QBYA 3L26A 2JCHA 1E9RA 1H8PA 3HY5A 5EXSA 4BLCA 2J7OA 4OJPA 3FUVA 3U6EA 1JB0F 2KNVA 1NHWC 3KSXA 4KODA 5FLXS 1XC8A 4I8OA 1C7YA 3E4RA 2UXCM 1AIWA 1MU5A 3GLGE 1QO6A 4IBFA 1PGYA
chains in the Genus database with same CATH topology
3GP1A 3AKZA 2QZ4A 2R65A 1VDDA 1NY5A 1HNWM 2L7HA 4B7HA 4GIPA 5ITUA 3GPYA 3VK7A 3FUTA 3VKHA 3HKPA 1YU2A 2R4JA 2A5YB 4QNMA 4MGIE 1R6BX 3MJ5A 2Z4SA 1IY1A 3ILKA 4YHHM 2RGOA 2XD1A 4NZ4A 5KO3A 4Z6YA 2QCUA 2Z4RA 3CF0A 1IY0A 4IBJA 3HHZA 2DWNA 4Z8XA 1IBMM 3K2LA 1NY6A 4NXMM 2EO2A 1NHGC 3A46A 2DWLA 4X65M 4LY6A 1YU3A 4DR7M 2FFFB 4DR6M 3TPZA 2C98A 4GH9A 1K82A 3T38A 1R7RA 4QNRA 1Z5AA 3D8BA 2ZM6M 2Y2PA 2YNMD 4JI6M 3PFIA 3U60B 2M5ZA 2DHRA 4NZ1A 1SXJD 2CV2A 5FTJA 1SXJE 1L2DA 4P16A 3U6CA 3GRRA 2I7PA 3HWSA 1TDHA 4D81A 4DR4M 1PM5A 4OJLA 3L28A 3VFDA 1DO2A 3CF2A 3U6SA 1XXHA 3ZC7B 1DGFA 1Z59A 5EP4A 3U61A 3IG8A 1J5EM 5DNYA 2UUBM 4LGYA 2X49A 1N78A 4DV3M 1IXRC 2CEAA 2V6ZM 2KA6B 4JV5M 2C9OA 1DO0A 2H1RA 4NRWA 4NYUA 2L6OA 4FVMA 4JI0M 5FSWA 4AKHA 4D80A 4ZPXA 3MHVC 2QP9X 3FTDA 4B08A 1GVNA 5JI3E 4IBDA 4LF9M 2AHMA 2ZAOA 4NSOB 1IN6A 1IXSB 3I4VA 3HU1A 4NL4H 3KP1E 5LMNM 3GPUA 4OUIA 1YE9A 1R2ZA 2R62A 3SMSA 1QZMA 4PT5A 3U6DA 4B3SM 3AL0C 2HCBA 3CF6E 5FTKA 3J7AS 3T15A 4IJEA 1NJFA 3GQ4A 3PVSA 3GLHA 4PDGA 4GHAA 4NOOB 2HHHM 2V1CA 1T3TA 3FUXA 2L7IA 4XGIA 2Y2JA 2R4EA 5JI2E 4IBGA 1GLNA 3GLIA 3QAUA 2Y2OA 2Y2IA 1EE8A 1DGHA 2QBYB 5BR8M 4KO8A 5EXTA 1L1ZA 5FTNA 2Q2EB 3KOYE 3SMPA 1GKIA 3TWMA 4MB7A 4PCZA 1HQYE 1KSFX 2XFTA 2G5GX 2YFQA 1XWIA 2CUZA 5C1BA 2G8LA 3UK6A 4D82A 3JAMS 2KXEA 2DZNB 2XFSA 3SATA 2YR0A 2Y20A 4JXJA 4A3VB 1N32M 3LQRA 3OTOM 2IOUA 4NY2A 1K3WA 3JR5A 3E9SA 2Y2KA 4DV1M 2VQEM 2R45A 4LF6M 3KVWA 2CHVA 4TUWA 1XHBA 1G3IA 3HGIA 1N34M 8CATA 2OQ4A 3WHLA 4JI3M 1Z6TA 3SYLA 3TWKA 4LFCM 4G4RA 3RGPA 5F3WA 4IJFA 4NXNM 4M0DA 5KQDA 4JI1M 1IXZA 4MGYE 3RFWA 4I81A 4L78A 1SXJC 1L1TA 4W5WA 5ITXE 3L2AA 3KOZE 4WW0A 2ZAMA 2OPFA 3I51A 4RF0A 4LJAA 4LZZA 4X62M 2P5TA 2DWZB 3Q8XA 5EP2A 1FNNA 2XSZA 2J7NA 4AG6A 1IN8A 2LXEA 3GQ5A 2UU9M 2XZFA 4IBEA 3TWLA 4CHTB 4LCBA 5KQ8A 1XXHB 3L27A 3LMMA 4I5SA 1GL7A 3ZH9B 2F5OA 4MGZE 3SC3A 3GQ3A 4NZ5A 3U61B 2Y2HA 1Q3BA 3GLGB 3SAVA 1PJIA 3GPPA 3DZDA 1IY2A 4G4QA 1E32A 1L8QA 2DWMA 1JQJC 2BG1A 3UZUA 1NNUC 1NJGA 3A45A 3A42A 4XBOA 1IBKM 4LJ9A 3SYKA 1HNZM 4B3RM 4BB9A 1QAOA 4LFAM 1HT1E 4MGHA 4QOZC 3U6LA 2CE7A 5ITQA 3GRYA 1C1KA 3GLGA 3SARA 1DGBA 3A98B 3JR4A 3NWLA 4DUZM 1HR0M 4AKIA 5E26A 3GRUA 5FTMA 1QANA 5ITTA 3AOGA 1JR3D 3HHWA 3HU3A 3AJIB 4DV6M 4JI4M 2QENA 4PDIA 3KS8A 3K8ZA 3C58A 1IQPA 2R18A 1N33M 1OFHA 4NYYA 2DZOB 4DV0M 3KOXE 1QQWA 3I4YA 3FTEA 5LMUM 4LRTA 1KYIA 4RNAA 4QHTA 2LH0A 4ITQA 4CGYB 3EIHA 1HNXM 2RGHA 3LVWA 3GLHB 1NSFA 3KW6A 4LJ5A 3U5ZA 3PNYA 3KFUG 4JYAM 2BJVA 1N36M 4HL4A 1I4WA 3DA1A 2Y21A 3RGSA 4JI7M 3T1YM 1XNRM 1YU1A 2DXIA 2I7NA 3GLIB 2KRUA 3AOEA 1H6UA 3KOWE 1IN4A 1QYRA 2UUAM 1N75A 4LF7M 4AQYM 1DGHB 4GHLA 4AI6A 2ERCA 2K47A 2F5NA 3WX7A 3LVVA 2FFJA 4G6ZA 2BNKA 1IN5A 2BJWA 3H4MA 4IBBA 4R3DA 5KPZA 4X64M 3VKGA 3SFZA 1Z5CA 2D7GA 5DYIA 4OU7A 1K3XA 5IWAM 1YUEA 1SXJA 3FKEA 2E5LM 2KZUA 3UJNA 4G4OA 4II7A 2LNHC 4AG5A 3M0EA 3HSHA 3GRVA 3GO8A 2KW0A 3D8LA 1QAMA 1YSYA 2XD5A 1Q3CA 3R9XB 3KDSE 1W5SA 1TH3A 3HJQA 2HL7A 1Q39A 4L4UA 4DV2M 4M0WA 2CHQA 2JE5A 2FE8A 5IREB 3THGA 2F4VM 1FJGM 1KFVA 3L25A 3AV0A 2DVWB 3KXEC 4HLQA 3IG5A 1XMOM 4LG2A 1GL6A 4IBIA 4JI2M 3GLFA 4JI5M 1OFIA 4MM3B 4DR5M 4NRVA 5BPVA 2UXDM 3LQQA 2XGNA 3HJ8A 2EA0A 3T1HM 3WHKA 2VIIA 4OJ5A 4WURA 3KSJA 2NQ8C 4B3MM 4RF1A 4OJOA 3TL4X 5KPRA 3AOEC 1DGGA 1HT2E 1E9SA 4DUYM 2F5SA 4G4NA 3AFHA 3UMMA 3KP0E 4KLNA 5EP3A 3EIEA 2Z3XA 4GITA 4FCVA 3U6PA 1NNJA 4DR1M 1TDZA 4LJ6A 1S3SA 2L09A 5E6JA 5C18A 5A2QS 4IIWA 3SAUA 4K0KM 1OJLA 3FYCA 4JN6A 3DOAA 2EUCA 2C96A 2CFOA 4QHSA 4X66M 2Y2MA 2KEBA 3PXGA 5ITRA 1X37A 3ZCBB 2V1UA 3HHYA 2C99A 3M7GA 4FWGA 2LWXA 3GPXA 4DR3M 2QPAA 4LF4M 4LFBM 3HONA 2KRKA 2C9CA 4LGMA 5KPTA 1E94E 4FD2A 2R46A 2YQZA 4S12A 4B7GA 1D2NA 4L8RC 4LF5M 2UXBM 4QNLA 4GMQA 3W0FA 2FNAA 4M9ZA 2F5PA 1TH4A 4REZA 5EQTA 3UGJA 4AW4A 4OJ6A 2Y2GA 4DR2M 1YU4A 3QWLA 3HHXA 1J09A 1I94M 3FUWA 2ZBKB 1IM2A 3VDUA 4M9SA 3VK8A 3RE8A 3PNVA 4FW9A 4OW0A 1W5TA 1G4AE 2ZANA 3J80S 3DFZA 3U6QA 4JI8M 2Y0TA 3U5ZB 3J7BA 1J7KA 2HKJA 3FD9A 4LJ8A 4FWDA 4B7FA 4OX9M 3FTCA 2X4AA 3CTWB 5GKNA 3KS4A 4CISA 3TQSA 3SBJA 3U6OA 1L2BA 2UWXA 1ZQ9A 3FUUA 4LJ7A 4MGKE 5H37D 4FCWA 1UM8A 3HJSA 5EXXA 2Y2LA 4GKKM 1XMQM 5ITXA 1L2CA 4FCTA 1IBLM 3U60A 2Y2QA 3J81S 1LV7A 3NBIA 5EJCA 3J2PB 1TGUA 1IN7A 1SXJB 3VDPA 2Y0QA 2M60A 4LRSA 3SHGB 3L29A 4M9XA 3SAWA 4DV5M 1R2YA 1G41A 1Z5BA 4EIWA 2W82A 1NVMA 4AKGA 4AZFA 4NZ3A 4GC5A 1XNQM 1G8PA 2RKOA 3K1JA 4KHPM 2CV0A 4R7GA 1YUBA 1PJJA 4LJ4A 4IBCA 4GC9A 4L15A 1QAQA 3BOSA 2JA2A 4B3TM 5IZ7D 4YY3M 3TE6A 5DYGA 2FOIC 2Y2NA 1G59A 2O5RA 2XZUA 2XH9A 4IBKA 3J27B 3B9PA 3U6MA 3GLFB 2C5RA 1N77A 2CHGA 1QVRA 3SHFA 5EP1A 3N3FA 2F5QA 3FYDA 1JR3A 4LF8M 3M6AA 4NSRA 4DV7M 4GRIA 1MX0A 4OVZB 1ORYB 2CV1A 2UUCM 1HQCA 2XSZD 4L16A 5FTLA 2KZSA 2XF3A 3MK6A 2X8AA 3W0LB 2VQFM 3K92A 4LZJA 4BBAA 4I4LA 4GKJM 4MH0E 4PD2A 2Z7JA 2D7HA 1WXQA 1YU0A 3R8FA 4FWHA 1ZAEA 5IT9S 3VLFB 3SASA 7CATA 5EXPA 5ITYA 1TH2A 2XEPA 4OVZA 3FTFA 2D7EA 4QOSA 3HU2A 2XLJA 4DV4M 2QBYA 3L26A 2JCHA 1E9RA 5EXSA 4BLCA 2J7OA 4OJPA 3FUVA 3U6EA 2UXCM 1NHWC 3KSXA 4KODA 5FLXS 1XC8A 4I8OA 3E4RA 1MU5A 4IBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBE A;  4GH9 A;  4IBK A;  3L29 A;  3L27 A;  4IJE A;  3KS8 A;  4GHL A;  4GHA A;  4IJF A;  3L26 A;  4IBB A;  4IBD A;  3L25 A;  3KS4 A;  3FKE A;  3L2A A;  4LG2 A;  4IBG A;  4IBI A;  4IBC A;  3L28 A;  4IBJ A;  5BPV A;  4IBF A; 
#chains in the Genus database with same CATH topology
 3GP1 A;  3AKZ A;  2QZ4 A;  2R65 A;  4TX8 A;  2LHC A;  1VDD A;  1NY5 A;  1HNW M;  1KS0 A;  1O6I A;  2L7H A;  2WSE F;  4GIP A;  4B7H A;  5ITU A;  3GPY A;  3VK7 A;  3FUT A;  4WP2 A;  3VKH A;  1OAO C;  1W1V A;  3HKP A;  1QDT A;  1E6P A;  1J7M A;  1YU2 A;  2R4J A;  2A5Y B;  4QNM A;  4MGI E;  1R6B X;  3MJ5 A;  2Z4S A;  1IY1 A;  3ILK A;  4YHH M;  2RGO A;  4Q7J A;  2R44 A;  2XD1 A;  1ZMV A;  4NZ4 A;  5KO3 A;  4Z6Y A;  2QCU A;  2FS1 A;  2OO9 A;  2Z4R A;  4MB4 A;  1E88 A;  3CF0 A;  1IY0 A;  4IBJ A;  3HHZ A;  2DWN A;  1SG9 A;  3FRH A;  4Z8X A;  3I01 M;  1IBM M;  3K2L A;  1NY6 A;  4NXM M;  2EO2 A;  1NHG C;  3A46 A;  2DWL A;  4X65 M;  4LY6 A;  4F1I A;  4DR7 M;  1YU3 A;  5DFL A;  2FFF B;  4DR6 M;  1OIZ A;  3TPZ A;  1OGG A;  1W1T A;  2LVQ D;  2C98 A;  4GH9 A;  1K82 A;  3T38 A;  1R7R A;  4QNR A;  4MB5 A;  1Z5A A;  3D8B A;  2ZM6 M;  2Y2P A;  2YNM D;  4JI6 M;  2L2D A;  3KS8 A;  1XB2 B;  3GLH E;  3PFI A;  2M5Z A;  2DHR A;  3U60 B;  4HMC A;  4NZ1 A;  1SXJ D;  2CV2 A;  1GPF A;  5FTJ A;  1SXJ E;  2DAK A;  1L2D A;  4P16 A;  1VDL A;  3U6C A;  3GRR A;  2I7P A;  3HWS A;  2D49 A;  1TDH A;  2ZTC A;  3E46 A;  4D81 A;  4DR4 M;  1PM5 A;  4HME A;  1VEK A;  4OJL A;  3I04 M;  2EJS A;  3L28 A;  1AUA A;  1DO2 A;  3CF2 A;  3VFD A;  3U6S A;  1XXH A;  3ZC7 B;  1DGF A;  1Z59 A;  5EP4 A;  2VDB B;  4XK8 F;  3B74 A;  3U61 A;  2RTS A;  3IG8 A;  1J5E M;  1GXD A;  1WHC A;  5DNY A;  2UUB M;  4LGY A;  2X49 A;  1N78 A;  4DV3 M;  1IXR C;  2CEA A;  2V6Z M;  2KA6 B;  3K9P A;  4JV5 M;  2C9O A;  1DO0 A;  1LTM A;  2H1R A;  2QQ8 A;  4NRW A;  2L6O A;  4NYU A;  4FVM A;  4JI0 M;  5FSW A;  4AKH A;  4D80 A;  1OGB A;  1ZV1 A;  4ZPX A;  3MHV C;  1PJS A;  4RKU F;  2QP9 X;  3FTD A;  4B08 A;  1GVN A;  2JY8 A;  5JI3 E;  4IBD A;  4LF9 M;  2AHM A;  2ZAO A;  4NSO B;  3GLF E;  1D0M A;  1D0L A;  1IN6 A;  1IXS B;  4LF7 M;  2DI0 A;  4Z2J A;  1VEJ A;  3HU1 A;  2APL A;  3I4V A;  4NL4 H;  3KP1 E;  2VF7 A;  5LMN M;  3GPU A;  4L6V 6;  4OUI A;  1YE9 A;  1R2Z A;  3C3D A;  1E6N A;  2R62 A;  2JY5 A;  3SMS A;  1QZM A;  4PT5 A;  3U6D A;  1R5L A;  2L4F A;  4B3S M;  3AL0 C;  2HCB A;  1UR9 A;  3CF6 E;  5FTK A;  3J7A S;  3T15 A;  3WD3 A;  4IJE A;  1NJF A;  1QUT A;  2L4E A;  3GQ4 A;  2DAI A;  3PVS A;  1IFY A;  3GLH A;  4PDG A;  4GHA A;  4NOO B;  1ZMW A;  2HHH M;  2V1C A;  1T3T A;  3FUX A;  1ED7 A;  2L7I A;  4XGI A;  1NV9 A;  3FE3 A;  2H5X A;  2Y2J A;  2MJ5 B;  2R4E A;  5JI2 E;  4IBG A;  2RRU A;  1GLN A;  3GLI A;  3QAU A;  2JNH A;  2Y2O A;  2Y2I A;  1EE8 A;  1DGH A;  2QBY B;  5BR8 M;  4KO8 A;  5EXT A;  3WD0 A;  1L1Z A;  5FTN A;  2Q2E B;  3KOY E;  3SMP A;  3IEC A;  1GKI A;  3TWM A;  4MB7 A;  4PCZ A;  1HQY E;  1KSF X;  2XFT A;  2G5G X;  1T6O A;  2YFQ A;  1XWI A;  2CUZ A;  2J5Y A;  5C1B A;  2G8L A;  3UK6 A;  4D82 A;  3JAM S;  4Z2I A;  4HMD A;  2KXE A;  2DZL A;  2DZN B;  2XFS A;  1ZMU A;  2YR0 A;  3SAT A;  2Y20 A;  1Y8G A;  4JXJ A;  4A3V B;  1N32 M;  3LQR A;  3OTO M;  2IOU A;  4NY2 A;  1K3W A;  2JP7 A;  3E9S A;  3JR5 A;  2Y2K A;  4DV1 M;  2VQE M;  2R45 A;  4LF6 M;  3KVW A;  2CHV A;  3W67 A;  4TUW A;  1XHB A;  1G3I A;  3HGI A;  1MN3 A;  2WSF F;  1MJG M;  8CAT A;  1N34 M;  2OQ4 A;  3WHL A;  4JI3 M;  4MB3 A;  1Z6T A;  3SYL A;  3TWK A;  4LFC M;  3LCU A;  4G4R A;  2JZ0 A;  3RGP A;  1G71 A;  1PJT A;  4IJF A;  5F3W A;  4NXN M;  4M0D A;  5KQD A;  4JI1 M;  3T6P A;  1IXZ A;  2QNJ A;  2ZTD A;  4MGY E;  3RFW A;  4Z2G A;  2K6B A;  4I81 A;  1QUS A;  2N35 A;  1SXJ C;  4L78 A;  1L1T A;  4W5W A;  5ITX E;  3L2A A;  2LHG A;  3KOZ E;  1A5T A;  2ZAM A;  4P17 A;  4WW0 A;  3I51 A;  2OPF A;  4RF0 A;  4LJA A;  4LZZ A;  2O01 F;  1VEG A;  4X62 M;  2Z8Y M;  2WSC F;  2P5T A;  2DWZ B;  3Q8X A;  5EP2 A;  1FNN A;  2LTU A;  1OIP A;  2J7N A;  1IN8 A;  2LXE A;  2QHO B;  2XSZ A;  4AG6 A;  4ANR A;  3GQ5 A;  2UU9 M;  1V33 A;  4IBE A;  3TWL A;  4CHT B;  4LCB A;  2XZF A;  5KQ8 A;  2OOA A;  2LVP C;  1XXH B;  1YLA A;  3L27 A;  3LMM A;  1GL7 A;  4I5S A;  3ZH9 B;  4MGZ E;  3SC3 A;  3GQ3 A;  2F5O A;  4NZ5 A;  3U61 B;  2Y2H A;  1Q3B A;  2MH8 A;  3GLG B;  3SAV A;  1PJI A;  1PRB A;  1QDR A;  3VKG A;  3GPP A;  3Q8G A;  3DZD A;  1GJS A;  1IY2 A;  4G4Q A;  1E32 A;  4F2L A;  1L8Q A;  2DWM A;  1JQJ C;  2BG1 A;  3UZU A;  1NNU C;  1NJG A;  3A45 A;  3A42 A;  4XBO A;  1IBK M;  4LJ9 A;  3SYK A;  1HNZ M;  4B3R M;  4BB9 A;  1QAO A;  4LFA M;  1HT1 E;  4MGH A;  4QOZ C;  3U6L A;  2CE7 A;  5ITQ A;  3GRY A;  3K9O A;  1C1K A;  3GLG A;  1QZE A;  3SAR A;  1DGB A;  3A98 B;  3JR4 A;  2JXN A;  3NWL A;  4DUZ M;  2DEN A;  1HR0 M;  4AKI A;  5E26 A;  2R0I A;  1WIV A;  1QAN A;  2EKK A;  3GRU A;  3IHP A;  5FTM A;  4G3O A;  1T43 A;  5ITT A;  1GO5 A;  3AOG A;  2LVA A;  1GJT A;  1JR3 D;  3HHW A;  3H4J A;  1JR3 E;  3AJI B;  3HU3 A;  2QEN A;  4PDI A;  4DV6 M;  3K8Z A;  3NBX X;  4JI4 M;  2MRO B;  1IQP A;  3C58 A;  2R18 A;  1N33 M;  1OFH A;  3F92 A;  4Z2K A;  4NYY A;  3QYE A;  1V34 A;  2DZO B;  4DV0 M;  3KOX E;  2DHY A;  1QQW A;  3I4Y A;  3FTE A;  5LMU M;  4LRT A;  1KYI A;  4RNA A;  4QHT A;  1H0G A;  2LH0 A;  4ITQ A;  4CGY B;  3EIH A;  1HNX M;  1E8B A;  1W1P A;  2RGH A;  3LVW A;  3GLH B;  1NSF A;  3KW6 A;  4LJ5 A;  3U5Z A;  3PNY A;  3KFU G;  4JYA M;  2BJV A;  1N36 M;  1OTR A;  4HL4 A;  4LFB M;  1EFU B;  1I4W A;  3BXW A;  3DA1 A;  2Y21 A;  3RGS A;  4JI7 M;  3T1Y M;  1XNR M;  1YU1 A;  2DXI A;  2I7N A;  3GLI B;  2KRU A;  3AOE A;  1H6U A;  3KOW E;  1IN4 A;  1OKS A;  1QYR A;  1N75 A;  4GEW A;  4AQY M;  2UUA M;  1DGH B;  1PDC A;  1EAK A;  4GHL A;  4AI6 A;  2ERC A;  2K47 A;  2F5N A;  3WX7 A;  1P3Q Q;  3LVV A;  1WJ7 A;  1GOI A;  1E15 A;  2FFJ A;  2JZ1 A;  2BNK A;  1IN5 A;  2BJW A;  3H4M A;  4G6Z A;  4IBB A;  4R3D A;  5KPZ A;  3B7Z A;  3SFZ A;  1Z5C A;  2D7G A;  5DYI A;  4X64 M;  4OU7 A;  1K3X A;  5IWA M;  1YUE A;  1SXJ A;  3FKE A;  2E5L M;  2DKL A;  2KZU A;  3UJN A;  4G4O A;  2V5O A;  4II7 A;  2LNH C;  4Z2H A;  4AG5 A;  3M0E A;  3HSH A;  1TTE A;  3GRV A;  3GO8 A;  2KW0 A;  3D8L A;  1QAM A;  3CGW A;  1YSY A;  2XD5 A;  1Q3C A;  2JWS A;  3KDS E;  4CJ6 A;  3R9X B;  1W5S A;  1PJQ A;  1TH3 A;  2HL7 A;  3HJQ A;  1Q39 A;  4L4U A;  4DV2 M;  2K9D A;  4M0W A;  1CXW A;  2CHQ A;  2FH0 A;  2JE5 A;  2FE8 A;  2DAE A;  5IRE B;  3THG A;  4R71 A;  2F4V M;  1FJG M;  1EIJ A;  1KFV A;  1NO1 A;  3QYB A;  3HZJ A;  1E6R A;  3L25 A;  3AV0 A;  4DBG B;  1TR8 A;  2DVW B;  3KXE C;  4HLQ A;  3IG5 A;  1XMO M;  4LG2 A;  1GL6 A;  4IBI A;  4JI2 M;  3GLF A;  3MMP A;  4JI5 M;  1OFI A;  4MM3 B;  4DR5 M;  4NRV A;  5BPV A;  2UXD M;  3LQQ A;  1WGL A;  2XGN A;  3HJ8 A;  2EA0 A;  3T1H M;  1HJP A;  3WHK A;  2KDL A;  2VII A;  4OJ5 A;  4WUR A;  3KSJ A;  2NQ8 C;  2LVO C;  4B3M M;  4RF1 A;  4OJO A;  3TL4 X;  5KPR A;  3AOE C;  1DGG A;  2EKF A;  1HT2 E;  1E9S A;  4DUY M;  2F5S A;  1Q02 A;  4G4N A;  3AFH A;  3ZQJ A;  1RU3 A;  2BWB A;  2LVN C;  3UMM A;  3KP0 E;  3BBZ A;  4KLN A;  1XXH E;  2KNZ A;  5EP3 A;  3EIE A;  2Z3X A;  4GIT A;  4FCV A;  1OAI A;  3U6P A;  1NNJ A;  4DR1 M;  1TDZ A;  4LJ6 A;  1S3S A;  2L09 A;  5E6J A;  5C18 A;  5A2Q S;  4IIW A;  3SAU A;  4K0K M;  1OJL A;  2O25 A;  3C9P A;  3FYC A;  3DOA A;  2EUC A;  2C96 A;  4JN6 A;  1H0I A;  2CFO A;  4QHS A;  4X66 M;  2Y2M A;  2KEB A;  3PXG A;  5ITR A;  3WD1 A;  3B7N A;  1X37 A;  3ZCB B;  2V1U A;  3HHY A;  1OQY A;  2C99 A;  2QSF X;  3M7G A;  2LWX A;  4FWG A;  4NC6 A;  2QPA A;  3GPX A;  4DR3 M;  4LF4 M;  2KRK A;  2C9C A;  4LGM A;  5L8R F;  1AIP C;  5KPT A;  3HON A;  1E94 E;  4FD2 A;  2R46 A;  4KT0 F;  1W1Y A;  2YQZ A;  4S12 A;  2MGW A;  1D2N A;  4B7G A;  4L8R C;  2LBC A;  4LF5 M;  2UXB M;  4GMQ A;  3W0F A;  1BVS A;  2FNA A;  4QNL A;  4M9Z A;  2F5P A;  1TH4 A;  4REZ A;  5EQT A;  3UGJ A;  4AW4 A;  4OJ6 A;  2Y2G A;  2KHH A;  4DR2 M;  1L6J A;  1YU4 A;  3QWL A;  3HHX A;  1J09 A;  1I94 M;  3FUW A;  2ZBK B;  1IM2 A;  3VDU A;  4M9S A;  3VK8 A;  3RE8 A;  3PNV A;  4FW9 A;  4OW0 A;  1W5T A;  2K0B X;  3FRI A;  1G4A E;  2ZAN A;  2MR9 A;  3J80 S;  1E6Z A;  4HEO A;  3DFZ A;  3U6Q A;  4JI8 M;  2Y0T A;  3U5Z B;  1J7K A;  2HKJ A;  3FD9 A;  3J7B A;  4LJ8 A;  4FWD A;  4B7F A;  4OX9 M;  3FTC A;  1UR8 A;  2X4A A;  2DAM A;  3CTW B;  5GKN A;  2DAG A;  3KS4 A;  3GLI E;  3TQS A;  4CIS A;  3SBJ A;  3U6O A;  1L2B A;  2UWX A;  1ZQ9 A;  2R6F A;  3FUU A;  4LJ7 A;  4MGK E;  5H37 D;  1D0K A;  1UM8 A;  3HJS A;  4FCW A;  5EXX A;  2Y2L A;  2GNO A;  4GKK M;  1GAB A;  1XMQ M;  2VF8 A;  5ITX A;  1L2C A;  4FCT A;  1IBL M;  3U60 A;  2Y2Q A;  3J81 S;  1LV7 A;  2CRU A;  3NBI A;  3J2P B;  5EJC A;  3M7P A;  1TGU A;  1VQ1 A;  1IN7 A;  1SXJ B;  3VDP A;  2Y0Q A;  2M60 A;  4LRS A;  2CP8 A;  1V92 A;  3SHG B;  2HAK A;  3L29 A;  4M9X A;  3SAW A;  4Z2L A;  4DV5 M;  2BWE A;  1R2Y A;  1G41 A;  1Z5B A;  4EIW A;  2KNA A;  2W82 A;  2JY7 A;  1NVM A;  3WD2 A;  1CK7 A;  3MQL A;  4AKG A;  3HX3 A;  4AZF A;  4NZ3 A;  4GC5 A;  1XNQ M;  1G8P A;  4CIZ A;  2RKO A;  3K1J A;  4Y28 F;  4KHP M;  2JUJ A;  2CV0 A;  4R7G A;  1YUB A;  2G3Q A;  1PJJ A;  4LJ4 A;  4IBC A;  4GC9 A;  4L15 A;  1QAQ A;  1R4G A;  3BOS A;  2JA2 A;  4B3T M;  3C3E A;  5IZ7 D;  4YY3 M;  3TE6 A;  4UN2 B;  2WZJ A;  5DYG A;  2FOI C;  2Y2N A;  1G59 A;  2O5R A;  3W68 A;  2XZU A;  2XH9 A;  4IBK A;  3J27 B;  3B9P A;  3U6M A;  3GLF B;  2C5R A;  1N77 A;  2CHG A;  1QVR A;  3SHF A;  5EP1 A;  2OOB A;  3N3F A;  1DV0 A;  1IXS A;  2F5Q A;  3V76 A;  3FYD A;  1TF0 B;  2DNA A;  1JR3 A;  2FN2 A;  4LF8 M;  3M6A A;  4NSR A;  4DV7 M;  3E21 A;  3B89 A;  4GRI A;  1MX0 A;  2HWJ A;  4OVZ B;  1ORY B;  2CV1 A;  2GQF A;  2UUC M;  1HQC A;  2XSZ D;  4L16 A;  3B7Q A;  1VG5 A;  5FTL A;  2KZS A;  2XF3 A;  1WGN A;  3MK6 A;  2X8A A;  3W0L B;  1UFZ A;  2VQF M;  3K92 A;  4LZJ A;  4BBA A;  2CWB A;  4I4L A;  1CUK A;  2B3T A;  4GKJ M;  1NV8 A;  4MH0 E;  4PD2 A;  2Z7J A;  2D7H A;  1WXQ A;  1F4I A;  3LCV B;  3R8F A;  4FWH A;  1YU0 A;  1ZAE A;  5IT9 S;  3VLF B;  3SAS A;  7CAT A;  5EXP A;  5ITY A;  2JY6 B;  1TH2 A;  2XEP A;  3LW5 F;  1WR1 B;  4OVZ A;  3FTF A;  2D7E A;  3WD4 A;  4QOS A;  3HU2 A;  2XLJ A;  4DV4 M;  2QBY A;  3L26 A;  2JCH A;  1E9R A;  1H8P A;  3HY5 A;  5EXS A;  4BLC A;  2J7O A;  4OJP A;  3FUV A;  3U6E A;  1JB0 F;  2KNV A;  1NHW C;  3KSX A;  4KOD A;  5FLX S;  1XC8 A;  4I8O A;  1C7Y A;  3E4R A;  2UXC M;  1AIW A;  1MU5 A;  3GLG E;  1QO6 A;  4IBF A;  1PGY A; 
#chains in the Genus database with same CATH homology
 3GP1 A;  3AKZ A;  2QZ4 A;  2R65 A;  1VDD A;  1NY5 A;  1HNW M;  2L7H A;  4B7H A;  4GIP A;  5ITU A;  3GPY A;  3VK7 A;  3FUT A;  3VKH A;  3HKP A;  1YU2 A;  2R4J A;  2A5Y B;  4QNM A;  4MGI E;  1R6B X;  3MJ5 A;  2Z4S A;  1IY1 A;  3ILK A;  4YHH M;  2RGO A;  2XD1 A;  4NZ4 A;  5KO3 A;  4Z6Y A;  2QCU A;  2Z4R A;  3CF0 A;  1IY0 A;  4IBJ A;  3HHZ A;  2DWN A;  4Z8X A;  1IBM M;  3K2L A;  1NY6 A;  4NXM M;  2EO2 A;  1NHG C;  3A46 A;  2DWL A;  4X65 M;  4LY6 A;  1YU3 A;  4DR7 M;  2FFF B;  4DR6 M;  3TPZ A;  2C98 A;  4GH9 A;  1K82 A;  3T38 A;  1R7R A;  4QNR A;  1Z5A A;  3D8B A;  2ZM6 M;  2Y2P A;  2YNM D;  4JI6 M;  3PFI A;  3U60 B;  2M5Z A;  2DHR A;  4NZ1 A;  1SXJ D;  2CV2 A;  5FTJ A;  1SXJ E;  1L2D A;  4P16 A;  3U6C A;  3GRR A;  2I7P A;  3HWS A;  1TDH A;  4D81 A;  4DR4 M;  1PM5 A;  4OJL A;  3L28 A;  3VFD A;  1DO2 A;  3CF2 A;  3U6S A;  1XXH A;  3ZC7 B;  1DGF A;  1Z59 A;  5EP4 A;  3U61 A;  3IG8 A;  1J5E M;  5DNY A;  2UUB M;  4LGY A;  2X49 A;  1N78 A;  4DV3 M;  1IXR C;  2CEA A;  2V6Z M;  2KA6 B;  4JV5 M;  2C9O A;  1DO0 A;  2H1R A;  4NRW A;  4NYU A;  2L6O A;  4FVM A;  4JI0 M;  5FSW A;  4AKH A;  4D80 A;  4ZPX A;  3MHV C;  2QP9 X;  3FTD A;  4B08 A;  1GVN A;  5JI3 E;  4IBD A;  4LF9 M;  2AHM A;  2ZAO A;  4NSO B;  1IN6 A;  1IXS B;  3I4V A;  3HU1 A;  4NL4 H;  3KP1 E;  5LMN M;  3GPU A;  4OUI A;  1YE9 A;  1R2Z A;  2R62 A;  3SMS A;  1QZM A;  4PT5 A;  3U6D A;  4B3S M;  3AL0 C;  2HCB A;  3CF6 E;  5FTK A;  3J7A S;  3T15 A;  4IJE A;  1NJF A;  3GQ4 A;  3PVS A;  3GLH A;  4PDG A;  4GHA A;  4NOO B;  2HHH M;  2V1C A;  1T3T A;  3FUX A;  2L7I A;  4XGI A;  2Y2J A;  2R4E A;  5JI2 E;  4IBG A;  1GLN A;  3GLI A;  3QAU A;  2Y2O A;  2Y2I A;  1EE8 A;  1DGH A;  2QBY B;  5BR8 M;  4KO8 A;  5EXT A;  1L1Z A;  5FTN A;  2Q2E B;  3KOY E;  3SMP A;  1GKI A;  3TWM A;  4MB7 A;  4PCZ A;  1HQY E;  1KSF X;  2XFT A;  2G5G X;  2YFQ A;  1XWI A;  2CUZ A;  5C1B A;  2G8L A;  3UK6 A;  4D82 A;  3JAM S;  2KXE A;  2DZN B;  2XFS A;  3SAT A;  2YR0 A;  2Y20 A;  4JXJ A;  4A3V B;  1N32 M;  3LQR A;  3OTO M;  2IOU A;  4NY2 A;  1K3W A;  3JR5 A;  3E9S A;  2Y2K A;  4DV1 M;  2VQE M;  2R45 A;  4LF6 M;  3KVW A;  2CHV A;  4TUW A;  1XHB A;  1G3I A;  3HGI A;  1N34 M;  8CAT A;  2OQ4 A;  3WHL A;  4JI3 M;  1Z6T A;  3SYL A;  3TWK A;  4LFC M;  4G4R A;  3RGP A;  5F3W A;  4IJF A;  4NXN M;  4M0D A;  5KQD A;  4JI1 M;  1IXZ A;  4MGY E;  3RFW A;  4I81 A;  4L78 A;  1SXJ C;  1L1T A;  4W5W A;  5ITX E;  3L2A A;  3KOZ E;  4WW0 A;  2ZAM A;  2OPF A;  3I51 A;  4RF0 A;  4LJA A;  4LZZ A;  4X62 M;  2P5T A;  2DWZ B;  3Q8X A;  5EP2 A;  1FNN A;  2XSZ A;  2J7N A;  4AG6 A;  1IN8 A;  2LXE A;  3GQ5 A;  2UU9 M;  2XZF A;  4IBE A;  3TWL A;  4CHT B;  4LCB A;  5KQ8 A;  1XXH B;  3L27 A;  3LMM A;  4I5S A;  1GL7 A;  3ZH9 B;  2F5O A;  4MGZ E;  3SC3 A;  3GQ3 A;  4NZ5 A;  3U61 B;  2Y2H A;  1Q3B A;  3GLG B;  3SAV A;  1PJI A;  3GPP A;  3DZD A;  1IY2 A;  4G4Q A;  1E32 A;  1L8Q A;  2DWM A;  1JQJ C;  2BG1 A;  3UZU A;  1NNU C;  1NJG A;  3A45 A;  3A42 A;  4XBO A;  1IBK M;  4LJ9 A;  3SYK A;  1HNZ M;  4B3R M;  4BB9 A;  1QAO A;  4LFA M;  1HT1 E;  4MGH A;  4QOZ C;  3U6L A;  2CE7 A;  5ITQ A;  3GRY A;  1C1K A;  3GLG A;  3SAR A;  1DGB A;  3A98 B;  3JR4 A;  3NWL A;  4DUZ M;  1HR0 M;  4AKI A;  5E26 A;  3GRU A;  5FTM A;  1QAN A;  5ITT A;  3AOG A;  1JR3 D;  3HHW A;  3HU3 A;  3AJI B;  4DV6 M;  4JI4 M;  2QEN A;  4PDI A;  3KS8 A;  3K8Z A;  3C58 A;  1IQP A;  2R18 A;  1N33 M;  1OFH A;  4NYY A;  2DZO B;  4DV0 M;  3KOX E;  1QQW A;  3I4Y A;  3FTE A;  5LMU M;  4LRT A;  1KYI A;  4RNA A;  4QHT A;  2LH0 A;  4ITQ A;  4CGY B;  3EIH A;  1HNX M;  2RGH A;  3LVW A;  3GLH B;  1NSF A;  3KW6 A;  4LJ5 A;  3U5Z A;  3PNY A;  3KFU G;  4JYA M;  2BJV A;  1N36 M;  4HL4 A;  1I4W A;  3DA1 A;  2Y21 A;  3RGS A;  4JI7 M;  3T1Y M;  1XNR M;  1YU1 A;  2DXI A;  2I7N A;  3GLI B;  2KRU A;  3AOE A;  1H6U A;  3KOW E;  1IN4 A;  1QYR A;  2UUA M;  1N75 A;  4LF7 M;  4AQY M;  1DGH B;  4GHL A;  4AI6 A;  2ERC A;  2K47 A;  2F5N A;  3WX7 A;  3LVV A;  2FFJ A;  4G6Z A;  2BNK A;  1IN5 A;  2BJW A;  3H4M A;  4IBB A;  4R3D A;  5KPZ A;  4X64 M;  3VKG A;  3SFZ A;  1Z5C A;  2D7G A;  5DYI A;  4OU7 A;  1K3X A;  5IWA M;  1YUE A;  1SXJ A;  3FKE A;  2E5L M;  2KZU A;  3UJN A;  4G4O A;  4II7 A;  2LNH C;  4AG5 A;  3M0E A;  3HSH A;  3GRV A;  3GO8 A;  2KW0 A;  3D8L A;  1QAM A;  1YSY A;  2XD5 A;  1Q3C A;  3R9X B;  3KDS E;  1W5S A;  1TH3 A;  3HJQ A;  2HL7 A;  1Q39 A;  4L4U A;  4DV2 M;  4M0W A;  2CHQ A;  2JE5 A;  2FE8 A;  5IRE B;  3THG A;  2F4V M;  1FJG M;  1KFV A;  3L25 A;  3AV0 A;  2DVW B;  3KXE C;  4HLQ A;  3IG5 A;  1XMO M;  4LG2 A;  1GL6 A;  4IBI A;  4JI2 M;  3GLF A;  4JI5 M;  1OFI A;  4MM3 B;  4DR5 M;  4NRV A;  5BPV A;  2UXD M;  3LQQ A;  2XGN A;  3HJ8 A;  2EA0 A;  3T1H M;  3WHK A;  2VII A;  4OJ5 A;  4WUR A;  3KSJ A;  2NQ8 C;  4B3M M;  4RF1 A;  4OJO A;  3TL4 X;  5KPR A;  3AOE C;  1DGG A;  1HT2 E;  1E9S A;  4DUY M;  2F5S A;  4G4N A;  3AFH A;  3UMM A;  3KP0 E;  4KLN A;  5EP3 A;  3EIE A;  2Z3X A;  4GIT A;  4FCV A;  3U6P A;  1NNJ A;  4DR1 M;  1TDZ A;  4LJ6 A;  1S3S A;  2L09 A;  5E6J A;  5C18 A;  5A2Q S;  4IIW A;  3SAU A;  4K0K M;  1OJL A;  3FYC A;  4JN6 A;  3DOA A;  2EUC A;  2C96 A;  2CFO A;  4QHS A;  4X66 M;  2Y2M A;  2KEB A;  3PXG A;  5ITR A;  1X37 A;  3ZCB B;  2V1U A;  3HHY A;  2C99 A;  3M7G A;  4FWG A;  2LWX A;  3GPX A;  4DR3 M;  2QPA A;  4LF4 M;  4LFB M;  3HON A;  2KRK A;  2C9C A;  4LGM A;  5KPT A;  1E94 E;  4FD2 A;  2R46 A;  2YQZ A;  4S12 A;  4B7G A;  1D2N A;  4L8R C;  4LF5 M;  2UXB M;  4QNL A;  4GMQ A;  3W0F A;  2FNA A;  4M9Z A;  2F5P A;  1TH4 A;  4REZ A;  5EQT A;  3UGJ A;  4AW4 A;  4OJ6 A;  2Y2G A;  4DR2 M;  1YU4 A;  3QWL A;  3HHX A;  1J09 A;  1I94 M;  3FUW A;  2ZBK B;  1IM2 A;  3VDU A;  4M9S A;  3VK8 A;  3RE8 A;  3PNV A;  4FW9 A;  4OW0 A;  1W5T A;  1G4A E;  2ZAN A;  3J80 S;  3DFZ A;  3U6Q A;  4JI8 M;  2Y0T A;  3U5Z B;  3J7B A;  1J7K A;  2HKJ A;  3FD9 A;  4LJ8 A;  4FWD A;  4B7F A;  4OX9 M;  3FTC A;  2X4A A;  3CTW B;  5GKN A;  3KS4 A;  4CIS A;  3TQS A;  3SBJ A;  3U6O A;  1L2B A;  2UWX A;  1ZQ9 A;  3FUU A;  4LJ7 A;  4MGK E;  5H37 D;  4FCW A;  1UM8 A;  3HJS A;  5EXX A;  2Y2L A;  4GKK M;  1XMQ M;  5ITX A;  1L2C A;  4FCT A;  1IBL M;  3U60 A;  2Y2Q A;  3J81 S;  1LV7 A;  3NBI A;  5EJC A;  3J2P B;  1TGU A;  1IN7 A;  1SXJ B;  3VDP A;  2Y0Q A;  2M60 A;  4LRS A;  3SHG B;  3L29 A;  4M9X A;  3SAW A;  4DV5 M;  1R2Y A;  1G41 A;  1Z5B A;  4EIW A;  2W82 A;  1NVM A;  4AKG A;  4AZF A;  4NZ3 A;  4GC5 A;  1XNQ M;  1G8P A;  2RKO A;  3K1J A;  4KHP M;  2CV0 A;  4R7G A;  1YUB A;  1PJJ A;  4LJ4 A;  4IBC A;  4GC9 A;  4L15 A;  1QAQ A;  3BOS A;  2JA2 A;  4B3T M;  5IZ7 D;  4YY3 M;  3TE6 A;  5DYG A;  2FOI C;  2Y2N A;  1G59 A;  2O5R A;  2XZU A;  2XH9 A;  4IBK A;  3J27 B;  3B9P A;  3U6M A;  3GLF B;  2C5R A;  1N77 A;  2CHG A;  1QVR A;  3SHF A;  5EP1 A;  3N3F A;  2F5Q A;  3FYD A;  1JR3 A;  4LF8 M;  3M6A A;  4NSR A;  4DV7 M;  4GRI A;  1MX0 A;  4OVZ B;  1ORY B;  2CV1 A;  2UUC M;  1HQC A;  2XSZ D;  4L16 A;  5FTL A;  2KZS A;  2XF3 A;  3MK6 A;  2X8A A;  3W0L B;  2VQF M;  3K92 A;  4LZJ A;  4BBA A;  4I4L A;  4GKJ M;  4MH0 E;  4PD2 A;  2Z7J A;  2D7H A;  1WXQ A;  1YU0 A;  3R8F A;  4FWH A;  1ZAE A;  5IT9 S;  3VLF B;  3SAS A;  7CAT A;  5EXP A;  5ITY A;  1TH2 A;  2XEP A;  4OVZ A;  3FTF A;  2D7E A;  4QOS A;  3HU2 A;  2XLJ A;  4DV4 M;  2QBY A;  3L26 A;  2JCH A;  1E9R A;  5EXS A;  4BLC A;  2J7O A;  4OJP A;  3FUV A;  3U6E A;  2UXC M;  1NHW C;  3KSX A;  4KOD A;  5FLX S;  1XC8 A;  4I8O A;  3E4R A;  1MU5 A;  4IBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...