4GHLA

Structural basis for marburg virus vp35 mediate immune evasion mechanisms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
b'HMEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFMGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords short palindromic RNA AGACAGCAUAUGCUGUCU
molecule tags Transcription, viral protein/rna
source organism Lake victoria marburgvirus
publication title Structural basis for Marburg virus VP35-mediated immune evasion mechanisms.
pubmed doi rcsb
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ghlA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ghlA02
3L28A 4IBJA 4GHLA 4IJEA 4IBBA 4LG2A 4IBDA 4IBEA 4IBCA 3KS4A 3L2AA 3L29A 3L27A 4IBGA 3L25A 3L26A 4GH9A 4IBIA 4GHAA 4IBKA 3FKEA 3KS8A 4IBFA 5BPVA 4IJFA
chains in the Genus database with same CATH superfamily
4DV5M 3KXEC 1TTEA 3D8LA 2LH0A 5LMUM 3SATA 2HAKA 4LJAA 1ORYB 4G4QA 1XNRM 1GXDA 3PNYA 4JI7M 4DR6M 3U6EA 5ITYA 3KP0E 4LJ8A 3KOXE 3WD3A 1Z6TA 1XB2B 1Z5BA 5C18A 4DV3M 2JY5A 1L1ZA 5KQ8A 1V34A 4B3TM 1R4GA 4X62M 2OPFA 3U6PA 2O5RA 2Y20A 1DGHA 1XXHA 2JY8A 4GEWA 4B08A 1NO1A 3FTDA 2EA0A 5IREB 3MQLA 3UMMA 2G8LA 1IFYA 1R6BX 2GQFA 4NOOB 4LFCM 3KS8A 1NHGC 4JXJA 4DR3M 4NZ5A 4OVZA 4JYAM 5DNYA 1QZMA 2DXIA 3J27B 3AOGA 4AG6A 1QANA 4PDGA 2HCBA 2BJWA 2QZ4A 2Y2NA 4NC6A 1QUTA 1FNNA 2OOBA 2R62A 2UUCM 1C1KA 4GKJM 5BR8M 1A5TA 1IN5A 1R7RA 3LVVA 2ZTDA 5EP3A 4IBDA 3RE8A 4B3MM 4LZJA 4LJ4A 2DHYA 1ZMWA 2Z7JA 1Q3CA 2Z4RA 1DO2A 2FNAA 4B7GA 1DGGA 1YUBA 5KPTA 3SHFA 3L26A 1E6RA 4F2LA 1NJFA 5ITXA 3U6SA 3C3DA 1K82A 1G4AE 2APLA 2B3TA 3WD0A 1MN3A 4I5SA 2KW0A 3E9SA 4L15A 3KOWE 2R0IA 3W67A 2H5XA 4M0DA 2VF8A 3SAWA 1R2YA 5FTNA 1NJGA 1QVRA 2R4JA 3GLHB 3HKPA 1N78A 1QDRA 3HU3A 5ITXE 3HHXA 2EJSA 2DZNB 4LF7M 1NNUC 4DV4M 4Z2HA 2Y2GA 1NNJA 3HY5A 4AW4A 2F4VM 2RTSA 4QNLA 2L4FA 2N35A 3B7QA 4HL4A 4IBEA 4FWGA 4NRVA 1L2CA 1RU3A 3L29A 1UR9A 3W0FA 1XXHE 3FE3A 4UN2B 4NXMM 1IXSA 1NVMA 3FRIA 3TWKA 4HEOA 2LTUA 2RKOA 1YU2A 3M6AA 4IBKA 2DZOB 2BWBA 1BVSA 3ZQJA 2LVQD 4GKKM 3UJNA 2QHOB 4LJ9A 2CV0A 4CIZA 1XC8A 1HNXM 3U6MA 1PM5A 4CHTB 5IZ7D 4Z6YA 3TL4X 4BB9A 3SARA 1HQYE 2UXDM 1W1PA 4LF6M 2K9DA 4Z8XA 2ZANA 1W1YA 2FFJA 1J7KA 1T3TA 4A3VB 4D81A 2LVNC 3L2AA 3KP1E 1AIWA 3PFIA 3GLGE 1E32A 2WSEF 1TDZA 4IBGA 1XMOM 3AJIB 4I8OA 1VEKA 2DI0A 4AG5A 1VQ1A 3GRVA 4GC5A 4DV7M 2C98A 2O01F 4MGYE 4KT0F 1PJJA 1E15A 5KPZA 3RGSA 3CTWB 3DOAA 2CFOA 4HLQA 4FCVA 4GIPA 1IQPA 4LCBA 2V1CA 2LHCA 3IHPA 4M9SA 4JI8M 2CHVA 3BOSA 4S12A 1IBLM 4MGIE 1MU5A 3FTFA 3NBXX 3GQ3A 1OTRA 2DNAA 2RGOA 3UK6A 4ZPXA 4LJ7A 1XWIA 4FCWA 3VKHA 1DGBA 1OIPA 1YE9A 2XH9A 3VDUA 5KPRA 4TX8A 2JUJA 2CWBA 3K9OA 2R18A 4LGMA 1KYIA 4QHSA 5DYGA 4JI4M 2RGHA 3BXWA 3GRYA 3HSHA 1ED7A 4KO8A 3MK6A 2G3QA 1K3WA 1HT2E 2XEPA 5KQDA 2KA6B 2DAIA 2EKFA 3KOYE 4ITQA 4LF8M 4NYYA 4FWHA 1DV0A 2JXNA 1CXWA 2V6ZM 4QNMA 5EP2A 4G6ZA 4WURA 4RF1A 4DR2M 4JN6A 1R2ZA 4LF4M 4HMEA 4NXNM 3W0LB 2XD5A 1V92A 4M9XA 4LRTA 3HU1A 4I4LA 4GC9A 1TR8A 2Y21A 1O6IA 3PVSA 2Y0QA 2MR9A 3VK8A 1VDLA 4DR1M 2CV2A 2LXEA 2HWJA 2DHRA 2NQ8C 3K9PA 3UZUA 4D80A 3KS4A 3GPYA 3SYKA 2F5QA 1EIJA 3J80S 1SXJA 2H1RA 4G4NA 2YNMD 3HWSA 2XGNA 4BBAA 2OO9A 3GLFB 2CE7A 3LCUA 4DR7M 4FCTA 2ZM6M 3HHWA 4QHTA 1PJTA 1W5TA 2LVAA 3AOEC 4LGYA 1L6JA 4DBGB 3PNVA 1JR3A 2XSZD 2ZTCA 3A98B 4JI5M 3KDSE 2LVPC 1IBMM 4IBJA 4I81A 1SXJB 4P17A 4REZA 1EAKA 2DVWB 2KNAA 1D0MA 3FTCA 4MB5A 2CHGA 4MH0E 4MB4A 2UXCM 3I4VA 1GL6A 3GLFA 4OUIA 4GITA 2DENA 1QAQA 4NSOB 3M7GA 4Z2KA 2R6FA 1YUEA 3A42A 1SXJE 3GPPA 1EE8A 4Z2GA 4OJ5A 2ZAMA 5KO3A 4IBCA 3VDPA 4LJ5A 2MJ5B 4WP2A 1PJIA 2CUZA 3KSXA 3PXGA 5EP1A 3ZC7B 2VQEM 3B9PA 3U60B 1CK7A 2Y2MA 1KS0A 5EQTA 2L4EA 3B74A 1SXJC 4D82A 4YY3M 3U61B 1C7YA 2V1UA 3R9XB 2X8AA 2JWSA 3GLFE 4JV5M 4R3DA 2F5NA 2Y2IA 1OQYA 2MROB 2XFTA 3GQ5A 4NYUA 4PD2A 1QO6A 2QNJA 4MB3A 4JI2M 1WGNA 1GLNA 1G3IA 2A5YB 1QYRA 3L28A 4Z2LA 4NZ3A 3SYLA 1X37A 2CP8A 3DFZA 1VEGA 4L78A 3TQSA 2Z8YM 3WX7A 4F1IA 1OAOC 1I94M 4IIWA 3U6CA 1S3SA 1E9RA 3VK7A 2Y2KA 1L2DA 2Q2EB 4EIWA 2Y2HA 3M7PA 3OTOM 1GVNA 2Y2PA 1W1TA 1NV9A 2C9CA 2D7EA 5A2QS 4DV0M 3SASA 2VQFM 1NHWC 1VDDA 3C9PA 4X66M 3QYBA 1H6UA 1NY5A 4LFBM 1IM2A 3BBZA 2JY6B 4IBIA 3H4MA 1JB0F 2HL7A 4X65M 5EXXA 2FOIC 4IBFA 2AHMA 2MH8A 1HNZM 3LQQA 1OJLA 4IJFA 1TF0B 3W68A 1XMQM 1GPFA 1AIPC 4JI0M 3IECA 4NRWA 1V33A 1XHBA 1GABA 1H8PA 1NY6A 1YU4A 4NY2A 3NBIA 3HHZA 1IN6A 3AOEA 1H0GA 3HONA 3GPXA 3SAUA 3LMMA 3U6DA 2W82A 1W5SA 4LF9M 1ZV1A 2P5TA 1G59A 1IY0A 1TGUA 4PCZA 5ITUA 3T1YM 3FTEA 2O25A 3U6LA 4B3RM 3KOZE 3VLFB 1E6ZA 3I01M 2FFFB 2L7HA 1QQWA 2BWEA 1WHCA 2X49A 3QWLA 4XGIA 3L27A 3J7AS 3B89A 2JZ1A 2FS1A 1IXZA 2M60A 2KRKA 3KW6A 4KODA 4L16A 4L4UA 1PDCA 3VKGA 1NSFA 2FH0A 1J5EM 2D7HA 2HKJA 5EXSA 4R7GA 4DV6M 3SFZA 2DWZB 3SBJA 3LQRA 4CGYB 1L8QA 1D0KA 3K8ZA 1E8BA 2F5SA 3GQ4A 2Y2OA 3FYCA 1WJ7A 4DV2M 2IOUA 2KDLA 3LVWA 2WZJA 4FW9A 1ZAEA 2UU9M 1HQCA 3THGA 4OJLA 5EJCA 4MGZE 4NSRA 4BLCA 3R8FA 4K0KM 4Z2JA 3B7ZA 2DWMA 4LF5M 1IXSB 5EXTA 4DR4M 2JZ0A 3FUUA 1H0IA 5EXPA 2I7PA 1IY2A 4B7FA 2I7NA 2VF7A 4DUZM 4YHHM 3F92A 1CUKA 1GL7A 1Z59A 2DKLA 4DUYM 4OJOA 5IT9S 1DO0A 1T6OA 3KVWA 5ITTA 2QBYB 2OQ4A 4W5WA 2MGWA 3HJ8A 2XLJA 2KZUA 1OFIA 2KXEA 3A45A 1VEJA 1DGHB 1XXHB 4JI3M 3CF6E 3N3FA 3GP1A 2E5LM 2KNVA 4Z2IA 1UFZA 3J2PB 2DZLA 1Q3BA 1TH2A 3LW5F 5FTKA 2X4AA 1WR1B 4OVZB 1PGYA 1WIVA 2KHHA 3WHKA 1E9SA 1HT1E 2QBYA 2V5OA 1E94E 3E21A 3FUXA 2BJVA 2XZFA 2YR0A 2ZAOA 1NV8A 2R4EA 1Z5AA 3FYDA 5ITQA 3K1JA 3RFWA 2XF3A 1KFVA 1MX0A 2L2DA 4OX9M 1PJQA 3IG8A 2UWXA 1IXRC 3E46A 2Y2JA 2QPAA 2JNHA 4JI1M 1OGGA 1OIZA 2DWNA 4XBOA 4AKIA 2OOAA 2ZBKB 3FKEA 4KLNA 4HMCA 4NL4H 3Q8XA 2CEAA 1J7MA 1Q39A 4LY6A 1IN7A 3D8BA 1HR0M 2LNHC 2CRUA 4RF0A 3GLIE 2G5GX 2XFSA 1XNQM 2DAEA 5E26A 1ZMUA 2J7OA 4MM3B 2FN2A 4OJ6A 3ILKA 2Y2QA 3HX3A 4IBBA 4LFAM 3CGWA 3AL0C 1N33M 2XZUA 1EFUB 3EIHA 4LJ6A 3GLHA 3MJ5A 3CF2A 2KRUA 5FLXS 4L8RC 5L8RF 3C3EA 3KSJA 4HMDA 2L7IA 2F5OA 1Y8GA 2C96A 3MHVC 3JAMS 1N32M 4AQYM 2LWXA 3HJQA 1QUSA 3T38A 4GHAA 3FRHA 2GNOA 4OW0A 3WD2A 1YU1A 1YU0A 2JP7A 2DWLA 2R46A 2QCUA 2K6BA 3TPZA 4QOZC 1Z5CA 1L1TA 1E88A 1QDTA 3E4RA 3GPUA 1DGFA 3HJSA 4II7A 4LRSA 4G4RA 2XD1A 5GKNA 3ZCBB 2C9OA 5JI2E 4GMQA 1OGBA 3GRRA 2YFQA 1W1VA 1PRBA 3SC3A 1GOIA 2KEBA 5LMNM 3GLIB 3FUWA 1HNWM 3J7BA 1GJTA 1FJGM 4QNRA 1N77A 2K47A 2J7NA 1J09A 3T6PA 5ITRA 1TH3A 1R5LA 2FE8A 2LHGA 1Q02A 2QQ8A 2JY7A 2K0BX 3T15A 3L25A 4NZ4A 2XSZA 1JR3D 2ERCA 4PT5A 5BPVA 1WXQA 1G41A 3RGPA 7CATA 5FTLA 5JI3E 1IN4A 3EIEA 3MMPA 2KZSA 3JR4A 2L09A 3GLIA 2Z3XA 3U5ZA 3HU2A 4AKHA 4P16A 3WD1A 1YLAA 3U6QA 4CISA 2VIIA 3LCVB 4FVMA 3GRUA 4M9ZA 1TDHA 4MGHA 4LZZA 1SXJD 3SMPA 4CJ6A 4JI6M 1KSFX 5EP4A 1T43A 3AFHA 3I04M 4X64M 4DR5M 4WW0A 2UXBM 1IY1A 1QAMA 3GLHE 3U61A 4KHPM 3GLGB 4AZFA 2D7GA 4DV1M 3SAVA 3KFUG 1IN8A 2QENA 1D0LA 3V76A 3U5ZB 2D49A 2JA2A 3Q8GA 3HZJA 3TWLA 3FUTA 2J5YA 4AKGA 4RNAA 1K3XA 2JCHA 1OAIA 4OJPA 5DYIA 3AV0A 2CHQA 2Y2LA 2C5RA 2M5ZA 3I4YA 1LV7A 1VG5A 4M0WA 3VFDA 1QZEA 4L6V6 5DFLA 1I4WA 1SG9A 3GLGA 3HGIA 4G4OA 1JR3E 2EO2A 1OKSA 4MB7A 4B3SM 2UUBM 3C58A 1P3QQ 1OFHA 4PDIA 2CV1A 1N34M 2RRUA 2QSFX 3TE6A 4LG2A 2JE5A 3K92A 2KNZA 4FWDA 3SMSA 4R71A 1ZMVA 4G3OA 4MGKE 3A46A 3TWMA 3WD4A 2R44A 3H4JA 2DAGA 3DZDA 5FSWA 2BG1A 3DA1A 2EUCA 2DAKA 3I51A 1UM8A 3T1HM 1F4IA 2Z4SA 3M0EA 1G8PA 1TH4A 1PJSA 3JR5A 3U6OA 1G71A 4XK8F 4ANRA 3FD9A 3J81S 5H37D 1JQJC 2WSFF 1E6NA 3GO8A 2HHHM 2DAMA 2VDBB 2Y0TA 1LTMA 3FUVA 4GH9A 4IJEA 2LVOC 2L6OA 1QAOA 4Q7JA 5FTMA 8CATA 1L2BA 2R45A 4GHLA 3IG5A 3QYEA 4B7HA 2YQZA 1HJPA 3QAUA 4AI6A 1N36M 4RKUF 4Y28F 1ZQ9A 3CF0A 2QP9X 4FD2A 5C1BA 5FTJA 1E6PA 1N75A 3AKZA 2C99A 3K2LA 3SHGB 1UR8A 5IWAM 4TUWA 1GJSA 1AUAA 2F5PA 5F3WA 1GKIA 4QOSA 3ZH9B 1WGLA 3WHLA 4GRIA 2LBCA 3UGJA 1YSYA 1IBKM 2UUAM 4NZ1A 5E6JA 3NWLA 3B7NA 1YU3A 1MJGM 2BNKA 3U60A 1GO5A 2EKKA 4OU7A 2WSCF 2R65A 1D2NA 3HHYA
chains in the Genus database with same CATH topology
4DV5M 3KXEC 3D8LA 2LH0A 5LMUM 3SATA 4LJAA 4G4QA 1ORYB 1XNRM 3PNYA 4JI7M 4DR6M 3U6EA 5ITYA 3KP0E 4LJ8A 3KOXE 1Z6TA 5C18A 1Z5BA 4DV3M 1L1ZA 5KQ8A 4B3TM 4X62M 2OPFA 3U6PA 2O5RA 2Y20A 1DGHA 1XXHA 4B08A 2EA0A 3FTDA 5IREB 3UMMA 2G8LA 1R6BX 4NOOB 4LFCM 3KS8A 1NHGC 4JXJA 4DR3M 4NZ5A 4OVZA 4JYAM 5DNYA 1QZMA 2DXIA 3J27B 3AOGA 4AG6A 1QANA 4PDGA 2HCBA 2BJWA 2QZ4A 2Y2NA 2R62A 1FNNA 2UUCM 4GKJM 1C1KA 5BR8M 1IN5A 1R7RA 3LVVA 5EP3A 4IBDA 3RE8A 4B3MM 4LZJA 4LJ4A 2Z7JA 1Q3CA 2Z4RA 1DO2A 2FNAA 4B7GA 1DGGA 1YUBA 5KPTA 3SHFA 3L26A 1NJFA 5ITXA 3U6SA 1K82A 1G4AE 4I5SA 2KW0A 3E9SA 4L15A 3KOWE 4M0DA 3SAWA 1R2YA 5FTNA 1NJGA 1QVRA 2R4JA 3GLHB 3HKPA 1N78A 3HU3A 5ITXE 3HHXA 2DZNB 4LF7M 1NNUC 4DV4M 2Y2GA 1NNJA 4AW4A 2F4VM 4QNLA 4HL4A 4IBEA 4FWGA 4NRVA 1L2CA 3L29A 3W0FA 4NXMM 1NVMA 3TWKA 2RKOA 1YU2A 3M6AA 4IBKA 2DZOB 4GKKM 3UJNA 4LJ9A 2CV0A 1XC8A 1HNXM 3U6MA 1PM5A 4CHTB 5IZ7D 4Z6YA 3TL4X 4BB9A 3SARA 1HQYE 2UXDM 4LF6M 4Z8XA 2ZANA 2FFJA 1J7KA 1T3TA 4A3VB 4D81A 3L2AA 3KP1E 3PFIA 1E32A 1TDZA 4IBGA 1XMOM 3AJIB 4I8OA 4AG5A 3GRVA 4GC5A 4DV7M 2C98A 4MGYE 1PJJA 5KPZA 3RGSA 3CTWB 3DOAA 2CFOA 4HLQA 4FCVA 4GIPA 1IQPA 4LCBA 2V1CA 4M9SA 4JI8M 2CHVA 3BOSA 4S12A 1IBLM 4MGIE 1MU5A 3FTFA 3GQ3A 2RGOA 3UK6A 4ZPXA 4LJ7A 1XWIA 4FCWA 3VKHA 1DGBA 2XH9A 1YE9A 3VDUA 5KPRA 4LGMA 2R18A 5DYGA 1KYIA 4QHSA 4JI4M 2RGHA 3GRYA 3HSHA 4KO8A 3MK6A 1K3WA 1HT2E 2XEPA 5KQDA 2KA6B 4ITQA 3KOYE 4LF8M 4NYYA 4FWHA 2V6ZM 4QNMA 5EP2A 4G6ZA 4WURA 4RF1A 4DR2M 4JN6A 1R2ZA 4LF4M 4NXNM 3W0LB 2XD5A 4M9XA 4LRTA 3HU1A 4I4LA 4GC9A 2Y21A 3PVSA 2Y0QA 3VK8A 4DR1M 2CV2A 2LXEA 2DHRA 2NQ8C 4D80A 3GPYA 3KS4A 3SYKA 2F5QA 3J80S 1SXJA 2H1RA 4G4NA 2YNMD 3HWSA 2XGNA 4BBAA 3GLFB 2CE7A 4DR7M 4FCTA 2ZM6M 3HHWA 4QHTA 1W5TA 3AOEC 4LGYA 3PNVA 1JR3A 2XSZD 3A98B 4JI5M 3KDSE 1IBMM 4IBJA 4I81A 1SXJB 4REZA 2DVWB 3FTCA 2CHGA 4MH0E 2UXCM 3I4VA 1GL6A 3GLFA 4OUIA 4GITA 1QAQA 4NSOB 3M7GA 1YUEA 3A42A 1SXJE 3GPPA 1EE8A 4OJ5A 2ZAMA 5KO3A 4IBCA 3VDPA 4LJ5A 1PJIA 2CUZA 3KSXA 3PXGA 5EP1A 3ZC7B 2VQEM 3B9PA 3U60B 2Y2MA 5EQTA 4D82A 4YY3M 1SXJC 3U61B 2V1UA 3R9XB 2X8AA 4JV5M 4R3DA 2F5NA 2Y2IA 2XFTA 3GQ5A 4NYUA 4PD2A 4JI2M 1GLNA 1G3IA 2A5YB 1QYRA 3L28A 4NZ3A 3SYLA 1X37A 3DFZA 4L78A 3TQSA 3WX7A 1I94M 4IIWA 3U6CA 1S3SA 1E9RA 3VK7A 2Y2KA 1L2DA 2Q2EB 4EIWA 2Y2HA 3OTOM 1GVNA 2Y2PA 2C9CA 2D7EA 5A2QS 4DV0M 3SASA 2VQFM 1NHWC 1VDDA 4X66M 1H6UA 1NY5A 4LFBM 1IM2A 4IBIA 3H4MA 2HL7A 4X65M 5EXXA 2FOIC 4IBFA 2AHMA 1HNZM 3LQQA 1OJLA 4IJFA 1XMQM 4JI0M 4NRWA 4NY2A 1XHBA 1YU4A 1NY6A 3NBIA 3HHZA 1IN6A 3AOEA 3HONA 3GPXA 3SAUA 3LMMA 3U6DA 2W82A 1W5SA 4LF9M 2P5TA 1G59A 1IY0A 1TGUA 4PCZA 5ITUA 3T1YM 3FTEA 3U6LA 4B3RM 3KOZE 3VLFB 2FFFB 2L7HA 1QQWA 2X49A 3QWLA 4XGIA 3L27A 3J7AS 3UZUA 4KODA 2M60A 1IXZA 3KW6A 2KRKA 4L16A 4L4UA 3VKGA 1NSFA 1J5EM 2D7HA 2HKJA 5EXSA 4R7GA 4DV6M 3SFZA 2DWZB 3SBJA 3LQRA 4CGYB 1L8QA 3K8ZA 2F5SA 3GQ4A 2Y2OA 3FYCA 4DV2M 2IOUA 3LVWA 4FW9A 1ZAEA 2UU9M 1HQCA 3THGA 4OJLA 5EJCA 4MGZE 4NSRA 4BLCA 3R8FA 4K0KM 2DWMA 4LF5M 1IXSB 5EXTA 4DR4M 3FUUA 5EXPA 2I7PA 1IY2A 4B7FA 2I7NA 4DUZM 4YHHM 4OJOA 1GL7A 1Z59A 4DUYM 5IT9S 1DO0A 3KVWA 5ITTA 2QBYB 2OQ4A 4W5WA 3HJ8A 2XLJA 2KZUA 1OFIA 2KXEA 3A45A 4JI3M 1DGHB 1XXHB 3CF6E 3N3FA 3GP1A 2E5LM 3J2PB 1Q3BA 1TH2A 5FTKA 2X4AA 4OVZB 3WHKA 1E9SA 1HT1E 2QBYA 1E94E 3FUXA 2XZFA 2BJVA 2YR0A 2ZAOA 3FYDA 2R4EA 1Z5AA 5ITQA 3K1JA 3RFWA 2XF3A 1KFVA 1MX0A 2UWXA 4OX9M 3IG8A 1IXRC 2Y2JA 2QPAA 4JI1M 2DWNA 4XBOA 4AKIA 3FKEA 2ZBKB 4KLNA 4NL4H 3Q8XA 2CEAA 1Q39A 4LY6A 1IN7A 3D8BA 1HR0M 2LNHC 4RF0A 2G5GX 2XFSA 1XNQM 5E26A 2J7OA 4OJ6A 4MM3B 3ILKA 2Y2QA 4IBBA 4LFAM 3AL0C 1N33M 2XZUA 3EIHA 4LJ6A 3GLHA 3MJ5A 3CF2A 2KRUA 5FLXS 4L8RC 3KSJA 2L7IA 2F5OA 2C96A 3MHVC 3JAMS 1N32M 4AQYM 2LWXA 3HJQA 3T38A 4GHAA 4OW0A 1YU1A 1YU0A 2DWLA 2R46A 2QCUA 3TPZA 4QOZC 1Z5CA 1L1TA 3E4RA 3GPUA 1DGFA 3HJSA 4II7A 4LRSA 4G4RA 2XD1A 5GKNA 3ZCBB 2C9OA 5JI2E 4GMQA 3GRRA 2YFQA 3SC3A 2KEBA 5LMNM 3GLIB 3FUWA 3J7BA 1FJGM 4QNRA 1N77A 2K47A 2J7NA 1J09A 5ITRA 1TH3A 3L25A 2FE8A 4NZ4A 3T15A 2XSZA 1JR3D 2ERCA 4PT5A 5BPVA 1WXQA 1G41A 3RGPA 7CATA 5FTLA 5JI3E 1IN4A 3EIEA 2KZSA 3JR4A 2L09A 3GLIA 2Z3XA 3U5ZA 3HU2A 4AKHA 4P16A 3U6QA 4CISA 2VIIA 1HNWM 4FVMA 3GRUA 4M9ZA 1TDHA 4MGHA 4LZZA 1SXJD 3SMPA 4JI6M 1KSFX 5EP4A 4X64M 3AFHA 4DR5M 4WW0A 2UXBM 1IY1A 1QAMA 3U61A 4KHPM 3GLGB 4AZFA 2D7GA 4DV1M 3SAVA 3KFUG 1IN8A 2QENA 3U5ZB 2JA2A 3TWLA 3FUTA 4AKGA 2JCHA 4RNAA 1K3XA 4OJPA 5DYIA 3AV0A 2CHQA 2Y2LA 2C5RA 2M5ZA 3I4YA 1LV7A 4M0WA 3VFDA 1I4WA 3GLGA 3HGIA 4G4OA 2EO2A 4MB7A 4B3SM 2UUBM 3C58A 1OFHA 4PDIA 2CV1A 1N34M 3TE6A 4LG2A 2JE5A 3K92A 4FWDA 3SMSA 4MGKE 3A46A 3TWMA 5FSWA 3DZDA 2BG1A 3DA1A 2EUCA 3I51A 1UM8A 3T1HM 2Z4SA 3M0EA 1G8PA 1TH4A 3JR5A 3U6OA 3FD9A 3J81S 5H37D 1JQJC 3GO8A 2HHHM 2Y0TA 3FUVA 4GH9A 4IJEA 2L6OA 1QAOA 5FTMA 1L2BA 8CATA 2R45A 4GHLA 3IG5A 4B7HA 2YQZA 3QAUA 4AI6A 1N36M 1ZQ9A 3CF0A 2QP9X 4FD2A 5C1BA 5FTJA 1N75A 3AKZA 2C99A 3K2LA 3SHGB 5IWAM 4TUWA 2F5PA 5F3WA 1GKIA 4QOSA 3ZH9B 3WHLA 4GRIA 3UGJA 1YSYA 1IBKM 2UUAM 4NZ1A 5E6JA 3NWLA 1YU3A 2BNKA 3U60A 4OU7A 2R65A 1D2NA 3HHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L28 A;  4IBJ A;  4GHL A;  4IJE A;  4IBB A;  4LG2 A;  4IBD A;  4IBE A;  4IBC A;  3KS4 A;  3L2A A;  3L29 A;  3L27 A;  4IBG A;  3L25 A;  3L26 A;  4GH9 A;  4IBI A;  4GHA A;  4IBK A;  3FKE A;  3KS8 A;  4IBF A;  5BPV A;  4IJF A; 
#chains in the Genus database with same CATH topology
 4DV5 M;  3KXE C;  1TTE A;  3D8L A;  2LH0 A;  5LMU M;  3SAT A;  2HAK A;  4LJA A;  1ORY B;  4G4Q A;  1XNR M;  1GXD A;  3PNY A;  4JI7 M;  4DR6 M;  3U6E A;  5ITY A;  3KP0 E;  4LJ8 A;  3KOX E;  3WD3 A;  1Z6T A;  1XB2 B;  1Z5B A;  5C18 A;  4DV3 M;  2JY5 A;  1L1Z A;  5KQ8 A;  1V34 A;  4B3T M;  1R4G A;  4X62 M;  2OPF A;  3U6P A;  2O5R A;  2Y20 A;  1DGH A;  1XXH A;  2JY8 A;  4GEW A;  4B08 A;  1NO1 A;  3FTD A;  2EA0 A;  5IRE B;  3MQL A;  3UMM A;  2G8L A;  1IFY A;  1R6B X;  2GQF A;  4NOO B;  4LFC M;  3KS8 A;  1NHG C;  4JXJ A;  4DR3 M;  4NZ5 A;  4OVZ A;  4JYA M;  5DNY A;  1QZM A;  2DXI A;  3J27 B;  3AOG A;  4AG6 A;  1QAN A;  4PDG A;  2HCB A;  2BJW A;  2QZ4 A;  2Y2N A;  4NC6 A;  1QUT A;  1FNN A;  2OOB A;  2R62 A;  2UUC M;  1C1K A;  4GKJ M;  5BR8 M;  1A5T A;  1IN5 A;  1R7R A;  3LVV A;  2ZTD A;  5EP3 A;  4IBD A;  3RE8 A;  4B3M M;  4LZJ A;  4LJ4 A;  2DHY A;  1ZMW A;  2Z7J A;  1Q3C A;  2Z4R A;  1DO2 A;  2FNA A;  4B7G A;  1DGG A;  1YUB A;  5KPT A;  3SHF A;  3L26 A;  1E6R A;  4F2L A;  1NJF A;  5ITX A;  3U6S A;  3C3D A;  1K82 A;  1G4A E;  2APL A;  2B3T A;  3WD0 A;  1MN3 A;  4I5S A;  2KW0 A;  3E9S A;  4L15 A;  3KOW E;  2R0I A;  3W67 A;  2H5X A;  4M0D A;  2VF8 A;  3SAW A;  1R2Y A;  5FTN A;  1NJG A;  1QVR A;  2R4J A;  3GLH B;  3HKP A;  1N78 A;  1QDR A;  3HU3 A;  5ITX E;  3HHX A;  2EJS A;  2DZN B;  4LF7 M;  1NNU C;  4DV4 M;  4Z2H A;  2Y2G A;  1NNJ A;  3HY5 A;  4AW4 A;  2F4V M;  2RTS A;  4QNL A;  2L4F A;  2N35 A;  3B7Q A;  4HL4 A;  4IBE A;  4FWG A;  4NRV A;  1L2C A;  1RU3 A;  3L29 A;  1UR9 A;  3W0F A;  1XXH E;  3FE3 A;  4UN2 B;  4NXM M;  1IXS A;  1NVM A;  3FRI A;  3TWK A;  4HEO A;  2LTU A;  2RKO A;  1YU2 A;  3M6A A;  4IBK A;  2DZO B;  2BWB A;  1BVS A;  3ZQJ A;  2LVQ D;  4GKK M;  3UJN A;  2QHO B;  4LJ9 A;  2CV0 A;  4CIZ A;  1XC8 A;  1HNX M;  3U6M A;  1PM5 A;  4CHT B;  5IZ7 D;  4Z6Y A;  3TL4 X;  4BB9 A;  3SAR A;  1HQY E;  2UXD M;  1W1P A;  4LF6 M;  2K9D A;  4Z8X A;  2ZAN A;  1W1Y A;  2FFJ A;  1J7K A;  1T3T A;  4A3V B;  4D81 A;  2LVN C;  3L2A A;  3KP1 E;  1AIW A;  3PFI A;  3GLG E;  1E32 A;  2WSE F;  1TDZ A;  4IBG A;  1XMO M;  3AJI B;  4I8O A;  1VEK A;  2DI0 A;  4AG5 A;  1VQ1 A;  3GRV A;  4GC5 A;  4DV7 M;  2C98 A;  2O01 F;  4MGY E;  4KT0 F;  1PJJ A;  1E15 A;  5KPZ A;  3RGS A;  3CTW B;  3DOA A;  2CFO A;  4HLQ A;  4FCV A;  4GIP A;  1IQP A;  4LCB A;  2V1C A;  2LHC A;  3IHP A;  4M9S A;  4JI8 M;  2CHV A;  3BOS A;  4S12 A;  1IBL M;  4MGI E;  1MU5 A;  3FTF A;  3NBX X;  3GQ3 A;  1OTR A;  2DNA A;  2RGO A;  3UK6 A;  4ZPX A;  4LJ7 A;  1XWI A;  4FCW A;  3VKH A;  1DGB A;  1OIP A;  1YE9 A;  2XH9 A;  3VDU A;  5KPR A;  4TX8 A;  2JUJ A;  2CWB A;  3K9O A;  2R18 A;  4LGM A;  1KYI A;  4QHS A;  5DYG A;  4JI4 M;  2RGH A;  3BXW A;  3GRY A;  3HSH A;  1ED7 A;  4KO8 A;  3MK6 A;  2G3Q A;  1K3W A;  1HT2 E;  2XEP A;  5KQD A;  2KA6 B;  2DAI A;  2EKF A;  3KOY E;  4ITQ A;  4LF8 M;  4NYY A;  4FWH A;  1DV0 A;  2JXN A;  1CXW A;  2V6Z M;  4QNM A;  5EP2 A;  4G6Z A;  4WUR A;  4RF1 A;  4DR2 M;  4JN6 A;  1R2Z A;  4LF4 M;  4HME A;  4NXN M;  3W0L B;  2XD5 A;  1V92 A;  4M9X A;  4LRT A;  3HU1 A;  4I4L A;  4GC9 A;  1TR8 A;  2Y21 A;  1O6I A;  3PVS A;  2Y0Q A;  2MR9 A;  3VK8 A;  1VDL A;  4DR1 M;  2CV2 A;  2LXE A;  2HWJ A;  2DHR A;  2NQ8 C;  3K9P A;  3UZU A;  4D80 A;  3KS4 A;  3GPY A;  3SYK A;  2F5Q A;  1EIJ A;  3J80 S;  1SXJ A;  2H1R A;  4G4N A;  2YNM D;  3HWS A;  2XGN A;  4BBA A;  2OO9 A;  3GLF B;  2CE7 A;  3LCU A;  4DR7 M;  4FCT A;  2ZM6 M;  3HHW A;  4QHT A;  1PJT A;  1W5T A;  2LVA A;  3AOE C;  4LGY A;  1L6J A;  4DBG B;  3PNV A;  1JR3 A;  2XSZ D;  2ZTC A;  3A98 B;  4JI5 M;  3KDS E;  2LVP C;  1IBM M;  4IBJ A;  4I81 A;  1SXJ B;  4P17 A;  4REZ A;  1EAK A;  2DVW B;  2KNA A;  1D0M A;  3FTC A;  4MB5 A;  2CHG A;  4MH0 E;  4MB4 A;  2UXC M;  3I4V A;  1GL6 A;  3GLF A;  4OUI A;  4GIT A;  2DEN A;  1QAQ A;  4NSO B;  3M7G A;  4Z2K A;  2R6F A;  1YUE A;  3A42 A;  1SXJ E;  3GPP A;  1EE8 A;  4Z2G A;  4OJ5 A;  2ZAM A;  5KO3 A;  4IBC A;  3VDP A;  4LJ5 A;  2MJ5 B;  4WP2 A;  1PJI A;  2CUZ A;  3KSX A;  3PXG A;  5EP1 A;  3ZC7 B;  2VQE M;  3B9P A;  3U60 B;  1CK7 A;  2Y2M A;  1KS0 A;  5EQT A;  2L4E A;  3B74 A;  1SXJ C;  4D82 A;  4YY3 M;  3U61 B;  1C7Y A;  2V1U A;  3R9X B;  2X8A A;  2JWS A;  3GLF E;  4JV5 M;  4R3D A;  2F5N A;  2Y2I A;  1OQY A;  2MRO B;  2XFT A;  3GQ5 A;  4NYU A;  4PD2 A;  1QO6 A;  2QNJ A;  4MB3 A;  4JI2 M;  1WGN A;  1GLN A;  1G3I A;  2A5Y B;  1QYR A;  3L28 A;  4Z2L A;  4NZ3 A;  3SYL A;  1X37 A;  2CP8 A;  3DFZ A;  1VEG A;  4L78 A;  3TQS A;  2Z8Y M;  3WX7 A;  4F1I A;  1OAO C;  1I94 M;  4IIW A;  3U6C A;  1S3S A;  1E9R A;  3VK7 A;  2Y2K A;  1L2D A;  2Q2E B;  4EIW A;  2Y2H A;  3M7P A;  3OTO M;  1GVN A;  2Y2P A;  1W1T A;  1NV9 A;  2C9C A;  2D7E A;  5A2Q S;  4DV0 M;  3SAS A;  2VQF M;  1NHW C;  1VDD A;  3C9P A;  4X66 M;  3QYB A;  1H6U A;  1NY5 A;  4LFB M;  1IM2 A;  3BBZ A;  2JY6 B;  4IBI A;  3H4M A;  1JB0 F;  2HL7 A;  4X65 M;  5EXX A;  2FOI C;  4IBF A;  2AHM A;  2MH8 A;  1HNZ M;  3LQQ A;  1OJL A;  4IJF A;  1TF0 B;  3W68 A;  1XMQ M;  1GPF A;  1AIP C;  4JI0 M;  3IEC A;  4NRW A;  1V33 A;  1XHB A;  1GAB A;  1H8P A;  1NY6 A;  1YU4 A;  4NY2 A;  3NBI A;  3HHZ A;  1IN6 A;  3AOE A;  1H0G A;  3HON A;  3GPX A;  3SAU A;  3LMM A;  3U6D A;  2W82 A;  1W5S A;  4LF9 M;  1ZV1 A;  2P5T A;  1G59 A;  1IY0 A;  1TGU A;  4PCZ A;  5ITU A;  3T1Y M;  3FTE A;  2O25 A;  3U6L A;  4B3R M;  3KOZ E;  3VLF B;  1E6Z A;  3I01 M;  2FFF B;  2L7H A;  1QQW A;  2BWE A;  1WHC A;  2X49 A;  3QWL A;  4XGI A;  3L27 A;  3J7A S;  3B89 A;  2JZ1 A;  2FS1 A;  1IXZ A;  2M60 A;  2KRK A;  3KW6 A;  4KOD A;  4L16 A;  4L4U A;  1PDC A;  3VKG A;  1NSF A;  2FH0 A;  1J5E M;  2D7H A;  2HKJ A;  5EXS A;  4R7G A;  4DV6 M;  3SFZ A;  2DWZ B;  3SBJ A;  3LQR A;  4CGY B;  1L8Q A;  1D0K A;  3K8Z A;  1E8B A;  2F5S A;  3GQ4 A;  2Y2O A;  3FYC A;  1WJ7 A;  4DV2 M;  2IOU A;  2KDL A;  3LVW A;  2WZJ A;  4FW9 A;  1ZAE A;  2UU9 M;  1HQC A;  3THG A;  4OJL A;  5EJC A;  4MGZ E;  4NSR A;  4BLC A;  3R8F A;  4K0K M;  4Z2J A;  3B7Z A;  2DWM A;  4LF5 M;  1IXS B;  5EXT A;  4DR4 M;  2JZ0 A;  3FUU A;  1H0I A;  5EXP A;  2I7P A;  1IY2 A;  4B7F A;  2I7N A;  2VF7 A;  4DUZ M;  4YHH M;  3F92 A;  1CUK A;  1GL7 A;  1Z59 A;  2DKL A;  4DUY M;  4OJO A;  5IT9 S;  1DO0 A;  1T6O A;  3KVW A;  5ITT A;  2QBY B;  2OQ4 A;  4W5W A;  2MGW A;  3HJ8 A;  2XLJ A;  2KZU A;  1OFI A;  2KXE A;  3A45 A;  1VEJ A;  1DGH B;  1XXH B;  4JI3 M;  3CF6 E;  3N3F A;  3GP1 A;  2E5L M;  2KNV A;  4Z2I A;  1UFZ A;  3J2P B;  2DZL A;  1Q3B A;  1TH2 A;  3LW5 F;  5FTK A;  2X4A A;  1WR1 B;  4OVZ B;  1PGY A;  1WIV A;  2KHH A;  3WHK A;  1E9S A;  1HT1 E;  2QBY A;  2V5O A;  1E94 E;  3E21 A;  3FUX A;  2BJV A;  2XZF A;  2YR0 A;  2ZAO A;  1NV8 A;  2R4E A;  1Z5A A;  3FYD A;  5ITQ A;  3K1J A;  3RFW A;  2XF3 A;  1KFV A;  1MX0 A;  2L2D A;  4OX9 M;  1PJQ A;  3IG8 A;  2UWX A;  1IXR C;  3E46 A;  2Y2J A;  2QPA A;  2JNH A;  4JI1 M;  1OGG A;  1OIZ A;  2DWN A;  4XBO A;  4AKI A;  2OOA A;  2ZBK B;  3FKE A;  4KLN A;  4HMC A;  4NL4 H;  3Q8X A;  2CEA A;  1J7M A;  1Q39 A;  4LY6 A;  1IN7 A;  3D8B A;  1HR0 M;  2LNH C;  2CRU A;  4RF0 A;  3GLI E;  2G5G X;  2XFS A;  1XNQ M;  2DAE A;  5E26 A;  1ZMU A;  2J7O A;  4MM3 B;  2FN2 A;  4OJ6 A;  3ILK A;  2Y2Q A;  3HX3 A;  4IBB A;  4LFA M;  3CGW A;  3AL0 C;  1N33 M;  2XZU A;  1EFU B;  3EIH A;  4LJ6 A;  3GLH A;  3MJ5 A;  3CF2 A;  2KRU A;  5FLX S;  4L8R C;  5L8R F;  3C3E A;  3KSJ A;  4HMD A;  2L7I A;  2F5O A;  1Y8G A;  2C96 A;  3MHV C;  3JAM S;  1N32 M;  4AQY M;  2LWX A;  3HJQ A;  1QUS A;  3T38 A;  4GHA A;  3FRH A;  2GNO A;  4OW0 A;  3WD2 A;  1YU1 A;  1YU0 A;  2JP7 A;  2DWL A;  2R46 A;  2QCU A;  2K6B A;  3TPZ A;  4QOZ C;  1Z5C A;  1L1T A;  1E88 A;  1QDT A;  3E4R A;  3GPU A;  1DGF A;  3HJS A;  4II7 A;  4LRS A;  4G4R A;  2XD1 A;  5GKN A;  3ZCB B;  2C9O A;  5JI2 E;  4GMQ A;  1OGB A;  3GRR A;  2YFQ A;  1W1V A;  1PRB A;  3SC3 A;  1GOI A;  2KEB A;  5LMN M;  3GLI B;  3FUW A;  1HNW M;  3J7B A;  1GJT A;  1FJG M;  4QNR A;  1N77 A;  2K47 A;  2J7N A;  1J09 A;  3T6P A;  5ITR A;  1TH3 A;  1R5L A;  2FE8 A;  2LHG A;  1Q02 A;  2QQ8 A;  2JY7 A;  2K0B X;  3T15 A;  3L25 A;  4NZ4 A;  2XSZ A;  1JR3 D;  2ERC A;  4PT5 A;  5BPV A;  1WXQ A;  1G41 A;  3RGP A;  7CAT A;  5FTL A;  5JI3 E;  1IN4 A;  3EIE A;  3MMP A;  2KZS A;  3JR4 A;  2L09 A;  3GLI A;  2Z3X A;  3U5Z A;  3HU2 A;  4AKH A;  4P16 A;  3WD1 A;  1YLA A;  3U6Q A;  4CIS A;  2VII A;  3LCV B;  4FVM A;  3GRU A;  4M9Z A;  1TDH A;  4MGH A;  4LZZ A;  1SXJ D;  3SMP A;  4CJ6 A;  4JI6 M;  1KSF X;  5EP4 A;  1T43 A;  3AFH A;  3I04 M;  4X64 M;  4DR5 M;  4WW0 A;  2UXB M;  1IY1 A;  1QAM A;  3GLH E;  3U61 A;  4KHP M;  3GLG B;  4AZF A;  2D7G A;  4DV1 M;  3SAV A;  3KFU G;  1IN8 A;  2QEN A;  1D0L A;  3V76 A;  3U5Z B;  2D49 A;  2JA2 A;  3Q8G A;  3HZJ A;  3TWL A;  3FUT A;  2J5Y A;  4AKG A;  4RNA A;  1K3X A;  2JCH A;  1OAI A;  4OJP A;  5DYI A;  3AV0 A;  2CHQ A;  2Y2L A;  2C5R A;  2M5Z A;  3I4Y A;  1LV7 A;  1VG5 A;  4M0W A;  3VFD A;  1QZE A;  4L6V 6;  5DFL A;  1I4W A;  1SG9 A;  3GLG A;  3HGI A;  4G4O A;  1JR3 E;  2EO2 A;  1OKS A;  4MB7 A;  4B3S M;  2UUB M;  3C58 A;  1P3Q Q;  1OFH A;  4PDI A;  2CV1 A;  1N34 M;  2RRU A;  2QSF X;  3TE6 A;  4LG2 A;  2JE5 A;  3K92 A;  2KNZ A;  4FWD A;  3SMS A;  4R71 A;  1ZMV A;  4G3O A;  4MGK E;  3A46 A;  3TWM A;  3WD4 A;  2R44 A;  3H4J A;  2DAG A;  3DZD A;  5FSW A;  2BG1 A;  3DA1 A;  2EUC A;  2DAK A;  3I51 A;  1UM8 A;  3T1H M;  1F4I A;  2Z4S A;  3M0E A;  1G8P A;  1TH4 A;  1PJS A;  3JR5 A;  3U6O A;  1G71 A;  4XK8 F;  4ANR A;  3FD9 A;  3J81 S;  5H37 D;  1JQJ C;  2WSF F;  1E6N A;  3GO8 A;  2HHH M;  2DAM A;  2VDB B;  2Y0T A;  1LTM A;  3FUV A;  4GH9 A;  4IJE A;  2LVO C;  2L6O A;  1QAO A;  4Q7J A;  5FTM A;  8CAT A;  1L2B A;  2R45 A;  4GHL A;  3IG5 A;  3QYE A;  4B7H A;  2YQZ A;  1HJP A;  3QAU A;  4AI6 A;  1N36 M;  4RKU F;  4Y28 F;  1ZQ9 A;  3CF0 A;  2QP9 X;  4FD2 A;  5C1B A;  5FTJ A;  1E6P A;  1N75 A;  3AKZ A;  2C99 A;  3K2L A;  3SHG B;  1UR8 A;  5IWA M;  4TUW A;  1GJS A;  1AUA A;  2F5P A;  5F3W A;  1GKI A;  4QOS A;  3ZH9 B;  1WGL A;  3WHL A;  4GRI A;  2LBC A;  3UGJ A;  1YSY A;  1IBK M;  2UUA M;  4NZ1 A;  5E6J A;  3NWL A;  3B7N A;  1YU3 A;  1MJG M;  2BNK A;  3U60 A;  1GO5 A;  2EKK A;  4OU7 A;  2WSC F;  2R65 A;  1D2N A;  3HHY A; 
#chains in the Genus database with same CATH homology
 4DV5 M;  3KXE C;  3D8L A;  2LH0 A;  5LMU M;  3SAT A;  4LJA A;  4G4Q A;  1ORY B;  1XNR M;  3PNY A;  4JI7 M;  4DR6 M;  3U6E A;  5ITY A;  3KP0 E;  4LJ8 A;  3KOX E;  1Z6T A;  5C18 A;  1Z5B A;  4DV3 M;  1L1Z A;  5KQ8 A;  4B3T M;  4X62 M;  2OPF A;  3U6P A;  2O5R A;  2Y20 A;  1DGH A;  1XXH A;  4B08 A;  2EA0 A;  3FTD A;  5IRE B;  3UMM A;  2G8L A;  1R6B X;  4NOO B;  4LFC M;  3KS8 A;  1NHG C;  4JXJ A;  4DR3 M;  4NZ5 A;  4OVZ A;  4JYA M;  5DNY A;  1QZM A;  2DXI A;  3J27 B;  3AOG A;  4AG6 A;  1QAN A;  4PDG A;  2HCB A;  2BJW A;  2QZ4 A;  2Y2N A;  2R62 A;  1FNN A;  2UUC M;  4GKJ M;  1C1K A;  5BR8 M;  1IN5 A;  1R7R A;  3LVV A;  5EP3 A;  4IBD A;  3RE8 A;  4B3M M;  4LZJ A;  4LJ4 A;  2Z7J A;  1Q3C A;  2Z4R A;  1DO2 A;  2FNA A;  4B7G A;  1DGG A;  1YUB A;  5KPT A;  3SHF A;  3L26 A;  1NJF A;  5ITX A;  3U6S A;  1K82 A;  1G4A E;  4I5S A;  2KW0 A;  3E9S A;  4L15 A;  3KOW E;  4M0D A;  3SAW A;  1R2Y A;  5FTN A;  1NJG A;  1QVR A;  2R4J A;  3GLH B;  3HKP A;  1N78 A;  3HU3 A;  5ITX E;  3HHX A;  2DZN B;  4LF7 M;  1NNU C;  4DV4 M;  2Y2G A;  1NNJ A;  4AW4 A;  2F4V M;  4QNL A;  4HL4 A;  4IBE A;  4FWG A;  4NRV A;  1L2C A;  3L29 A;  3W0F A;  4NXM M;  1NVM A;  3TWK A;  2RKO A;  1YU2 A;  3M6A A;  4IBK A;  2DZO B;  4GKK M;  3UJN A;  4LJ9 A;  2CV0 A;  1XC8 A;  1HNX M;  3U6M A;  1PM5 A;  4CHT B;  5IZ7 D;  4Z6Y A;  3TL4 X;  4BB9 A;  3SAR A;  1HQY E;  2UXD M;  4LF6 M;  4Z8X A;  2ZAN A;  2FFJ A;  1J7K A;  1T3T A;  4A3V B;  4D81 A;  3L2A A;  3KP1 E;  3PFI A;  1E32 A;  1TDZ A;  4IBG A;  1XMO M;  3AJI B;  4I8O A;  4AG5 A;  3GRV A;  4GC5 A;  4DV7 M;  2C98 A;  4MGY E;  1PJJ A;  5KPZ A;  3RGS A;  3CTW B;  3DOA A;  2CFO A;  4HLQ A;  4FCV A;  4GIP A;  1IQP A;  4LCB A;  2V1C A;  4M9S A;  4JI8 M;  2CHV A;  3BOS A;  4S12 A;  1IBL M;  4MGI E;  1MU5 A;  3FTF A;  3GQ3 A;  2RGO A;  3UK6 A;  4ZPX A;  4LJ7 A;  1XWI A;  4FCW A;  3VKH A;  1DGB A;  2XH9 A;  1YE9 A;  3VDU A;  5KPR A;  4LGM A;  2R18 A;  5DYG A;  1KYI A;  4QHS A;  4JI4 M;  2RGH A;  3GRY A;  3HSH A;  4KO8 A;  3MK6 A;  1K3W A;  1HT2 E;  2XEP A;  5KQD A;  2KA6 B;  4ITQ A;  3KOY E;  4LF8 M;  4NYY A;  4FWH A;  2V6Z M;  4QNM A;  5EP2 A;  4G6Z A;  4WUR A;  4RF1 A;  4DR2 M;  4JN6 A;  1R2Z A;  4LF4 M;  4NXN M;  3W0L B;  2XD5 A;  4M9X A;  4LRT A;  3HU1 A;  4I4L A;  4GC9 A;  2Y21 A;  3PVS A;  2Y0Q A;  3VK8 A;  4DR1 M;  2CV2 A;  2LXE A;  2DHR A;  2NQ8 C;  4D80 A;  3GPY A;  3KS4 A;  3SYK A;  2F5Q A;  3J80 S;  1SXJ A;  2H1R A;  4G4N A;  2YNM D;  3HWS A;  2XGN A;  4BBA A;  3GLF B;  2CE7 A;  4DR7 M;  4FCT A;  2ZM6 M;  3HHW A;  4QHT A;  1W5T A;  3AOE C;  4LGY A;  3PNV A;  1JR3 A;  2XSZ D;  3A98 B;  4JI5 M;  3KDS E;  1IBM M;  4IBJ A;  4I81 A;  1SXJ B;  4REZ A;  2DVW B;  3FTC A;  2CHG A;  4MH0 E;  2UXC M;  3I4V A;  1GL6 A;  3GLF A;  4OUI A;  4GIT A;  1QAQ A;  4NSO B;  3M7G A;  1YUE A;  3A42 A;  1SXJ E;  3GPP A;  1EE8 A;  4OJ5 A;  2ZAM A;  5KO3 A;  4IBC A;  3VDP A;  4LJ5 A;  1PJI A;  2CUZ A;  3KSX A;  3PXG A;  5EP1 A;  3ZC7 B;  2VQE M;  3B9P A;  3U60 B;  2Y2M A;  5EQT A;  4D82 A;  4YY3 M;  1SXJ C;  3U61 B;  2V1U A;  3R9X B;  2X8A A;  4JV5 M;  4R3D A;  2F5N A;  2Y2I A;  2XFT A;  3GQ5 A;  4NYU A;  4PD2 A;  4JI2 M;  1GLN A;  1G3I A;  2A5Y B;  1QYR A;  3L28 A;  4NZ3 A;  3SYL A;  1X37 A;  3DFZ A;  4L78 A;  3TQS A;  3WX7 A;  1I94 M;  4IIW A;  3U6C A;  1S3S A;  1E9R A;  3VK7 A;  2Y2K A;  1L2D A;  2Q2E B;  4EIW A;  2Y2H A;  3OTO M;  1GVN A;  2Y2P A;  2C9C A;  2D7E A;  5A2Q S;  4DV0 M;  3SAS A;  2VQF M;  1NHW C;  1VDD A;  4X66 M;  1H6U A;  1NY5 A;  4LFB M;  1IM2 A;  4IBI A;  3H4M A;  2HL7 A;  4X65 M;  5EXX A;  2FOI C;  4IBF A;  2AHM A;  1HNZ M;  3LQQ A;  1OJL A;  4IJF A;  1XMQ M;  4JI0 M;  4NRW A;  4NY2 A;  1XHB A;  1YU4 A;  1NY6 A;  3NBI A;  3HHZ A;  1IN6 A;  3AOE A;  3HON A;  3GPX A;  3SAU A;  3LMM A;  3U6D A;  2W82 A;  1W5S A;  4LF9 M;  2P5T A;  1G59 A;  1IY0 A;  1TGU A;  4PCZ A;  5ITU A;  3T1Y M;  3FTE A;  3U6L A;  4B3R M;  3KOZ E;  3VLF B;  2FFF B;  2L7H A;  1QQW A;  2X49 A;  3QWL A;  4XGI A;  3L27 A;  3J7A S;  3UZU A;  4KOD A;  2M60 A;  1IXZ A;  3KW6 A;  2KRK A;  4L16 A;  4L4U A;  3VKG A;  1NSF A;  1J5E M;  2D7H A;  2HKJ A;  5EXS A;  4R7G A;  4DV6 M;  3SFZ A;  2DWZ B;  3SBJ A;  3LQR A;  4CGY B;  1L8Q A;  3K8Z A;  2F5S A;  3GQ4 A;  2Y2O A;  3FYC A;  4DV2 M;  2IOU A;  3LVW A;  4FW9 A;  1ZAE A;  2UU9 M;  1HQC A;  3THG A;  4OJL A;  5EJC A;  4MGZ E;  4NSR A;  4BLC A;  3R8F A;  4K0K M;  2DWM A;  4LF5 M;  1IXS B;  5EXT A;  4DR4 M;  3FUU A;  5EXP A;  2I7P A;  1IY2 A;  4B7F A;  2I7N A;  4DUZ M;  4YHH M;  4OJO A;  1GL7 A;  1Z59 A;  4DUY M;  5IT9 S;  1DO0 A;  3KVW A;  5ITT A;  2QBY B;  2OQ4 A;  4W5W A;  3HJ8 A;  2XLJ A;  2KZU A;  1OFI A;  2KXE A;  3A45 A;  4JI3 M;  1DGH B;  1XXH B;  3CF6 E;  3N3F A;  3GP1 A;  2E5L M;  3J2P B;  1Q3B A;  1TH2 A;  5FTK A;  2X4A A;  4OVZ B;  3WHK A;  1E9S A;  1HT1 E;  2QBY A;  1E94 E;  3FUX A;  2XZF A;  2BJV A;  2YR0 A;  2ZAO A;  3FYD A;  2R4E A;  1Z5A A;  5ITQ A;  3K1J A;  3RFW A;  2XF3 A;  1KFV A;  1MX0 A;  2UWX A;  4OX9 M;  3IG8 A;  1IXR C;  2Y2J A;  2QPA A;  4JI1 M;  2DWN A;  4XBO A;  4AKI A;  3FKE A;  2ZBK B;  4KLN A;  4NL4 H;  3Q8X A;  2CEA A;  1Q39 A;  4LY6 A;  1IN7 A;  3D8B A;  1HR0 M;  2LNH C;  4RF0 A;  2G5G X;  2XFS A;  1XNQ M;  5E26 A;  2J7O A;  4OJ6 A;  4MM3 B;  3ILK A;  2Y2Q A;  4IBB A;  4LFA M;  3AL0 C;  1N33 M;  2XZU A;  3EIH A;  4LJ6 A;  3GLH A;  3MJ5 A;  3CF2 A;  2KRU A;  5FLX S;  4L8R C;  3KSJ A;  2L7I A;  2F5O A;  2C96 A;  3MHV C;  3JAM S;  1N32 M;  4AQY M;  2LWX A;  3HJQ A;  3T38 A;  4GHA A;  4OW0 A;  1YU1 A;  1YU0 A;  2DWL A;  2R46 A;  2QCU A;  3TPZ A;  4QOZ C;  1Z5C A;  1L1T A;  3E4R A;  3GPU A;  1DGF A;  3HJS A;  4II7 A;  4LRS A;  4G4R A;  2XD1 A;  5GKN A;  3ZCB B;  2C9O A;  5JI2 E;  4GMQ A;  3GRR A;  2YFQ A;  3SC3 A;  2KEB A;  5LMN M;  3GLI B;  3FUW A;  3J7B A;  1FJG M;  4QNR A;  1N77 A;  2K47 A;  2J7N A;  1J09 A;  5ITR A;  1TH3 A;  3L25 A;  2FE8 A;  4NZ4 A;  3T15 A;  2XSZ A;  1JR3 D;  2ERC A;  4PT5 A;  5BPV A;  1WXQ A;  1G41 A;  3RGP A;  7CAT A;  5FTL A;  5JI3 E;  1IN4 A;  3EIE A;  2KZS A;  3JR4 A;  2L09 A;  3GLI A;  2Z3X A;  3U5Z A;  3HU2 A;  4AKH A;  4P16 A;  3U6Q A;  4CIS A;  2VII A;  1HNW M;  4FVM A;  3GRU A;  4M9Z A;  1TDH A;  4MGH A;  4LZZ A;  1SXJ D;  3SMP A;  4JI6 M;  1KSF X;  5EP4 A;  4X64 M;  3AFH A;  4DR5 M;  4WW0 A;  2UXB M;  1IY1 A;  1QAM A;  3U61 A;  4KHP M;  3GLG B;  4AZF A;  2D7G A;  4DV1 M;  3SAV A;  3KFU G;  1IN8 A;  2QEN A;  3U5Z B;  2JA2 A;  3TWL A;  3FUT A;  4AKG A;  2JCH A;  4RNA A;  1K3X A;  4OJP A;  5DYI A;  3AV0 A;  2CHQ A;  2Y2L A;  2C5R A;  2M5Z A;  3I4Y A;  1LV7 A;  4M0W A;  3VFD A;  1I4W A;  3GLG A;  3HGI A;  4G4O A;  2EO2 A;  4MB7 A;  4B3S M;  2UUB M;  3C58 A;  1OFH A;  4PDI A;  2CV1 A;  1N34 M;  3TE6 A;  4LG2 A;  2JE5 A;  3K92 A;  4FWD A;  3SMS A;  4MGK E;  3A46 A;  3TWM A;  5FSW A;  3DZD A;  2BG1 A;  3DA1 A;  2EUC A;  3I51 A;  1UM8 A;  3T1H M;  2Z4S A;  3M0E A;  1G8P A;  1TH4 A;  3JR5 A;  3U6O A;  3FD9 A;  3J81 S;  5H37 D;  1JQJ C;  3GO8 A;  2HHH M;  2Y0T A;  3FUV A;  4GH9 A;  4IJE A;  2L6O A;  1QAO A;  5FTM A;  1L2B A;  8CAT A;  2R45 A;  4GHL A;  3IG5 A;  4B7H A;  2YQZ A;  3QAU A;  4AI6 A;  1N36 M;  1ZQ9 A;  3CF0 A;  2QP9 X;  4FD2 A;  5C1B A;  5FTJ A;  1N75 A;  3AKZ A;  2C99 A;  3K2L A;  3SHG B;  5IWA M;  4TUW A;  2F5P A;  5F3W A;  1GKI A;  4QOS A;  3ZH9 B;  3WHL A;  4GRI A;  3UGJ A;  1YSY A;  1IBK M;  2UUA M;  4NZ1 A;  5E6J A;  3NWL A;  1YU3 A;  2BNK A;  3U60 A;  4OU7 A;  2R65 A;  1D2N A;  3HHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...