4GHLA

Structural basis for marburg virus vp35 mediate immune evasion mechanisms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
HMEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFMGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords short palindromic RNA AGACAGCAUAUGCUGUCU
publication title Structural basis for Marburg virus VP35-mediated immune evasion mechanisms.
pubmed doi rcsb
source organism Lake victoria marburgvirus
molecule tags Transcription, viral protein/rna
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ghlA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ghlA02
4IBKA 3L27A 3KS4A 4GHAA 3L26A 4IBDA 3L29A 4IJEA 4GHLA 4IBGA 3KS8A 3FKEA 4IBFA 3L2AA 3L28A 4IBBA 4IBIA 4GH9A 5BPVA 3L25A 4IBEA 4IBCA 4LG2A 4IJFA 4IBJA
chains in the Genus database with same CATH superfamily
2LNHC 5FTKA 3L27A 3I04M 3U5ZB 2CRUA 3KS4A 3V76A 2DNAA 3LQQA 3FTDA 4DR1M 4RKUF 4B3TM 3SC3A 1VDLA 3UK6A 4AW4A 2Y2NA 2UXDM 4Z2IA 5DYIA 1L1ZA 4AKIA 4LF9M 4HLQA 1IY2A 2R4EA 4JI7M 1HR0M 4AQYM 5E6JA 4HL4A 3HU3A 1N77A 1K3WA 1C7YA 3HJSA 2NQ8C 1L2DA 2Y21A 3D8LA 5FLXS 1DGFA 4CHTB 3KVWA 4WW0A 2XSZD 4LJ7A 2JE5A 2V6ZM 2UWXA 2XFSA 1IN6A 4I4LA 3KXEC 1QZMA 2R45A 3K1JA 3WX7A 4LF7M 3FD9A 4QOZC 1XB2B 3PNYA 3T1HM 1H6UA 2BWEA 3K92A 4G4NA 2MR9A 3B9PA 1PJQA 8CATA 1HQYE 2LH0A 1GABA 1EFUB 1E6PA 3ZQJA 2FNAA 1XC8A 1Z5AA 1DO0A 3FYDA 5L8RF 3HONA 1TH3A 2UXCM 1XXHA 1WGNA 4GKJM 2R4JA 2DI0A 1V92A 2ZANA 4PT5A 2VF8A 4FD2A 3THGA 2G3QA 2FFFB 1JR3D 2G5GX 2J5YA 3DZDA 2UUAM 1ZQ9A 1IM2A 3GLHE 1JR3A 4PDIA 2X4AA 1UR8A 4IBEA 1PGYA 2C98A 2KXEA 4TX8A 1NJGA 2Q2EB 2M5ZA 1QAMA 1IN7A 1QUSA 1MJGM 5H37D 3HX3A 4NRVA 3R8FA 2C9CA 1LTMA 3FE3A 4LGMA 3U6SA 2K47A 2JNHA 3GLHA 1ZMVA 4B08A 4MB5A 3Q8GA 3D8BA 1QANA 3M7GA 1W5TA 2JY5A 1XXHB 3WD0A 3OTOM 3VDPA 1OJLA 3LVVA 3CF2A 5EXSA 2J7NA 3GP1A 3BBZA 2FH0A 5EP3A 3QYBA 3DA1A 3L28A 4DV7M 3QYEA 4LF4M 3HGIA 1NHGC 3WHKA 3U6QA 4HMDA 1T43A 2KNZA 2DHRA 3TQSA 3K9PA 3MK6A 4NSRA 4Z2KA 4DV2M 1N33M 1T3TA 2Y2IA 1NSFA 4AG5A 2R44A 4NYUA 1Q3BA 2HKJA 3FUTA 3K8ZA 4WURA 1L2CA 2F5NA 4JI4M 1HNWM 3GLHB 1E15A 3WD3A 2DAIA 2LVOC 3I4YA 5ITTA 3GRRA 4IBDA 1XHBA 4MGIE 3VKGA 1TTEA 4B3MM 3L29A 2DWZB 3J80S 5C18A 5KO3A 4IBGA 4Z6YA 4NY2A 4OVZA 3PNVA 1IBMM 1G3IA 3F92A 1OGBA 3SHGB 2JUJA 3UJNA 2QHOB 1N34M 2KZSA 2LWXA 3BOSA 1CK7A 3L25A 1OKSA 3TPZA 5FTLA 2BJVA 4GC5A 1QYRA 2N35A 2ZAMA 1A5TA 2L6OA 2BG1A 4PD2A 3LCUA 1XNQM 1QAQA 3M0EA 4D81A 1QZEA 3KSXA 5FTMA 4AZFA 1DV0A 4LJ8A 2XD1A 4JI1M 5ITYA 1WJ7A 3GPUA 3VDUA 1TDZA 2V5OA 4NZ4A 4YHHM 1R5LA 5FTNA 2R65A 3GPYA 4QNMA 4P17A 4MGHA 4JN6A 3J7BA 4LGYA 4CISA 4RF0A 1IY1A 2KW0A 1NNJA 1G4AE 3TWLA 4Z2GA 4Q7JA 1WR1B 1L8QA 4LJ6A 2OOAA 3SMSA 4FW9A 1GJTA 2CHVA 5EXXA 2JZ0A 1TR8A 4L78A 4NZ5A 2DZOB 4FWHA 1PJIA 3B7QA 4X64M 4L6V6 4I8OA 2Y0TA 3HKPA 4OU7A 2DAGA 5IZ7D 4HMCA 5LMUM 1PDCA 2EJSA 3HWSA 4R71A 2DXIA 2YFQA 4HEOA 4KO8A 5GKNA 4BLCA 4GITA 4K0KM 1EIJA 1W1TA 2ERCA 1R4GA 3B7ZA 1TF0B 2RRUA 1HJPA 1WIVA 3RGPA 5JI2E 3Q8XA 4GKKM 4CIZA 3TWKA 2H5XA 4Z2JA 2Y2PA 3M6AA 1R6BX 2K6BA 3FTEA 1SXJD 2APLA 4DR2M 3RE8A 4GIPA 4B3RM 5IREB 3QWLA 2UXBM 1DO2A 1OAOC 3AOGA 2OQ4A 2AHMA 4RNAA 4FCWA 1D0MA 2JY8A 3IHPA 3FUXA 1L2BA 3SFZA 1NV9A 2F4VM 2YNMD 3B74A 1VQ1A 4OJLA 3J2PB 4GH9A 4L15A 3GQ4A 2X8AA 3A98B 4DR3M 2UUCM 4ITQA 4Z2LA 2LTUA 4TUWA 3GO8A 3SMPA 1JB0F 2XSZA 3MMPA 3GPXA 1YE9A 2EKKA 1XXHE 5KPTA 1KS0A 4JYAM 3GLGE 1E8BA 3SAWA 3IG8A 2QCUA 1DGBA 2JZ1A 3E9SA 4MH0E 2LXEA 3LMMA 4L4UA 3AV0A 2K9DA 1Z59A 3UGJA 2XH9A 2VIIA 2WSCF 4DR5M 2HL7A 3FUUA 1QAOA 1JR3E 2ZAOA 5LMNM 3B89A 2KNAA 4XBOA 4DR6M 1OIPA 2EKFA 2QP9X 5IT9S 3GLGA 2IOUA 2I7NA 3J27B 4JI0M 3L2AA 3U6EA 4NRWA 4AI6A 2Y2KA 1HNXM 4I81A 4OX9M 2C99A 2JY6B 1GJSA 3MHVC 3ZH9B 4DV0M 4DV3M 2R62A 1TGUA 1FJGM 2WZJA 4OW0A 4QNRA 3U6DA 1G71A 1TH4A 2I7PA 1R2ZA 3AOEA 3SAUA 1XMOM 4AKGA 1T6OA 4NSOB 4FWDA 4ZPXA 1QQWA 4L16A 5EP1A 1AIWA 2C96A 1PM5A 1N75A 1YU1A 5EXTA 4Z2HA 2DAMA 1NVMA 5DFLA 1WXQA 2JWSA 3U6OA 2MJ5B 1W1YA 4G4OA 3VLFB 4DV4M 3WD4A 5C1BA 3KOZE 4XK8F 3GLGB 1R2YA 4OJ5A 2L09A 4KHPM 2MH8A 3TWMA 3RGSA 2L4FA 3U6PA 2CHGA 5BR8M 3E21A 2JP7A 4LRSA 4MGKE 3DOAA 2DAEA 2XZUA 1ED7A 1GVNA 3CGWA 4LY6A 1ZMWA 4IJFA 3U6LA 4X65M 2DENA 4JV5M 3WHLA 1MN3A 4EIWA 1PJSA 3GLIB 1N36M 2D7GA 2VDBB 3HHWA 3KP0E 4GHAA 5E26A 2VQFM 1QDTA 4OUIA 5JI3E 1OFHA 1D0LA 4D82A 3UMMA 3ZCBB 1MX0A 2ZTDA 4GHLA 1FNNA 2FOIC 1KYIA 2KA6B 2LHGA 3NBIA 5ITXA 3W0FA 2LBCA 3SHFA 3HSHA 3FKEA 3UZUA 2BWBA 3GRYA 1IQPA 4DBGB 2UU9M 3HY5A 2D7HA 1YUBA 4LJ4A 4CJ6A 5KQDA 2DHYA 2OO9A 2XGNA 4NZ1A 1Z5CA 1MU5A 3MQLA 3AOEC 4F1IA 1XNRM 4AKHA 4NOOB 3NBXX 1VDDA 2DZNB 2L2DA 1D2NA 2LVQD 4RF1A 1IBLM 3I01M 1IY0A 3HHXA 4IBCA 1NV8A 2RGHA 4YY3M 1E88A 3N3FA 5F3WA 4ANRA 3ILKA 3VKHA 5EP2A 4QNLA 4IBJA 1HQCA 3CF6E 3IG5A 4M9SA 3A45A 1DGHA 2CV2A 2R46A 3K2LA 1OFIA 2OPFA 1UM8A 4NXMM 1H0GA 3JAMS 1Q39A 1W5SA 3KS8A 4I5SA 1Q02A 1DGGA 3VK8A 1V34A 1W1VA 4Y28F 2R18A 1GO5A 2O5RA 2EUCA 4FWGA 5EJCA 3LW5F 2YQZA 5EQTA 4II7A 2CFOA 3ZC7B 1OAIA 3H4JA 3PFIA 4REZA 3W0LB 4X66M 1SG9A 3HJ8A 1CXWA 3C58A 5KQ8A 2FE8A 1XWIA 3SAVA 1VEKA 4XGIA 2Y2GA 2QNJA 4QHTA 3E46A 2KEBA 3LCVB 2XLJA 4M9XA 1SXJE 4B3SM 3H4MA 1H0IA 1IN8A 3KOXE 3U60B 1DGHB 2VF7A 4Z8XA 1GKIA 1N32M 1GL7A 3J81S 4JI6M 1AUAA 4LF8M 1WGLA 4MB3A 4A3VB 1IXRC 1NJFA 2Y0QA 2FN2A 1NNUC 3GQ5A 4LFBM 1QVRA 1YSYA 1SXJA 5EXPA 3HHYA 5KPRA 4X62M 2DWMA 2Y2LA 1I4WA 5IWAM 1Z6TA 3SBJA 4IIWA 3SYLA 1VEGA 3KOYE 2Y2OA 3A42A 1WHCA 1E32A 2HAKA 4GC9A 1EE8A 4DR4M 1GOIA 3SARA 1OTRA 2CP8A 2O25A 1YU4A 3KDSE 1EAKA 1NO1A 4CGYB 4DV5M 3U61A 1BVSA 4FVMA 4JI8M 1F4IA 2L7IA 1G59A 1E6NA 3I51A 4GMQA 4R7GA 3U6CA 4BBAA 4HMEA 3FRHA 1Y8GA 3SYKA 2F5QA 4LFCM 2R0IA 3T15A 2QSFX 3TE6A 1J7MA 1G8PA 4UN2B 3PXGA 3BXWA 2Y2MA 1QDRA 4F2LA 3AL0C 1SXJB 5ITRA 3EIEA 2XF3A 2B3TA 4FCVA 3CTWB 4IBFA 4KLNA 2A5YB 2R6FA 4KT0F 4QHSA 3HHZA 1UFZA 2QQ8A 4IBBA 4JXJA 2M60A 1L1TA 1NHWC 2H1RA 3GRVA 5BPVA 1N78A 2JCHA 5FTJA 3T1YM 1E6ZA 4M0WA 2XD5A 3GLIE 3TL4X 2J7OA 1IN4A 3C3DA 1JQJC 1V33A 4NYYA 1L6JA 2KRKA 4PCZA 1IBKM 3U61B 4LFAM 1E9RA 2CEAA 3C3EA 2RKOA 2KHHA 4P16A 1O6IA 1PRBA 1K3XA 3KFUG 1YU0A 3FTFA 4G4QA 3GLIA 1J09A 1SXJC 2FS1A 2X49A 3DFZA 3I4VA 4IJEA 4LF5M 1YU3A 2C9OA 3VFDA 4B7GA 1GL6A 3KP1E 1D0KA 1P3QQ 4B7HA 3GQ3A 5DNYA 2CUZA 2XEPA 1H8PA 3HU1A 2Z7JA 1PJTA 4LZJA 3MJ5A 3GPPA 1ZMUA 4DV1M 3A46A 1GPFA 4LRTA 4GRIA 3FUVA 1R7RA 2P5TA 4MGZE 3VK7A 4GEWA 2DWNA 2V1UA 2RTSA 3WD1A 3LQRA 1OIZA 3FTCA 3FRIA 2JXNA 5EP4A 4MGYE 4D80A 4PDGA 4JI2M 2UUBM 1AIPC 3J7AS 4OJPA 2G8LA 3AFHA 5ITXE 2CWBA 2Z3XA 4G4RA 2Y2HA 2HCBA 3RFWA 1NY6A 1TH2A 2CHQA 3B7NA 4NC6A 4G3OA 1HT2E 4LZZA 4BB9A 4DUYM 1QUTA 2O01F 2QPAA 1HNZM 1E94E 1VEJA 2LVNC 2WSEF 1YLAA 2XFTA 3HZJA 1PJJA 1HT1E 4L8RC 2V1CA 3FYCA 1UR9A 4S12A 3GLFE 4LJ9A 2VQEM 1QO6A 2GNOA 1J7KA 4LJAA 3W67A 3KOWE 1NY5A 4NL4H 2KZUA 2DZLA 2QZ4A 1K82A 4LJ5A 1YUEA 2CV0A 2Y2QA 3FUWA 4IBIA 2MROB 3EIHA 2QENA 4MM3B 5KPZA 2F5OA 4NZ3A 4M9ZA 2D7EA 3W68A 2C5RA 2W82A 4QOSA 3K9OA 4JI3M 3GLFA 1X37A 3IECA 1E9SA 3T38A 4JI5M 3HU2A 4M0DA 4B7FA 2FFJA 3AJIB 1OQYA 2F5SA 3AKZA 3U60A 3CF0A 3L26A 2Z4RA 1KFVA 3SATA 2Y20A 2CV1A 1IN5A 3HJQA 4FCTA 1IXSA 3SASA 2CE7A 2KDLA 4AG6A 2WSFF 2QBYA 3T6PA 1E6RA 2JA2A 2D49A 4LCBA 2EO2A 1W1PA 2Y2JA 1J5EM 4MB4A 2JY7A 4LF6M 4R3DA 2LVAA 3JR5A 2BJWA 2F5PA 1VG5A 4MB7A 3GLFB 2LHCA 5ITQA 2ZM6M 2L4EA 1YU2A 3R9XB 4G6ZA 1I94M 3NWLA 3C9PA 3GRUA 2HHHM 1TDHA 4WP2A 2DKLA 2DVWB 1ZV1A 2GQFA 4IBKA 5A2QS 1LV7A 4OJ6A 3U5ZA 1Q3CA 3PVSA 4KODA 2K0BX 2XZFA 3KSJA 1IFYA 2LVPC 1CUKA 4DR7M 2KRUA 4OVZB 1IXSB 5ITUA 4DV6M 2KNVA 1XMQM 2RGOA 3LVWA 2ZTCA 5DYGA 2QBYB 3U6MA 3M7PA 1C1KA 1ORYB 2Z8YM 2DAKA 3QAUA 2BNKA 1RU3A 2Z4SA 1S3SA 3JR4A 5FSWA 1Z5BA 3WD2A 1GXDA 1KSFX 1GLNA 2MGWA 3KW6A 2E5LM 1OGGA 2YR0A 4NXNM 7CATA 4DUZM 3E4RA 2DWLA 1ZAEA 4W5WA 2EA0A 2OOBA 1G41A 2ZBKB 4LG2A 4OJOA 2HWJA 1IXZA 2L7HA
chains in the Genus database with same CATH topology
2LNHC 5FTKA 3L27A 3U5ZB 3KS4A 4DR1M 4B3TM 3LQQA 3FTDA 3SC3A 3UK6A 4AW4A 2Y2NA 2UXDM 5DYIA 1L1ZA 4AKIA 4LF9M 4HLQA 1IY2A 2R4EA 4JI7M 1HR0M 4AQYM 5E6JA 4HL4A 3HU3A 1N77A 1K3WA 3HJSA 2NQ8C 1L2DA 2Y21A 3D8LA 5FLXS 1DGFA 4CHTB 3KVWA 4WW0A 2XSZD 4LJ7A 2JE5A 2V6ZM 2UWXA 2XFSA 1IN6A 4I4LA 3KXEC 1QZMA 2R45A 3K1JA 3WX7A 4LF7M 3FD9A 4QOZC 3PNYA 3T1HM 1H6UA 3K92A 4G4NA 3B9PA 8CATA 1HQYE 2LH0A 1XC8A 2FNAA 1Z5AA 1DO0A 3FYDA 3HONA 1TH3A 2UXCM 1XXHA 4GKJM 2R4JA 2ZANA 4PT5A 4FD2A 3THGA 2FFFB 1JR3D 2G5GX 3DZDA 2UUAM 1ZQ9A 1IM2A 1JR3A 4PDIA 2X4AA 4IBEA 2C98A 2KXEA 1NJGA 2Q2EB 2M5ZA 1QAMA 1IN7A 3R8FA 5H37D 4NRVA 2C9CA 4LGMA 3U6SA 2K47A 3GLHA 4B08A 3D8BA 1QANA 3M7GA 1W5TA 1XXHB 3OTOM 3VDPA 1OJLA 3LVVA 3CF2A 5EXSA 2J7NA 3GP1A 5EP3A 3DA1A 3L28A 4DV7M 3HGIA 1NHGC 3WHKA 3U6QA 2DHRA 3TQSA 4NSRA 3MK6A 4DV2M 1N33M 1T3TA 2Y2IA 1NSFA 4AG5A 4NYUA 1Q3BA 2HKJA 3FUTA 3K8ZA 4WURA 1L2CA 2F5NA 4JI4M 1HNWM 3GLHB 3VKGA 3I4YA 5ITTA 3GRRA 4IBDA 1XHBA 4MGIE 4B3MM 3L29A 2DWZB 3J80S 5C18A 5KO3A 4IBGA 4Z6YA 4NY2A 4OVZA 3PNVA 1IBMM 1G3IA 3SHGB 3UJNA 1N34M 2KZSA 2LWXA 3BOSA 3L25A 3TPZA 5FTLA 2BJVA 4GC5A 1QYRA 2ZAMA 2L6OA 2BG1A 4PD2A 1XNQM 1QAQA 3M0EA 4D81A 3KSXA 5FTMA 4AZFA 4LJ8A 2XD1A 4JI1M 5ITYA 3GPUA 3VDUA 1TDZA 4NZ4A 4YHHM 5FTNA 2R65A 3GPYA 4QNMA 4MGHA 4JN6A 3J7BA 4LGYA 4CISA 4RF0A 1IY1A 2KW0A 1NNJA 1G4AE 3TWLA 1L8QA 4LJ6A 3SMSA 4FW9A 5EXXA 2CHVA 4L78A 4NZ5A 2DZOB 4FWHA 1PJIA 4X64M 4I8OA 2Y0TA 3HKPA 4OU7A 5IZ7D 5LMUM 3HWSA 2DXIA 2YFQA 4KO8A 5GKNA 4BLCA 4GITA 4K0KM 2ERCA 5JI2E 2Y2MA 3RGPA 3Q8XA 4GKKM 3TWKA 2Y2PA 3M6AA 1R6BX 3FTEA 1SXJD 4DR2M 3RE8A 4GIPA 4B3RM 5IREB 3QWLA 2UXBM 1DO2A 2OQ4A 3AOGA 2AHMA 4RNAA 4FCWA 3FUXA 1L2BA 3SFZA 2F4VM 2YNMD 4OJLA 3J2PB 4GH9A 4L15A 3GQ4A 2X8AA 3A98B 4DR3M 2UUCM 4ITQA 4TUWA 3GO8A 3SMPA 2XSZA 3GPXA 1YE9A 5KPTA 4JYAM 3SAWA 3IG8A 2QCUA 1DGBA 3E9SA 4MH0E 2LXEA 3LMMA 4L4UA 3AV0A 1Z59A 3UGJA 2XH9A 2VIIA 4DR5M 2HL7A 3FUUA 1QAOA 2ZAOA 5LMNM 4XBOA 4DR6M 2QP9X 5IT9S 3GLGA 2IOUA 2I7NA 3J27B 4JI0M 3L2AA 3U6EA 4NRWA 4AI6A 2Y2KA 1HNXM 4I81A 4OX9M 2C99A 3MHVC 3ZH9B 4DV0M 4DV3M 2R62A 1TGUA 1FJGM 4OW0A 3U6DA 4QNRA 1TH4A 2I7PA 1R2ZA 3AOEA 3SAUA 1XMOM 4AKGA 4NSOB 4FWDA 4ZPXA 1QQWA 4L16A 5EP1A 2C96A 1PM5A 1N75A 1YU1A 5EXTA 1NVMA 1WXQA 3U6OA 4G4OA 3VLFB 4DV4M 5C1BA 3KOZE 3GLGB 1R2YA 4OJ5A 2L09A 4KHPM 3TWMA 3RGSA 3U6PA 2CHGA 5BR8M 4LRSA 4MGKE 3DOAA 2XZUA 1GVNA 4LY6A 4IJFA 3U6LA 4X65M 4JV5M 3WHLA 4EIWA 3GLIB 1N36M 2D7GA 3HHWA 3KP0E 4GHAA 4OUIA 5E26A 2VQFM 5JI3E 1OFHA 4D82A 3UMMA 3ZCBB 1MX0A 4GHLA 1FNNA 2FOIC 1KYIA 2KA6B 3NBIA 3W0FA 5ITXA 3SHFA 3HSHA 3FKEA 3UZUA 3GRYA 1IQPA 2UU9M 2D7HA 1YUBA 4LJ4A 5KQDA 2XGNA 4NZ1A 1Z5CA 1MU5A 3AOEC 1XNRM 4AKHA 4NOOB 1VDDA 2DZNB 4RF1A 1D2NA 1IBLM 1IY0A 3HHXA 4IBCA 2RGHA 4YY3M 3N3FA 5F3WA 3ILKA 3VKHA 5EP2A 4QNLA 4IBJA 1HQCA 3CF6E 3IG5A 4M9SA 3A45A 1DGHA 2CV2A 2R46A 3K2LA 1OFIA 2OPFA 1UM8A 4NXMM 3JAMS 1Q39A 1W5SA 3KS8A 4I5SA 1DGGA 3VK8A 2R18A 2O5RA 2EUCA 4FWGA 5EJCA 2YQZA 5EQTA 4II7A 2CFOA 3ZC7B 4X66M 4REZA 3PFIA 3W0LB 3HJ8A 3C58A 5KQ8A 2FE8A 1XWIA 3SAVA 4XGIA 2Y2GA 4QHTA 2KEBA 2XLJA 4M9XA 1SXJE 4B3SM 3H4MA 1IN8A 3KOXE 3U60B 1DGHB 4Z8XA 1GKIA 1N32M 1GL7A 3J81S 4JI6M 4LF8M 4A3VB 1IXRC 1NJFA 2Y0QA 1NNUC 3GQ5A 4LFBM 1QVRA 1YSYA 1SXJA 5EXPA 3HHYA 5KPRA 4X62M 2DWMA 2Y2LA 1I4WA 5IWAM 1Z6TA 3SBJA 4IIWA 3SYLA 2Y2OA 3KOYE 3A42A 4DR4M 1E32A 4GC9A 1EE8A 3SARA 1YU4A 3KDSE 4CGYB 4DV5M 3U61A 4FVMA 4JI8M 2L7IA 1G59A 3I51A 4GMQA 4R7GA 3U6CA 4BBAA 3SYKA 2F5QA 4LFCM 3T15A 3TE6A 1G8PA 3PXGA 3AL0C 1SXJB 5ITRA 3EIEA 2XF3A 4FCVA 3CTWB 4IBFA 4KLNA 2A5YB 3HHZA 4QHSA 4IBBA 4JXJA 2M60A 1L1TA 1NHWC 2H1RA 3GRVA 5BPVA 1N78A 2JCHA 5FTJA 3T1YM 4M0WA 2XD5A 3TL4X 2J7OA 1IN4A 4NYYA 1JQJC 2KRKA 4PCZA 1IBKM 3U61B 4LFAM 1E9RA 2CEAA 2RKOA 4P16A 1YU0A 1K3XA 3KFUG 3FTFA 4G4QA 3GLIA 1J09A 1SXJC 2X49A 3I4VA 3DFZA 4LF5M 4IJEA 2C9OA 3VFDA 4B7GA 1GL6A 3KP1E 4B7HA 3GQ3A 5DNYA 2CUZA 2XEPA 3HU1A 2Z7JA 3GPPA 4LZJA 3MJ5A 4DV1M 3A46A 4LRTA 4GRIA 3FUVA 1R7RA 2P5TA 4MGZE 3VK7A 2DWNA 2V1UA 3LQRA 3FTCA 5EP4A 4D80A 4JI2M 4MGYE 4PDGA 2UUBM 3J7AS 4OJPA 2G8LA 3AFHA 5ITXE 2Z3XA 4G4RA 2Y2HA 2HCBA 3RFWA 1NY6A 1TH2A 2CHQA 4LF4M 4LZZA 1HT2E 4BB9A 4DUYM 1YU3A 2QPAA 1HNZM 1E94E 2XFTA 4L8RC 1PJJA 1HT1E 2V1CA 3FYCA 4S12A 2VQEM 4LJ9A 1J7KA 4LJAA 3KOWE 1NY5A 4NL4H 2KZUA 2QZ4A 1K82A 4LJ5A 1YUEA 2CV0A 2Y2QA 3FUWA 4IBIA 5KPZA 3EIHA 2QENA 4MM3B 4NZ3A 2F5OA 4M9ZA 2D7EA 2C5RA 2W82A 4QOSA 4JI3M 3GLFA 1X37A 1E9SA 3T38A 4JI5M 3HU2A 4M0DA 4B7FA 2FFJA 3AJIB 2F5SA 3AKZA 3U60A 3CF0A 3L26A 2Z4RA 1KFVA 3SATA 2Y20A 2CV1A 3HJQA 1IN5A 4FCTA 3SASA 2CE7A 4AG6A 2QBYA 2JA2A 4LCBA 2EO2A 2Y2JA 1J5EM 4LF6M 4R3DA 3JR5A 2BJWA 2F5PA 4MB7A 3GLFB 2ZM6M 5ITQA 1YU2A 3R9XB 4G6ZA 1I94M 3NWLA 3GRUA 2HHHM 1TDHA 2DVWB 4IBKA 4OJ6A 5A2QS 1LV7A 3U5ZA 1Q3CA 3PVSA 4KODA 2XZFA 3KSJA 4DR7M 2KRUA 4OVZB 1IXSB 5ITUA 4DV6M 1XMQM 2RGOA 3LVWA 5DYGA 2QBYB 3U6MA 1C1KA 1ORYB 3QAUA 2BNKA 2Z4SA 3JR4A 1S3SA 5FSWA 1Z5BA 1KSFX 1GLNA 3KW6A 2E5LM 2YR0A 4NXNM 7CATA 4DUZM 3E4RA 2DWLA 1ZAEA 4W5WA 2EA0A 1G41A 2ZBKB 4LG2A 4OJOA 1IXZA 2L7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBK A;  3L27 A;  3KS4 A;  4GHA A;  3L26 A;  4IBD A;  3L29 A;  4IJE A;  4GHL A;  4IBG A;  3KS8 A;  3FKE A;  4IBF A;  3L2A A;  3L28 A;  4IBB A;  4IBI A;  4GH9 A;  5BPV A;  3L25 A;  4IBE A;  4IBC A;  4LG2 A;  4IJF A;  4IBJ A; 
#chains in the Genus database with same CATH topology
 2LNH C;  5FTK A;  3L27 A;  3I04 M;  3U5Z B;  2CRU A;  3KS4 A;  3V76 A;  2DNA A;  3LQQ A;  3FTD A;  4DR1 M;  4RKU F;  4B3T M;  3SC3 A;  1VDL A;  3UK6 A;  4AW4 A;  2Y2N A;  2UXD M;  4Z2I A;  5DYI A;  1L1Z A;  4AKI A;  4LF9 M;  4HLQ A;  1IY2 A;  2R4E A;  4JI7 M;  1HR0 M;  4AQY M;  5E6J A;  4HL4 A;  3HU3 A;  1N77 A;  1K3W A;  1C7Y A;  3HJS A;  2NQ8 C;  1L2D A;  2Y21 A;  3D8L A;  5FLX S;  1DGF A;  4CHT B;  3KVW A;  4WW0 A;  2XSZ D;  4LJ7 A;  2JE5 A;  2V6Z M;  2UWX A;  2XFS A;  1IN6 A;  4I4L A;  3KXE C;  1QZM A;  2R45 A;  3K1J A;  3WX7 A;  4LF7 M;  3FD9 A;  4QOZ C;  1XB2 B;  3PNY A;  3T1H M;  1H6U A;  2BWE A;  3K92 A;  4G4N A;  2MR9 A;  3B9P A;  1PJQ A;  8CAT A;  1HQY E;  2LH0 A;  1GAB A;  1EFU B;  1E6P A;  3ZQJ A;  2FNA A;  1XC8 A;  1Z5A A;  1DO0 A;  3FYD A;  5L8R F;  3HON A;  1TH3 A;  2UXC M;  1XXH A;  1WGN A;  4GKJ M;  2R4J A;  2DI0 A;  1V92 A;  2ZAN A;  4PT5 A;  2VF8 A;  4FD2 A;  3THG A;  2G3Q A;  2FFF B;  1JR3 D;  2G5G X;  2J5Y A;  3DZD A;  2UUA M;  1ZQ9 A;  1IM2 A;  3GLH E;  1JR3 A;  4PDI A;  2X4A A;  1UR8 A;  4IBE A;  1PGY A;  2C98 A;  2KXE A;  4TX8 A;  1NJG A;  2Q2E B;  2M5Z A;  1QAM A;  1IN7 A;  1QUS A;  1MJG M;  5H37 D;  3HX3 A;  4NRV A;  3R8F A;  2C9C A;  1LTM A;  3FE3 A;  4LGM A;  3U6S A;  2K47 A;  2JNH A;  3GLH A;  1ZMV A;  4B08 A;  4MB5 A;  3Q8G A;  3D8B A;  1QAN A;  3M7G A;  1W5T A;  2JY5 A;  1XXH B;  3WD0 A;  3OTO M;  3VDP A;  1OJL A;  3LVV A;  3CF2 A;  5EXS A;  2J7N A;  3GP1 A;  3BBZ A;  2FH0 A;  5EP3 A;  3QYB A;  3DA1 A;  3L28 A;  4DV7 M;  3QYE A;  4LF4 M;  3HGI A;  1NHG C;  3WHK A;  3U6Q A;  4HMD A;  1T43 A;  2KNZ A;  2DHR A;  3TQS A;  3K9P A;  3MK6 A;  4NSR A;  4Z2K A;  4DV2 M;  1N33 M;  1T3T A;  2Y2I A;  1NSF A;  4AG5 A;  2R44 A;  4NYU A;  1Q3B A;  2HKJ A;  3FUT A;  3K8Z A;  4WUR A;  1L2C A;  2F5N A;  4JI4 M;  1HNW M;  3GLH B;  1E15 A;  3WD3 A;  2DAI A;  2LVO C;  3I4Y A;  5ITT A;  3GRR A;  4IBD A;  1XHB A;  4MGI E;  3VKG A;  1TTE A;  4B3M M;  3L29 A;  2DWZ B;  3J80 S;  5C18 A;  5KO3 A;  4IBG A;  4Z6Y A;  4NY2 A;  4OVZ A;  3PNV A;  1IBM M;  1G3I A;  3F92 A;  1OGB A;  3SHG B;  2JUJ A;  3UJN A;  2QHO B;  1N34 M;  2KZS A;  2LWX A;  3BOS A;  1CK7 A;  3L25 A;  1OKS A;  3TPZ A;  5FTL A;  2BJV A;  4GC5 A;  1QYR A;  2N35 A;  2ZAM A;  1A5T A;  2L6O A;  2BG1 A;  4PD2 A;  3LCU A;  1XNQ M;  1QAQ A;  3M0E A;  4D81 A;  1QZE A;  3KSX A;  5FTM A;  4AZF A;  1DV0 A;  4LJ8 A;  2XD1 A;  4JI1 M;  5ITY A;  1WJ7 A;  3GPU A;  3VDU A;  1TDZ A;  2V5O A;  4NZ4 A;  4YHH M;  1R5L A;  5FTN A;  2R65 A;  3GPY A;  4QNM A;  4P17 A;  4MGH A;  4JN6 A;  3J7B A;  4LGY A;  4CIS A;  4RF0 A;  1IY1 A;  2KW0 A;  1NNJ A;  1G4A E;  3TWL A;  4Z2G A;  4Q7J A;  1WR1 B;  1L8Q A;  4LJ6 A;  2OOA A;  3SMS A;  4FW9 A;  1GJT A;  2CHV A;  5EXX A;  2JZ0 A;  1TR8 A;  4L78 A;  4NZ5 A;  2DZO B;  4FWH A;  1PJI A;  3B7Q A;  4X64 M;  4L6V 6;  4I8O A;  2Y0T A;  3HKP A;  4OU7 A;  2DAG A;  5IZ7 D;  4HMC A;  5LMU M;  1PDC A;  2EJS A;  3HWS A;  4R71 A;  2DXI A;  2YFQ A;  4HEO A;  4KO8 A;  5GKN A;  4BLC A;  4GIT A;  4K0K M;  1EIJ A;  1W1T A;  2ERC A;  1R4G A;  3B7Z A;  1TF0 B;  2RRU A;  1HJP A;  1WIV A;  3RGP A;  5JI2 E;  3Q8X A;  4GKK M;  4CIZ A;  3TWK A;  2H5X A;  4Z2J A;  2Y2P A;  3M6A A;  1R6B X;  2K6B A;  3FTE A;  1SXJ D;  2APL A;  4DR2 M;  3RE8 A;  4GIP A;  4B3R M;  5IRE B;  3QWL A;  2UXB M;  1DO2 A;  1OAO C;  3AOG A;  2OQ4 A;  2AHM A;  4RNA A;  4FCW A;  1D0M A;  2JY8 A;  3IHP A;  3FUX A;  1L2B A;  3SFZ A;  1NV9 A;  2F4V M;  2YNM D;  3B74 A;  1VQ1 A;  4OJL A;  3J2P B;  4GH9 A;  4L15 A;  3GQ4 A;  2X8A A;  3A98 B;  4DR3 M;  2UUC M;  4ITQ A;  4Z2L A;  2LTU A;  4TUW A;  3GO8 A;  3SMP A;  1JB0 F;  2XSZ A;  3MMP A;  3GPX A;  1YE9 A;  2EKK A;  1XXH E;  5KPT A;  1KS0 A;  4JYA M;  3GLG E;  1E8B A;  3SAW A;  3IG8 A;  2QCU A;  1DGB A;  2JZ1 A;  3E9S A;  4MH0 E;  2LXE A;  3LMM A;  4L4U A;  3AV0 A;  2K9D A;  1Z59 A;  3UGJ A;  2XH9 A;  2VII A;  2WSC F;  4DR5 M;  2HL7 A;  3FUU A;  1QAO A;  1JR3 E;  2ZAO A;  5LMN M;  3B89 A;  2KNA A;  4XBO A;  4DR6 M;  1OIP A;  2EKF A;  2QP9 X;  5IT9 S;  3GLG A;  2IOU A;  2I7N A;  3J27 B;  4JI0 M;  3L2A A;  3U6E A;  4NRW A;  4AI6 A;  2Y2K A;  1HNX M;  4I81 A;  4OX9 M;  2C99 A;  2JY6 B;  1GJS A;  3MHV C;  3ZH9 B;  4DV0 M;  4DV3 M;  2R62 A;  1TGU A;  1FJG M;  2WZJ A;  4OW0 A;  4QNR A;  3U6D A;  1G71 A;  1TH4 A;  2I7P A;  1R2Z A;  3AOE A;  3SAU A;  1XMO M;  4AKG A;  1T6O A;  4NSO B;  4FWD A;  4ZPX A;  1QQW A;  4L16 A;  5EP1 A;  1AIW A;  2C96 A;  1PM5 A;  1N75 A;  1YU1 A;  5EXT A;  4Z2H A;  2DAM A;  1NVM A;  5DFL A;  1WXQ A;  2JWS A;  3U6O A;  2MJ5 B;  1W1Y A;  4G4O A;  3VLF B;  4DV4 M;  3WD4 A;  5C1B A;  3KOZ E;  4XK8 F;  3GLG B;  1R2Y A;  4OJ5 A;  2L09 A;  4KHP M;  2MH8 A;  3TWM A;  3RGS A;  2L4F A;  3U6P A;  2CHG A;  5BR8 M;  3E21 A;  2JP7 A;  4LRS A;  4MGK E;  3DOA A;  2DAE A;  2XZU A;  1ED7 A;  1GVN A;  3CGW A;  4LY6 A;  1ZMW A;  4IJF A;  3U6L A;  4X65 M;  2DEN A;  4JV5 M;  3WHL A;  1MN3 A;  4EIW A;  1PJS A;  3GLI B;  1N36 M;  2D7G A;  2VDB B;  3HHW A;  3KP0 E;  4GHA A;  5E26 A;  2VQF M;  1QDT A;  4OUI A;  5JI3 E;  1OFH A;  1D0L A;  4D82 A;  3UMM A;  3ZCB B;  1MX0 A;  2ZTD A;  4GHL A;  1FNN A;  2FOI C;  1KYI A;  2KA6 B;  2LHG A;  3NBI A;  5ITX A;  3W0F A;  2LBC A;  3SHF A;  3HSH A;  3FKE A;  3UZU A;  2BWB A;  3GRY A;  1IQP A;  4DBG B;  2UU9 M;  3HY5 A;  2D7H A;  1YUB A;  4LJ4 A;  4CJ6 A;  5KQD A;  2DHY A;  2OO9 A;  2XGN A;  4NZ1 A;  1Z5C A;  1MU5 A;  3MQL A;  3AOE C;  4F1I A;  1XNR M;  4AKH A;  4NOO B;  3NBX X;  1VDD A;  2DZN B;  2L2D A;  1D2N A;  2LVQ D;  4RF1 A;  1IBL M;  3I01 M;  1IY0 A;  3HHX A;  4IBC A;  1NV8 A;  2RGH A;  4YY3 M;  1E88 A;  3N3F A;  5F3W A;  4ANR A;  3ILK A;  3VKH A;  5EP2 A;  4QNL A;  4IBJ A;  1HQC A;  3CF6 E;  3IG5 A;  4M9S A;  3A45 A;  1DGH A;  2CV2 A;  2R46 A;  3K2L A;  1OFI A;  2OPF A;  1UM8 A;  4NXM M;  1H0G A;  3JAM S;  1Q39 A;  1W5S A;  3KS8 A;  4I5S A;  1Q02 A;  1DGG A;  3VK8 A;  1V34 A;  1W1V A;  4Y28 F;  2R18 A;  1GO5 A;  2O5R A;  2EUC A;  4FWG A;  5EJC A;  3LW5 F;  2YQZ A;  5EQT A;  4II7 A;  2CFO A;  3ZC7 B;  1OAI A;  3H4J A;  3PFI A;  4REZ A;  3W0L B;  4X66 M;  1SG9 A;  3HJ8 A;  1CXW A;  3C58 A;  5KQ8 A;  2FE8 A;  1XWI A;  3SAV A;  1VEK A;  4XGI A;  2Y2G A;  2QNJ A;  4QHT A;  3E46 A;  2KEB A;  3LCV B;  2XLJ A;  4M9X A;  1SXJ E;  4B3S M;  3H4M A;  1H0I A;  1IN8 A;  3KOX E;  3U60 B;  1DGH B;  2VF7 A;  4Z8X A;  1GKI A;  1N32 M;  1GL7 A;  3J81 S;  4JI6 M;  1AUA A;  4LF8 M;  1WGL A;  4MB3 A;  4A3V B;  1IXR C;  1NJF A;  2Y0Q A;  2FN2 A;  1NNU C;  3GQ5 A;  4LFB M;  1QVR A;  1YSY A;  1SXJ A;  5EXP A;  3HHY A;  5KPR A;  4X62 M;  2DWM A;  2Y2L A;  1I4W A;  5IWA M;  1Z6T A;  3SBJ A;  4IIW A;  3SYL A;  1VEG A;  3KOY E;  2Y2O A;  3A42 A;  1WHC A;  1E32 A;  2HAK A;  4GC9 A;  1EE8 A;  4DR4 M;  1GOI A;  3SAR A;  1OTR A;  2CP8 A;  2O25 A;  1YU4 A;  3KDS E;  1EAK A;  1NO1 A;  4CGY B;  4DV5 M;  3U61 A;  1BVS A;  4FVM A;  4JI8 M;  1F4I A;  2L7I A;  1G59 A;  1E6N A;  3I51 A;  4GMQ A;  4R7G A;  3U6C A;  4BBA A;  4HME A;  3FRH A;  1Y8G A;  3SYK A;  2F5Q A;  4LFC M;  2R0I A;  3T15 A;  2QSF X;  3TE6 A;  1J7M A;  1G8P A;  4UN2 B;  3PXG A;  3BXW A;  2Y2M A;  1QDR A;  4F2L A;  3AL0 C;  1SXJ B;  5ITR A;  3EIE A;  2XF3 A;  2B3T A;  4FCV A;  3CTW B;  4IBF A;  4KLN A;  2A5Y B;  2R6F A;  4KT0 F;  4QHS A;  3HHZ A;  1UFZ A;  2QQ8 A;  4IBB A;  4JXJ A;  2M60 A;  1L1T A;  1NHW C;  2H1R A;  3GRV A;  5BPV A;  1N78 A;  2JCH A;  5FTJ A;  3T1Y M;  1E6Z A;  4M0W A;  2XD5 A;  3GLI E;  3TL4 X;  2J7O A;  1IN4 A;  3C3D A;  1JQJ C;  1V33 A;  4NYY A;  1L6J A;  2KRK A;  4PCZ A;  1IBK M;  3U61 B;  4LFA M;  1E9R A;  2CEA A;  3C3E A;  2RKO A;  2KHH A;  4P16 A;  1O6I A;  1PRB A;  1K3X A;  3KFU G;  1YU0 A;  3FTF A;  4G4Q A;  3GLI A;  1J09 A;  1SXJ C;  2FS1 A;  2X49 A;  3DFZ A;  3I4V A;  4IJE A;  4LF5 M;  1YU3 A;  2C9O A;  3VFD A;  4B7G A;  1GL6 A;  3KP1 E;  1D0K A;  1P3Q Q;  4B7H A;  3GQ3 A;  5DNY A;  2CUZ A;  2XEP A;  1H8P A;  3HU1 A;  2Z7J A;  1PJT A;  4LZJ A;  3MJ5 A;  3GPP A;  1ZMU A;  4DV1 M;  3A46 A;  1GPF A;  4LRT A;  4GRI A;  3FUV A;  1R7R A;  2P5T A;  4MGZ E;  3VK7 A;  4GEW A;  2DWN A;  2V1U A;  2RTS A;  3WD1 A;  3LQR A;  1OIZ A;  3FTC A;  3FRI A;  2JXN A;  5EP4 A;  4MGY E;  4D80 A;  4PDG A;  4JI2 M;  2UUB M;  1AIP C;  3J7A S;  4OJP A;  2G8L A;  3AFH A;  5ITX E;  2CWB A;  2Z3X A;  4G4R A;  2Y2H A;  2HCB A;  3RFW A;  1NY6 A;  1TH2 A;  2CHQ A;  3B7N A;  4NC6 A;  4G3O A;  1HT2 E;  4LZZ A;  4BB9 A;  4DUY M;  1QUT A;  2O01 F;  2QPA A;  1HNZ M;  1E94 E;  1VEJ A;  2LVN C;  2WSE F;  1YLA A;  2XFT A;  3HZJ A;  1PJJ A;  1HT1 E;  4L8R C;  2V1C A;  3FYC A;  1UR9 A;  4S12 A;  3GLF E;  4LJ9 A;  2VQE M;  1QO6 A;  2GNO A;  1J7K A;  4LJA A;  3W67 A;  3KOW E;  1NY5 A;  4NL4 H;  2KZU A;  2DZL A;  2QZ4 A;  1K82 A;  4LJ5 A;  1YUE A;  2CV0 A;  2Y2Q A;  3FUW A;  4IBI A;  2MRO B;  3EIH A;  2QEN A;  4MM3 B;  5KPZ A;  2F5O A;  4NZ3 A;  4M9Z A;  2D7E A;  3W68 A;  2C5R A;  2W82 A;  4QOS A;  3K9O A;  4JI3 M;  3GLF A;  1X37 A;  3IEC A;  1E9S A;  3T38 A;  4JI5 M;  3HU2 A;  4M0D A;  4B7F A;  2FFJ A;  3AJI B;  1OQY A;  2F5S A;  3AKZ A;  3U60 A;  3CF0 A;  3L26 A;  2Z4R A;  1KFV A;  3SAT A;  2Y20 A;  2CV1 A;  1IN5 A;  3HJQ A;  4FCT A;  1IXS A;  3SAS A;  2CE7 A;  2KDL A;  4AG6 A;  2WSF F;  2QBY A;  3T6P A;  1E6R A;  2JA2 A;  2D49 A;  4LCB A;  2EO2 A;  1W1P A;  2Y2J A;  1J5E M;  4MB4 A;  2JY7 A;  4LF6 M;  4R3D A;  2LVA A;  3JR5 A;  2BJW A;  2F5P A;  1VG5 A;  4MB7 A;  3GLF B;  2LHC A;  5ITQ A;  2ZM6 M;  2L4E A;  1YU2 A;  3R9X B;  4G6Z A;  1I94 M;  3NWL A;  3C9P A;  3GRU A;  2HHH M;  1TDH A;  4WP2 A;  2DKL A;  2DVW B;  1ZV1 A;  2GQF A;  4IBK A;  5A2Q S;  1LV7 A;  4OJ6 A;  3U5Z A;  1Q3C A;  3PVS A;  4KOD A;  2K0B X;  2XZF A;  3KSJ A;  1IFY A;  2LVP C;  1CUK A;  4DR7 M;  2KRU A;  4OVZ B;  1IXS B;  5ITU A;  4DV6 M;  2KNV A;  1XMQ M;  2RGO A;  3LVW A;  2ZTC A;  5DYG A;  2QBY B;  3U6M A;  3M7P A;  1C1K A;  1ORY B;  2Z8Y M;  2DAK A;  3QAU A;  2BNK A;  1RU3 A;  2Z4S A;  1S3S A;  3JR4 A;  5FSW A;  1Z5B A;  3WD2 A;  1GXD A;  1KSF X;  1GLN A;  2MGW A;  3KW6 A;  2E5L M;  1OGG A;  2YR0 A;  4NXN M;  7CAT A;  4DUZ M;  3E4R A;  2DWL A;  1ZAE A;  4W5W A;  2EA0 A;  2OOB A;  1G41 A;  2ZBK B;  4LG2 A;  4OJO A;  2HWJ A;  1IXZ A;  2L7H A; 
#chains in the Genus database with same CATH homology
 2LNH C;  5FTK A;  3L27 A;  3U5Z B;  3KS4 A;  4DR1 M;  4B3T M;  3LQQ A;  3FTD A;  3SC3 A;  3UK6 A;  4AW4 A;  2Y2N A;  2UXD M;  5DYI A;  1L1Z A;  4AKI A;  4LF9 M;  4HLQ A;  1IY2 A;  2R4E A;  4JI7 M;  1HR0 M;  4AQY M;  5E6J A;  4HL4 A;  3HU3 A;  1N77 A;  1K3W A;  3HJS A;  2NQ8 C;  1L2D A;  2Y21 A;  3D8L A;  5FLX S;  1DGF A;  4CHT B;  3KVW A;  4WW0 A;  2XSZ D;  4LJ7 A;  2JE5 A;  2V6Z M;  2UWX A;  2XFS A;  1IN6 A;  4I4L A;  3KXE C;  1QZM A;  2R45 A;  3K1J A;  3WX7 A;  4LF7 M;  3FD9 A;  4QOZ C;  3PNY A;  3T1H M;  1H6U A;  3K92 A;  4G4N A;  3B9P A;  8CAT A;  1HQY E;  2LH0 A;  1XC8 A;  2FNA A;  1Z5A A;  1DO0 A;  3FYD A;  3HON A;  1TH3 A;  2UXC M;  1XXH A;  4GKJ M;  2R4J A;  2ZAN A;  4PT5 A;  4FD2 A;  3THG A;  2FFF B;  1JR3 D;  2G5G X;  3DZD A;  2UUA M;  1ZQ9 A;  1IM2 A;  1JR3 A;  4PDI A;  2X4A A;  4IBE A;  2C98 A;  2KXE A;  1NJG A;  2Q2E B;  2M5Z A;  1QAM A;  1IN7 A;  3R8F A;  5H37 D;  4NRV A;  2C9C A;  4LGM A;  3U6S A;  2K47 A;  3GLH A;  4B08 A;  3D8B A;  1QAN A;  3M7G A;  1W5T A;  1XXH B;  3OTO M;  3VDP A;  1OJL A;  3LVV A;  3CF2 A;  5EXS A;  2J7N A;  3GP1 A;  5EP3 A;  3DA1 A;  3L28 A;  4DV7 M;  3HGI A;  1NHG C;  3WHK A;  3U6Q A;  2DHR A;  3TQS A;  4NSR A;  3MK6 A;  4DV2 M;  1N33 M;  1T3T A;  2Y2I A;  1NSF A;  4AG5 A;  4NYU A;  1Q3B A;  2HKJ A;  3FUT A;  3K8Z A;  4WUR A;  1L2C A;  2F5N A;  4JI4 M;  1HNW M;  3GLH B;  3VKG A;  3I4Y A;  5ITT A;  3GRR A;  4IBD A;  1XHB A;  4MGI E;  4B3M M;  3L29 A;  2DWZ B;  3J80 S;  5C18 A;  5KO3 A;  4IBG A;  4Z6Y A;  4NY2 A;  4OVZ A;  3PNV A;  1IBM M;  1G3I A;  3SHG B;  3UJN A;  1N34 M;  2KZS A;  2LWX A;  3BOS A;  3L25 A;  3TPZ A;  5FTL A;  2BJV A;  4GC5 A;  1QYR A;  2ZAM A;  2L6O A;  2BG1 A;  4PD2 A;  1XNQ M;  1QAQ A;  3M0E A;  4D81 A;  3KSX A;  5FTM A;  4AZF A;  4LJ8 A;  2XD1 A;  4JI1 M;  5ITY A;  3GPU A;  3VDU A;  1TDZ A;  4NZ4 A;  4YHH M;  5FTN A;  2R65 A;  3GPY A;  4QNM A;  4MGH A;  4JN6 A;  3J7B A;  4LGY A;  4CIS A;  4RF0 A;  1IY1 A;  2KW0 A;  1NNJ A;  1G4A E;  3TWL A;  1L8Q A;  4LJ6 A;  3SMS A;  4FW9 A;  5EXX A;  2CHV A;  4L78 A;  4NZ5 A;  2DZO B;  4FWH A;  1PJI A;  4X64 M;  4I8O A;  2Y0T A;  3HKP A;  4OU7 A;  5IZ7 D;  5LMU M;  3HWS A;  2DXI A;  2YFQ A;  4KO8 A;  5GKN A;  4BLC A;  4GIT A;  4K0K M;  2ERC A;  5JI2 E;  2Y2M A;  3RGP A;  3Q8X A;  4GKK M;  3TWK A;  2Y2P A;  3M6A A;  1R6B X;  3FTE A;  1SXJ D;  4DR2 M;  3RE8 A;  4GIP A;  4B3R M;  5IRE B;  3QWL A;  2UXB M;  1DO2 A;  2OQ4 A;  3AOG A;  2AHM A;  4RNA A;  4FCW A;  3FUX A;  1L2B A;  3SFZ A;  2F4V M;  2YNM D;  4OJL A;  3J2P B;  4GH9 A;  4L15 A;  3GQ4 A;  2X8A A;  3A98 B;  4DR3 M;  2UUC M;  4ITQ A;  4TUW A;  3GO8 A;  3SMP A;  2XSZ A;  3GPX A;  1YE9 A;  5KPT A;  4JYA M;  3SAW A;  3IG8 A;  2QCU A;  1DGB A;  3E9S A;  4MH0 E;  2LXE A;  3LMM A;  4L4U A;  3AV0 A;  1Z59 A;  3UGJ A;  2XH9 A;  2VII A;  4DR5 M;  2HL7 A;  3FUU A;  1QAO A;  2ZAO A;  5LMN M;  4XBO A;  4DR6 M;  2QP9 X;  5IT9 S;  3GLG A;  2IOU A;  2I7N A;  3J27 B;  4JI0 M;  3L2A A;  3U6E A;  4NRW A;  4AI6 A;  2Y2K A;  1HNX M;  4I81 A;  4OX9 M;  2C99 A;  3MHV C;  3ZH9 B;  4DV0 M;  4DV3 M;  2R62 A;  1TGU A;  1FJG M;  4OW0 A;  3U6D A;  4QNR A;  1TH4 A;  2I7P A;  1R2Z A;  3AOE A;  3SAU A;  1XMO M;  4AKG A;  4NSO B;  4FWD A;  4ZPX A;  1QQW A;  4L16 A;  5EP1 A;  2C96 A;  1PM5 A;  1N75 A;  1YU1 A;  5EXT A;  1NVM A;  1WXQ A;  3U6O A;  4G4O A;  3VLF B;  4DV4 M;  5C1B A;  3KOZ E;  3GLG B;  1R2Y A;  4OJ5 A;  2L09 A;  4KHP M;  3TWM A;  3RGS A;  3U6P A;  2CHG A;  5BR8 M;  4LRS A;  4MGK E;  3DOA A;  2XZU A;  1GVN A;  4LY6 A;  4IJF A;  3U6L A;  4X65 M;  4JV5 M;  3WHL A;  4EIW A;  3GLI B;  1N36 M;  2D7G A;  3HHW A;  3KP0 E;  4GHA A;  4OUI A;  5E26 A;  2VQF M;  5JI3 E;  1OFH A;  4D82 A;  3UMM A;  3ZCB B;  1MX0 A;  4GHL A;  1FNN A;  2FOI C;  1KYI A;  2KA6 B;  3NBI A;  3W0F A;  5ITX A;  3SHF A;  3HSH A;  3FKE A;  3UZU A;  3GRY A;  1IQP A;  2UU9 M;  2D7H A;  1YUB A;  4LJ4 A;  5KQD A;  2XGN A;  4NZ1 A;  1Z5C A;  1MU5 A;  3AOE C;  1XNR M;  4AKH A;  4NOO B;  1VDD A;  2DZN B;  4RF1 A;  1D2N A;  1IBL M;  1IY0 A;  3HHX A;  4IBC A;  2RGH A;  4YY3 M;  3N3F A;  5F3W A;  3ILK A;  3VKH A;  5EP2 A;  4QNL A;  4IBJ A;  1HQC A;  3CF6 E;  3IG5 A;  4M9S A;  3A45 A;  1DGH A;  2CV2 A;  2R46 A;  3K2L A;  1OFI A;  2OPF A;  1UM8 A;  4NXM M;  3JAM S;  1Q39 A;  1W5S A;  3KS8 A;  4I5S A;  1DGG A;  3VK8 A;  2R18 A;  2O5R A;  2EUC A;  4FWG A;  5EJC A;  2YQZ A;  5EQT A;  4II7 A;  2CFO A;  3ZC7 B;  4X66 M;  4REZ A;  3PFI A;  3W0L B;  3HJ8 A;  3C58 A;  5KQ8 A;  2FE8 A;  1XWI A;  3SAV A;  4XGI A;  2Y2G A;  4QHT A;  2KEB A;  2XLJ A;  4M9X A;  1SXJ E;  4B3S M;  3H4M A;  1IN8 A;  3KOX E;  3U60 B;  1DGH B;  4Z8X A;  1GKI A;  1N32 M;  1GL7 A;  3J81 S;  4JI6 M;  4LF8 M;  4A3V B;  1IXR C;  1NJF A;  2Y0Q A;  1NNU C;  3GQ5 A;  4LFB M;  1QVR A;  1YSY A;  1SXJ A;  5EXP A;  3HHY A;  5KPR A;  4X62 M;  2DWM A;  2Y2L A;  1I4W A;  5IWA M;  1Z6T A;  3SBJ A;  4IIW A;  3SYL A;  2Y2O A;  3KOY E;  3A42 A;  4DR4 M;  1E32 A;  4GC9 A;  1EE8 A;  3SAR A;  1YU4 A;  3KDS E;  4CGY B;  4DV5 M;  3U61 A;  4FVM A;  4JI8 M;  2L7I A;  1G59 A;  3I51 A;  4GMQ A;  4R7G A;  3U6C A;  4BBA A;  3SYK A;  2F5Q A;  4LFC M;  3T15 A;  3TE6 A;  1G8P A;  3PXG A;  3AL0 C;  1SXJ B;  5ITR A;  3EIE A;  2XF3 A;  4FCV A;  3CTW B;  4IBF A;  4KLN A;  2A5Y B;  3HHZ A;  4QHS A;  4IBB A;  4JXJ A;  2M60 A;  1L1T A;  1NHW C;  2H1R A;  3GRV A;  5BPV A;  1N78 A;  2JCH A;  5FTJ A;  3T1Y M;  4M0W A;  2XD5 A;  3TL4 X;  2J7O A;  1IN4 A;  4NYY A;  1JQJ C;  2KRK A;  4PCZ A;  1IBK M;  3U61 B;  4LFA M;  1E9R A;  2CEA A;  2RKO A;  4P16 A;  1YU0 A;  1K3X A;  3KFU G;  3FTF A;  4G4Q A;  3GLI A;  1J09 A;  1SXJ C;  2X49 A;  3I4V A;  3DFZ A;  4LF5 M;  4IJE A;  2C9O A;  3VFD A;  4B7G A;  1GL6 A;  3KP1 E;  4B7H A;  3GQ3 A;  5DNY A;  2CUZ A;  2XEP A;  3HU1 A;  2Z7J A;  3GPP A;  4LZJ A;  3MJ5 A;  4DV1 M;  3A46 A;  4LRT A;  4GRI A;  3FUV A;  1R7R A;  2P5T A;  4MGZ E;  3VK7 A;  2DWN A;  2V1U A;  3LQR A;  3FTC A;  5EP4 A;  4D80 A;  4JI2 M;  4MGY E;  4PDG A;  2UUB M;  3J7A S;  4OJP A;  2G8L A;  3AFH A;  5ITX E;  2Z3X A;  4G4R A;  2Y2H A;  2HCB A;  3RFW A;  1NY6 A;  1TH2 A;  2CHQ A;  4LF4 M;  4LZZ A;  1HT2 E;  4BB9 A;  4DUY M;  1YU3 A;  2QPA A;  1HNZ M;  1E94 E;  2XFT A;  4L8R C;  1PJJ A;  1HT1 E;  2V1C A;  3FYC A;  4S12 A;  2VQE M;  4LJ9 A;  1J7K A;  4LJA A;  3KOW E;  1NY5 A;  4NL4 H;  2KZU A;  2QZ4 A;  1K82 A;  4LJ5 A;  1YUE A;  2CV0 A;  2Y2Q A;  3FUW A;  4IBI A;  5KPZ A;  3EIH A;  2QEN A;  4MM3 B;  4NZ3 A;  2F5O A;  4M9Z A;  2D7E A;  2C5R A;  2W82 A;  4QOS A;  4JI3 M;  3GLF A;  1X37 A;  1E9S A;  3T38 A;  4JI5 M;  3HU2 A;  4M0D A;  4B7F A;  2FFJ A;  3AJI B;  2F5S A;  3AKZ A;  3U60 A;  3CF0 A;  3L26 A;  2Z4R A;  1KFV A;  3SAT A;  2Y20 A;  2CV1 A;  3HJQ A;  1IN5 A;  4FCT A;  3SAS A;  2CE7 A;  4AG6 A;  2QBY A;  2JA2 A;  4LCB A;  2EO2 A;  2Y2J A;  1J5E M;  4LF6 M;  4R3D A;  3JR5 A;  2BJW A;  2F5P A;  4MB7 A;  3GLF B;  2ZM6 M;  5ITQ A;  1YU2 A;  3R9X B;  4G6Z A;  1I94 M;  3NWL A;  3GRU A;  2HHH M;  1TDH A;  2DVW B;  4IBK A;  4OJ6 A;  5A2Q S;  1LV7 A;  3U5Z A;  1Q3C A;  3PVS A;  4KOD A;  2XZF A;  3KSJ A;  4DR7 M;  2KRU A;  4OVZ B;  1IXS B;  5ITU A;  4DV6 M;  1XMQ M;  2RGO A;  3LVW A;  5DYG A;  2QBY B;  3U6M A;  1C1K A;  1ORY B;  3QAU A;  2BNK A;  2Z4S A;  3JR4 A;  1S3S A;  5FSW A;  1Z5B A;  1KSF X;  1GLN A;  3KW6 A;  2E5L M;  2YR0 A;  4NXN M;  7CAT A;  4DUZ M;  3E4R A;  2DWL A;  1ZAE A;  4W5W A;  2EA0 A;  1G41 A;  2ZBK B;  4LG2 A;  4OJO A;  1IXZ A;  2L7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...