4GHOA

Crystal structure analysis of streptomyces aureofaciens ribonuclease s24a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIAADGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4ghoA00
1LOVA 1BNSA 1BRGA 2F5MA 1I8VA 1DE3A 1YGWA 1B27A 5BU4A 1I3IA 3URPA 1A2PA 1RN1A 2AAEA 2F5WA 1T2HA 1TRPA 2KF6A 4RNTA 2AADA 3GSPA 1BRNL 1JBSA 4J5KA 1DETA 5GSPA 1RGFA 1BSEA 1ZGXA 1RGLA 1RGKA 2BIRA 3DGYA 3HOHA 1RNBA 7RNTA 1BRSA 3RNTA 1YVSA 2SARA 1BRJA 1UCIA 1GSPA 1R4YA 1RHLA 1BRIA 6GSPA 3AGNA 3D5GA 1B21A 1BNGA 1PY3A 1RMSA 1FW7A 1FYSA 1BU4A 1B2UA 1BANA 1CH0A 4BIRA 1RNTA 2C4BA 3WHOA 2KAAA 1GOUA 1GOYA 1UCLA 1RTUA 5HOHA 1SARA 1X1XA 1X1WA 3Q3FA 1RGAA 2KF5A 2KF4A 1Q9EA 1GMRA 5BIRA 2BU4A 1FUTA 1B2SA 1BNJA 1RGGA 6RNTA 1B2ZA 1UCKA 3WR2A 1AQZA 1LOWA 1BVIA 2KF3A 1JBTA 1I0XA 1RN4A 3A5EA 1BIRA 1B3SA 1JBRA 1TRQA 1FZUA 1BNRA 3D4AA 2F56A 1BRKA 3KCHA 1BSAA 1YNVX 2RBIA 3AHSA 1BNIA 1I3FA 1BRHA 1GOVA 1MGRA 1UCJA 1I2GA 1I2EA 1LOYA 1LNIA 1BGSA 4BU4A 4GHOA 1I0VA 1RGEA 3D5IA 4J5GA 1RLSA 1RSNA 1X1UA 4HAAA 1B2MA 1HYFA 1RCKA 2RNTA 1IYYA 1BSDA 1C54A 1PYLA 1TTOA 1X1YA 1B2XA 1MGWA 1BSCA 2F4YA 1AY7A 1BOXA 1RGHA 2ZA4A 1G02A 5RNTA 1I70A 3AHWA 4HOHA 3BU4A 1BNFA 1RGCA 1I2FA 1BSBA 7GSPA 3SYUA 1GMQA 2GSPA 1T2IA 3AGOA 9RNTA 3BIRA 3DH2A 1GMPA 1RDSA 1RCLA 1HZ1A 8RNTA 1B20A 1BAOA 2HOHA 1BUJA 1BNEA 4GSPA 1FUSA 1LRAA
chains in the Genus database with same CATH superfamily
2L4VA 3LH4A 3F8HA 3JUMA 1FGOA 1I3IA 4XBTA 2BNGA 1A2PA 1RN1A 3WOFB 4G1MB 2M7OA 2AADA 3GSPA 5M19A 1NB5I 1K734 2O9UX 3DMCA 1DETA 2WOFA 2CW9A 2F99A 2Y74A 4N6MA 2CWVA 4NHFA 4TX4A 1BSEA 1EA2A 1ZGXA 4RBNA 3ZG5A 2MC8A 1QAKA 1DVCA 4L7KA 3GZRA 1VQ83 1RNBA 3NBJA 2RSXA 3WA2X 3KSED 2SARA 4J9AA 1SQWA 2R4IA 4EXRA 3FH1A 1BRIA 1YGEA 4EW5A 6GSPA 3GAXA 1W6YA 1B21A 2O3OA 3NQZA 4BTXA 3NX0A 1YJ93 1PY3A 1JKGA 2GEXA 2GBXB 1FYSA 3FF2A 2WOHA 2CX0A 4FMAA 4HZBB 3X3XA 3WHOA 2OTL3 3S5CA 1G96A 1MWTA 2OQEA 1OUNA 1RTUA 4FMBA 4HKVB 3Q2PA 1MWRA 3EQQB 3ZFZA 1QAFA 4AKYA 4KZ1A 5CF1A 2I9WA 1DMQA 3GZBA 3WDGB 5EEOA 1RGAA 4K61A 1K28A 3CNXA 3N9HA 4I4KA 4EYCA 5ELUA 3OX9A 2BU4A 1FUTA 3JUNA 1QALA 4STDA 5G1KA 3KIIA 2LQVA 3WA3A 1AV4A 1MWUA 3WR2A 4I5QA 1LOWA 1W2B2 1BUQA 2H0GA 3S29A 1NDOB 1TP6A 3T8NA 3LYGA 3NBBA 3FF0A 4IIAA 3EBTA 1AR0A 5IG3A 5M1AA 1OCVA 2HMKB 1STFI 3AHSA 1JNQA 1Q7HA 1YNVX 1QMAA 1TFKA 2XGLA 4LYLB 4N6V0 1GOVA 4ILFA 2W9QA 3VF1A 1LNHA 4KVHA 4WFOA 3B4OA 5AEUB 1CYUA 4N6TA 2RCDA 3S67A 1I0VA 1RGEA 3T0UA 1KD14 3BNCA 1RLSA 1RSNA 3MG3A 4J5GA 1IVUA 3N8BA 3RGAA 2YX9A 4OK0A 1MNLA 3UNLA 1TTOA 1SPUA 3NQYA 2CWUA 4XBXA 2E2TA 1BOXA 1ZS7A 4CPKA 3CCV3 3KZTA 4CDLA 2CC3A 4KFEA 5STDA 3AHWA 1IV7A 1IU7A 1ZO2A 5AYRB 5IF6A 3X3ZA 1U8CB 2W2CA 3DXOA 1NU3A 1BNFA 1W6CA 1WQLB 2CIUA 2P38A 3PCSA 5ELJA 3TDGA 1FGMA 3MSOA 1EG9B 3CCL3 3BIRA 3B4PA 2CFLA 1E3VA 3H51A 4X2HA 3CC43 2OQEC 3UB1A 3D9RA 4WWUC 2L1SA 1SJWA 3EE1A 2D42A 1EUIC 1U5OA 3M8CA 3G0KA 1JN5B 3STDA 1UI8A 1TUHA 5IG0A 1UDII 3NBRA 4R9LA 5IEPA 3FKAA 3Q90A 2INXA 3EN1B 3FCSB 3IMAB 3SLUA 5I97A 1KQS2 8CHOA 3J7Yd 3CCM3 3X42A 4NPBA 3OWYA 1BRGA 1FGRA 2HMLB 1CYVA 1W6GA 2MF7A 1I8VA 3MHEA 3LTAA 1YHQ3 3CC23 2AAEA 4EC6A 2RFRA 1TRPA 2KF6A 4RNTA 1Q42A 2XFTA 2FGTA 4J5KA 2V1LA 2Z7AA 4J8TA 3ECFA 2WO0A 2OWPA 3F7XA 3CMA3 4BL3A 4WYKA 1TFOA 1UI7A 1W2ZA 1S723 2YFIB 1UGIA 1M1K4 7RNTA 4XB5A 1BRSA 3ALAA 1JZOA 1UUGB 3T8UA 1IDPA 3F7SA 1SIHA 1VQ93 3GWRA 1GSPA 2PZVA 2OOVC 3U1WA 2C10A 2GU3A 3K63A 3NXJA 5G1LA 2P05A 3G713 2E2VA 3I0YA 5D81A 3DM8A 1JJ22 3B8LA 4XBYA 3G8ZA 4K1UA 4R9KA 1KC84 1DYUA 1RMSA 1FW7A 2GEYA 1BANA 3ER7A 2W04A 4HM5B 2BMOB 2K0MA 2C4BA 1N9EA 3B7CA 2KAAA 3JUOA 3NV0B 1JKGB 2UGIA 1M904 4MEIA 2Z6BA 3IJEB 3X3YA 1TU5A 3LTDA 4XDWA 4O2HA 2KF4A 3SOYA 1V57A 1A2KA 5AI1A 1SIIA 1PU4A 3WOEB 6STDA 1DMNA 3FLJA 1RGGA 3D79A 3DY5A 1B2ZA 1IQXA 3NUVA 1LQGC 4KFDA 1VQN3 1UUVB 4KFFA 3KKGA 1VQ53 4HYZA 1JBRA 1I0XA 2K54A 4PEJA 1B3SA 3PYJA 1FZUA 3SVAA 1BNRA 3NV0A 2W56A 1Q824 1O7WB 2RBIA 1FA3A 1I3FA 2XFSA 1OGXA 3CCJ3 1MGRA 2J8XB 3MYTA 1I2EA 3OWSA 3EHCA 5AEWB 4BU4A 3S27A 4HM0B 5CF2A 4ZM8A 1Q40B 3H3HA 3KSPA 1IK3A 3CXC2 1B2MA 4HM2B 1RCKA 4LGQA 3RDEA 1Z1SA 1BSDA 3FG4A 1MGWA 3JUQA 1BSCA 1K41A 1RGHA 5RNTA 3LMLA 1IVWA 1I70A 4RZMA 5D82A 3G4S3 3BU4A 3PGBA 2ZL8A 1QVF2 5CXOA 3K5TA 1BSBA 3LOYA 7GSPA 1IT8A 2Z76A 5DRVA 4HVNA 1W02A 2C11A 1T2IA 4R1KA 5CLKA 1IQ8A 4N6NB 4OUQA 1HKXA 3KE7A 1LQMB 1JRQA 3HX8A 1Q40A 4EV5A 1IVVA 2JQ5A 1GMPA 1RDSA 1VZZA 3EX9A 4BL2A 3GZYB 4FMCA 1KSIA 2OOVA 1KWIA 1W5ZA 1E97A 1Y4KA 2P09A 1YI23 1BUJA 1N5PA 1VQP3 1FGQA 2A15A 3F14A 2IUKA 3DGMA 4HM8B 4QWTA 1BNEA 1A67A 4Q53A 1WNHA 1TIJA 4GSPA 4LMIA 5JBSA 1D6UA 1N8QA 2W0QA 3A76A 1BNSA 2KCDA 3BNDA 3EC9A 1ULIB 2K3DA 4WHAA 4NREA 1OHOA 1R4CA 1B27A 3KFQC 4XM4A 5BU4A 5KP4A 3MG1A 3URPA 3HK4A 2UX0A 2CX1A 2F5WA 3D3LA 3DGLA 1VQK3 2QGUA 1VQQA 1BRNL 3PCRA 1JBSA 2H0HA 1GS3A 4HJLB 2E2UA 3MG2A 2GXFA 1ROVA 3CPW2 4GL6A 4OVMA 2BMQB 2D1WA 4U13A 4RNYA 1RGLA 4N6OB 1GD4A 1YVBI 2F86B 4R80A 1J2BA 3FSDA 2HMJB 4WYKB 1STDA 3L0RA 5EQLA 1OHSA 3RNTA 1YJW3 1C7HA 1MWSA 1NWWA 1GY6A 2UUGC 1BRJA 3JVCA 5A0OB 3K0ZA 1UCIA 2QIYA 1VQ73 1R4YA 1RHLA 1OGZA 3AGNA 3EN8A 1BNGA 2ML5A 4CCVA 2CFKA 2IMJA 1O7PB 1BU4A 1B2UA 1CH0A 2Z77A 2ML6A 5IEOA 4BIRA 2BHMA 3LTCA 3RGRA 1EKMA 3SX1A 1VQM3 1UCLA 3WODG 1O7MB 3FG1A 2CG1A 1WTHA 5JPPA 1N5HA 3CCS3 3V92A 3MPHA 2F98A 3VSYA 4CJNA 2KF5A 4N3VA 1GYBA 1WMPA 3CU3A 4ORLA 3S28A 1V58A 2OTJ3 1JZDA 1GY5A 2CG0A 3JUPA 3OWUA 2KXGA 2ZHXB 3A5EA 2H0IA 3X40A 3I563 1JB5A 1TRQA 1OACA 4BTYA 2Q07A 3D4AA 3I553 2F56A 1DVDA 5IERA 1ASKA 1M1XB 1VQ63 2R41A 3CPOA 1BNIA 4FMDA 3FZWA 5FW5A 1OF5A 1BRHA 3AMOB 1UCJA 4LEHA 1I2GA 1T5YA 2KRTA 1CQSA 1FGTA 1LNIA 1LOYA 1O7GB 1UUWB 2W56B 3HI7A 2XSOB 2YFLB 4GHOA 1Q814 1F8NA 1HU9A 3D5IA 3HIIA 1LOXA 5D83A 1EEJA 2XSHB 4HAAA 3CME3 1CEWI 2W6JH 3G6E3 4GB5A 3VGNA 2RNTA 1IYYA 1M9GA 4HM7B 1X1YA 3LXUX 5AIFA 3EJVA 2JDIH 3SOAA 3CNMA 2F4YA 3FG3A 3OXAA 5FGOA 1YIT3 3DUKA 3MKIA 1A90A 4RNZA 1GY7A 2IYJA 3NHXA 3UL5A 2PNCA 3V98A 5M18A 3AMOA 5G2GA 2QA43 2P0MA 2GBWB 1IT7A 2LYXA 2SBLA 3G16A 2QEX3 1RGCA 1I2FA 3HZPA 1OHPA 3SYUA 1GMQA 5JPUA 1NJI4 3CC73 5AIGA 1QVG2 1TJDA 3AGOA 9RNTA 2BT3A 4L8PA 3EB8A 3DH2A 4KT3B 2W03A 2XH9A 4EV2A 5IENA 3CCE3 2FXTA 1ULJB 1NO3A 1RCLA 1HZ1A 3HIGA 3CCU3 2FNQA 4O8SA 1D6YA 1BAOA 4WP5A 1NNVA 1ISKA 2GU1A 3LT8A 1S5AA 1US1A 4HM6B 3E99A 1AVLA 1L5GB 1T3BA 1LOVA 2F5MA 2IY2A 1DE3A 1YGWA 5CK6A 1ROAA 3UJMA 2CFDA 1W01A 2BMRB 2XEPA 4FCMA 1T2HA 3GZXB 1IV9A 3F40A 2P0XA 4JRFA 3BNEA 3LZAA 1QJGA 2IUJA 5GSPA 1IQYA 1RGFA 1RGKA 5TGNA 4L8OA 2BIRA 3BB9A 1YJN3 3DGYA 1AVKA 3HOHA 2CKFB 5AIIA 3U97A 3K7CA 2XR8B 5LC7A 1W7CA 3QRDA 1RN7A 1YVSA 1VQ43 1RRHA 1Q864 7STDA 5IW9A 5IG4A 5LC6A 3K9MC 2ZDJA 5HGRA 3F9SA 3D5GA 1K8A4 1WMOA 3NM7A 3ZG0A 1RNTA 3Q1CA 1O7NB 4K90B 4BTWA 3V99A 4O3VA 1GOUA 4AKZA 1GOYA 2BO9B 4FCZA 4HM3B 3ROBA 3QK9A 5HOHA 1SARA 2IA7A 5IG5A 1X1XA 1X1WA 4IPBA 3Q3FA 2CHCA 3PS8A 1E3RA 3BNBA 4LSOA 1Q9EA 1GMRA 5BIRA 2W9PA 3LTBA 4JF8A 1W00A 3IPTA 1V74A 4FR9A 3OV4A 4H61A 5KP3A 1B2SA 1BNJA 6RNTA 1UCKA 1AQZA 1BVIA 2Y73A 3PXMA 2KF3A 3X41A 1K9M4 1RN4A 4O02B 1BIRA 1OPYA 2B1XB 4IT7A 1JBTA 4HBRA 2XGNA 4X2OA 1EQKA 1NB3I 1BRKA 2STDA 1UW1A 1ZX2A 3KCHA 1RJOA 3N54B 1BSAA 3UL6A 1MOLA 4HM4B 2CFGA 5KP1A 2WGOA 3NM2A 1JB4A 1BGSA 1UGHI 1D6ZA 2XRXB 1OF5B 2RGQA 3PZWA 4HZ9B 4DKIA 4K1VA 5BVBA 3DGOA 1VQL3 3GRDA 1JV2B 1X1UA 3F8XA 3EBYA 2B24B 1HYFA 1RKYA 3CCQ3 4XDVA 5BXQA 1C54A 1PYLA 1B2XA 1O7HB 4HM1B 1DMMA 1LVNA 1AY7A 2ZA4A 2XF3A 1A2VA 1G02A 3BLZA 3FGYA 4MMZB 2WGQA 3WMDA 3LT9A 3KN4A 1WMNA 2YFJB 1RRLA 4HOHA 4H3UA 1FUWA 1N8R4 3CD63 5AYSC 3DGNA 4N6LA 2GSPA 3SEDA 4FCJA 2CH9A 3CCR3 3MWZA 3O8YA 2CK3H 2CFWA 1OH0A 1N9JA 4MMYB 2CWTA 1JB2A 2HMNB 2HMMB 1GD3A 1PFPA 1W4NA 4R4KA 2OCTA 1YIJ3 4LZIA 1JN5A 1Q7Y4 8RNTA 4EBGA 1LXEA 3DZLA 3SXXA 3OW22 1B20A 4MJDA 5EVHA 2HOHA 1VQO3 5AIHA 5DREA 4AEQA 1G0TA 4N6UA 4MMXB 1IVXA 3EF8A 1FUSA 1LRAA 2HMOB
chains in the Genus database with same CATH topology
1LOVA 1BNSA 1BRGA 2F5MA 1I8VA 1DE3A 1YGWA 1B27A 5BU4A 1I3IA 3URPA 1A2PA 1RN1A 2AAEA 2F5WA 1T2HA 1TRPA 2KF6A 4RNTA 2AADA 3GSPA 1BRNL 1JBSA 4J5KA 1DETA 5GSPA 1RGFA 1BSEA 1ZGXA 1RGLA 1RGKA 2BIRA 3DGYA 3HOHA 1RNBA 7RNTA 1BRSA 3RNTA 1YVSA 2SARA 1BRJA 1UCIA 1GSPA 1R4YA 1RHLA 1BRIA 6GSPA 3AGNA 3D5GA 1B21A 1BNGA 1PY3A 1RMSA 1FW7A 1FYSA 1BU4A 1B2UA 1BANA 1CH0A 4BIRA 1RNTA 2C4BA 3WHOA 2KAAA 1GOUA 1GOYA 1UCLA 1RTUA 5HOHA 1SARA 1X1XA 1X1WA 3Q3FA 1RGAA 2KF5A 2KF4A 1Q9EA 1GMRA 5BIRA 2BU4A 1FUTA 1B2SA 1BNJA 1RGGA 6RNTA 1B2ZA 1UCKA 3WR2A 1AQZA 1LOWA 1BVIA 2KF3A 1JBTA 1I0XA 1RN4A 3A5EA 1BIRA 1B3SA 1JBRA 1TRQA 1FZUA 1BNRA 3D4AA 2F56A 1BRKA 3KCHA 1BSAA 1YNVX 2RBIA 3AHSA 1BNIA 1I3FA 1BRHA 1GOVA 1MGRA 1UCJA 1I2GA 1I2EA 1LOYA 1LNIA 1BGSA 4BU4A 4GHOA 1I0VA 1RGEA 3D5IA 4J5GA 1RLSA 1RSNA 1X1UA 4HAAA 1B2MA 1HYFA 1RCKA 2RNTA 1IYYA 1BSDA 1C54A 1PYLA 1TTOA 1X1YA 1B2XA 1MGWA 1BSCA 2F4YA 1AY7A 1BOXA 1RGHA 2ZA4A 1G02A 5RNTA 1I70A 3AHWA 4HOHA 3BU4A 1BNFA 1RGCA 1I2FA 1BSBA 7GSPA 3SYUA 1GMQA 2GSPA 1T2IA 3AGOA 9RNTA 3BIRA 3DH2A 1GMPA 1RDSA 1RCLA 1HZ1A 8RNTA 1B20A 1BAOA 2HOHA 1BUJA 1BNEA 4GSPA 1FUSA 1LRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOV A;  1BNS A;  1BRG A;  2F5M A;  1I8V A;  1DE3 A;  1YGW A;  1B27 A;  5BU4 A;  1I3I A;  3URP A;  1A2P A;  1RN1 A;  2AAE A;  2F5W A;  1T2H A;  1TRP A;  2KF6 A;  4RNT A;  2AAD A;  3GSP A;  1BRN L;  1JBS A;  4J5K A;  1DET A;  5GSP A;  1RGF A;  1BSE A;  1ZGX A;  1RGL A;  1RGK A;  2BIR A;  3DGY A;  3HOH A;  1RNB A;  7RNT A;  1BRS A;  3RNT A;  1YVS A;  2SAR A;  1BRJ A;  1UCI A;  1GSP A;  1R4Y A;  1RHL A;  1BRI A;  6GSP A;  3AGN A;  3D5G A;  1B21 A;  1BNG A;  1PY3 A;  1RMS A;  1FW7 A;  1FYS A;  1BU4 A;  1B2U A;  1BAN A;  1CH0 A;  4BIR A;  1RNT A;  2C4B A;  3WHO A;  2KAA A;  1GOU A;  1GOY A;  1UCL A;  1RTU A;  5HOH A;  1SAR A;  1X1X A;  1X1W A;  3Q3F A;  1RGA A;  2KF5 A;  2KF4 A;  1Q9E A;  1GMR A;  5BIR A;  2BU4 A;  1FUT A;  1B2S A;  1BNJ A;  1RGG A;  6RNT A;  1B2Z A;  1UCK A;  3WR2 A;  1AQZ A;  1LOW A;  1BVI A;  2KF3 A;  1JBT A;  1I0X A;  1RN4 A;  3A5E A;  1BIR A;  1B3S A;  1JBR A;  1TRQ A;  1FZU A;  1BNR A;  3D4A A;  2F56 A;  1BRK A;  3KCH A;  1BSA A;  1YNV X;  2RBI A;  3AHS A;  1BNI A;  1I3F A;  1BRH A;  1GOV A;  1MGR A;  1UCJ A;  1I2G A;  1I2E A;  1LOY A;  1LNI A;  1BGS A;  4BU4 A;  4GHO A;  1I0V A;  1RGE A;  3D5I A;  4J5G A;  1RLS A;  1RSN A;  1X1U A;  4HAA A;  1B2M A;  1HYF A;  1RCK A;  2RNT A;  1IYY A;  1BSD A;  1C54 A;  1PYL A;  1TTO A;  1X1Y A;  1B2X A;  1MGW A;  1BSC A;  2F4Y A;  1AY7 A;  1BOX A;  1RGH A;  2ZA4 A;  1G02 A;  5RNT A;  1I70 A;  3AHW A;  4HOH A;  3BU4 A;  1BNF A;  1RGC A;  1I2F A;  1BSB A;  7GSP A;  3SYU A;  1GMQ A;  2GSP A;  1T2I A;  3AGO A;  9RNT A;  3BIR A;  3DH2 A;  1GMP A;  1RDS A;  1RCL A;  1HZ1 A;  8RNT A;  1B20 A;  1BAO A;  2HOH A;  1BUJ A;  1BNE A;  4GSP A;  1FUS A;  1LRA A; 
#chains in the Genus database with same CATH topology
 2L4V A;  3LH4 A;  3F8H A;  3JUM A;  1FGO A;  1I3I A;  4XBT A;  2BNG A;  1A2P A;  1RN1 A;  3WOF B;  4G1M B;  2M7O A;  2AAD A;  3GSP A;  5M19 A;  1NB5 I;  1K73 4;  2O9U X;  3DMC A;  1DET A;  2WOF A;  2CW9 A;  2F99 A;  2Y74 A;  4N6M A;  2CWV A;  4NHF A;  4TX4 A;  1BSE A;  1EA2 A;  1ZGX A;  4RBN A;  3ZG5 A;  2MC8 A;  1QAK A;  1DVC A;  4L7K A;  3GZR A;  1VQ8 3;  1RNB A;  3NBJ A;  2RSX A;  3WA2 X;  3KSE D;  2SAR A;  4J9A A;  1SQW A;  2R4I A;  4EXR A;  3FH1 A;  1BRI A;  1YGE A;  4EW5 A;  6GSP A;  3GAX A;  1W6Y A;  1B21 A;  2O3O A;  3NQZ A;  4BTX A;  3NX0 A;  1YJ9 3;  1PY3 A;  1JKG A;  2GEX A;  2GBX B;  1FYS A;  3FF2 A;  2WOH A;  2CX0 A;  4FMA A;  4HZB B;  3X3X A;  3WHO A;  2OTL 3;  3S5C A;  1G96 A;  1MWT A;  2OQE A;  1OUN A;  1RTU A;  4FMB A;  4HKV B;  3Q2P A;  1MWR A;  3EQQ B;  3ZFZ A;  1QAF A;  4AKY A;  4KZ1 A;  5CF1 A;  2I9W A;  1DMQ A;  3GZB A;  3WDG B;  5EEO A;  1RGA A;  4K61 A;  1K28 A;  3CNX A;  3N9H A;  4I4K A;  4EYC A;  5ELU A;  3OX9 A;  2BU4 A;  1FUT A;  3JUN A;  1QAL A;  4STD A;  5G1K A;  3KII A;  2LQV A;  3WA3 A;  1AV4 A;  1MWU A;  3WR2 A;  4I5Q A;  1LOW A;  1W2B 2;  1BUQ A;  2H0G A;  3S29 A;  1NDO B;  1TP6 A;  3T8N A;  3LYG A;  3NBB A;  3FF0 A;  4IIA A;  3EBT A;  1AR0 A;  5IG3 A;  5M1A A;  1OCV A;  2HMK B;  1STF I;  3AHS A;  1JNQ A;  1Q7H A;  1YNV X;  1QMA A;  1TFK A;  2XGL A;  4LYL B;  4N6V 0;  1GOV A;  4ILF A;  2W9Q A;  3VF1 A;  1LNH A;  4KVH A;  4WFO A;  3B4O A;  5AEU B;  1CYU A;  4N6T A;  2RCD A;  3S67 A;  1I0V A;  1RGE A;  3T0U A;  1KD1 4;  3BNC A;  1RLS A;  1RSN A;  3MG3 A;  4J5G A;  1IVU A;  3N8B A;  3RGA A;  2YX9 A;  4OK0 A;  1MNL A;  3UNL A;  1TTO A;  1SPU A;  3NQY A;  2CWU A;  4XBX A;  2E2T A;  1BOX A;  1ZS7 A;  4CPK A;  3CCV 3;  3KZT A;  4CDL A;  2CC3 A;  4KFE A;  5STD A;  3AHW A;  1IV7 A;  1IU7 A;  1ZO2 A;  5AYR B;  5IF6 A;  3X3Z A;  1U8C B;  2W2C A;  3DXO A;  1NU3 A;  1BNF A;  1W6C A;  1WQL B;  2CIU A;  2P38 A;  3PCS A;  5ELJ A;  3TDG A;  1FGM A;  3MSO A;  1EG9 B;  3CCL 3;  3BIR A;  3B4P A;  2CFL A;  1E3V A;  3H51 A;  4X2H A;  3CC4 3;  2OQE C;  3UB1 A;  3D9R A;  4WWU C;  2L1S A;  1SJW A;  3EE1 A;  2D42 A;  1EUI C;  1U5O A;  3M8C A;  3G0K A;  1JN5 B;  3STD A;  1UI8 A;  1TUH A;  5IG0 A;  1UDI I;  3NBR A;  4R9L A;  5IEP A;  3FKA A;  3Q90 A;  2INX A;  3EN1 B;  3FCS B;  3IMA B;  3SLU A;  5I97 A;  1KQS 2;  8CHO A;  3J7Y d;  3CCM 3;  3X42 A;  4NPB A;  3OWY A;  1BRG A;  1FGR A;  2HML B;  1CYV A;  1W6G A;  2MF7 A;  1I8V A;  3MHE A;  3LTA A;  1YHQ 3;  3CC2 3;  2AAE A;  4EC6 A;  2RFR A;  1TRP A;  2KF6 A;  4RNT A;  1Q42 A;  2XFT A;  2FGT A;  4J5K A;  2V1L A;  2Z7A A;  4J8T A;  3ECF A;  2WO0 A;  2OWP A;  3F7X A;  3CMA 3;  4BL3 A;  4WYK A;  1TFO A;  1UI7 A;  1W2Z A;  1S72 3;  2YFI B;  1UGI A;  1M1K 4;  7RNT A;  4XB5 A;  1BRS A;  3ALA A;  1JZO A;  1UUG B;  3T8U A;  1IDP A;  3F7S A;  1SIH A;  1VQ9 3;  3GWR A;  1GSP A;  2PZV A;  2OOV C;  3U1W A;  2C10 A;  2GU3 A;  3K63 A;  3NXJ A;  5G1L A;  2P05 A;  3G71 3;  2E2V A;  3I0Y A;  5D81 A;  3DM8 A;  1JJ2 2;  3B8L A;  4XBY A;  3G8Z A;  4K1U A;  4R9K A;  1KC8 4;  1DYU A;  1RMS A;  1FW7 A;  2GEY A;  1BAN A;  3ER7 A;  2W04 A;  4HM5 B;  2BMO B;  2K0M A;  2C4B A;  1N9E A;  3B7C A;  2KAA A;  3JUO A;  3NV0 B;  1JKG B;  2UGI A;  1M90 4;  4MEI A;  2Z6B A;  3IJE B;  3X3Y A;  1TU5 A;  3LTD A;  4XDW A;  4O2H A;  2KF4 A;  3SOY A;  1V57 A;  1A2K A;  5AI1 A;  1SII A;  1PU4 A;  3WOE B;  6STD A;  1DMN A;  3FLJ A;  1RGG A;  3D79 A;  3DY5 A;  1B2Z A;  1IQX A;  3NUV A;  1LQG C;  4KFD A;  1VQN 3;  1UUV B;  4KFF A;  3KKG A;  1VQ5 3;  4HYZ A;  1JBR A;  1I0X A;  2K54 A;  4PEJ A;  1B3S A;  3PYJ A;  1FZU A;  3SVA A;  1BNR A;  3NV0 A;  2W56 A;  1Q82 4;  1O7W B;  2RBI A;  1FA3 A;  1I3F A;  2XFS A;  1OGX A;  3CCJ 3;  1MGR A;  2J8X B;  3MYT A;  1I2E A;  3OWS A;  3EHC A;  5AEW B;  4BU4 A;  3S27 A;  4HM0 B;  5CF2 A;  4ZM8 A;  1Q40 B;  3H3H A;  3KSP A;  1IK3 A;  3CXC 2;  1B2M A;  4HM2 B;  1RCK A;  4LGQ A;  3RDE A;  1Z1S A;  1BSD A;  3FG4 A;  1MGW A;  3JUQ A;  1BSC A;  1K41 A;  1RGH A;  5RNT A;  3LML A;  1IVW A;  1I70 A;  4RZM A;  5D82 A;  3G4S 3;  3BU4 A;  3PGB A;  2ZL8 A;  1QVF 2;  5CXO A;  3K5T A;  1BSB A;  3LOY A;  7GSP A;  1IT8 A;  2Z76 A;  5DRV A;  4HVN A;  1W02 A;  2C11 A;  1T2I A;  4R1K A;  5CLK A;  1IQ8 A;  4N6N B;  4OUQ A;  1HKX A;  3KE7 A;  1LQM B;  1JRQ A;  3HX8 A;  1Q40 A;  4EV5 A;  1IVV A;  2JQ5 A;  1GMP A;  1RDS A;  1VZZ A;  3EX9 A;  4BL2 A;  3GZY B;  4FMC A;  1KSI A;  2OOV A;  1KWI A;  1W5Z A;  1E97 A;  1Y4K A;  2P09 A;  1YI2 3;  1BUJ A;  1N5P A;  1VQP 3;  1FGQ A;  2A15 A;  3F14 A;  2IUK A;  3DGM A;  4HM8 B;  4QWT A;  1BNE A;  1A67 A;  4Q53 A;  1WNH A;  1TIJ A;  4GSP A;  4LMI A;  5JBS A;  1D6U A;  1N8Q A;  2W0Q A;  3A76 A;  1BNS A;  2KCD A;  3BND A;  3EC9 A;  1ULI B;  2K3D A;  4WHA A;  4NRE A;  1OHO A;  1R4C A;  1B27 A;  3KFQ C;  4XM4 A;  5BU4 A;  5KP4 A;  3MG1 A;  3URP A;  3HK4 A;  2UX0 A;  2CX1 A;  2F5W A;  3D3L A;  3DGL A;  1VQK 3;  2QGU A;  1VQQ A;  1BRN L;  3PCR A;  1JBS A;  2H0H A;  1GS3 A;  4HJL B;  2E2U A;  3MG2 A;  2GXF A;  1ROV A;  3CPW 2;  4GL6 A;  4OVM A;  2BMQ B;  2D1W A;  4U13 A;  4RNY A;  1RGL A;  4N6O B;  1GD4 A;  1YVB I;  2F86 B;  4R80 A;  1J2B A;  3FSD A;  2HMJ B;  4WYK B;  1STD A;  3L0R A;  5EQL A;  1OHS A;  3RNT A;  1YJW 3;  1C7H A;  1MWS A;  1NWW A;  1GY6 A;  2UUG C;  1BRJ A;  3JVC A;  5A0O B;  3K0Z A;  1UCI A;  2QIY A;  1VQ7 3;  1R4Y A;  1RHL A;  1OGZ A;  3AGN A;  3EN8 A;  1BNG A;  2ML5 A;  4CCV A;  2CFK A;  2IMJ A;  1O7P B;  1BU4 A;  1B2U A;  1CH0 A;  2Z77 A;  2ML6 A;  5IEO A;  4BIR A;  2BHM A;  3LTC A;  3RGR A;  1EKM A;  3SX1 A;  1VQM 3;  1UCL A;  3WOD G;  1O7M B;  3FG1 A;  2CG1 A;  1WTH A;  5JPP A;  1N5H A;  3CCS 3;  3V92 A;  3MPH A;  2F98 A;  3VSY A;  4CJN A;  2KF5 A;  4N3V A;  1GYB A;  1WMP A;  3CU3 A;  4ORL A;  3S28 A;  1V58 A;  2OTJ 3;  1JZD A;  1GY5 A;  2CG0 A;  3JUP A;  3OWU A;  2KXG A;  2ZHX B;  3A5E A;  2H0I A;  3X40 A;  3I56 3;  1JB5 A;  1TRQ A;  1OAC A;  4BTY A;  2Q07 A;  3D4A A;  3I55 3;  2F56 A;  1DVD A;  5IER A;  1ASK A;  1M1X B;  1VQ6 3;  2R41 A;  3CPO A;  1BNI A;  4FMD A;  3FZW A;  5FW5 A;  1OF5 A;  1BRH A;  3AMO B;  1UCJ A;  4LEH A;  1I2G A;  1T5Y A;  2KRT A;  1CQS A;  1FGT A;  1LNI A;  1LOY A;  1O7G B;  1UUW B;  2W56 B;  3HI7 A;  2XSO B;  2YFL B;  4GHO A;  1Q81 4;  1F8N A;  1HU9 A;  3D5I A;  3HII A;  1LOX A;  5D83 A;  1EEJ A;  2XSH B;  4HAA A;  3CME 3;  1CEW I;  2W6J H;  3G6E 3;  4GB5 A;  3VGN A;  2RNT A;  1IYY A;  1M9G A;  4HM7 B;  1X1Y A;  3LXU X;  5AIF A;  3EJV A;  2JDI H;  3SOA A;  3CNM A;  2F4Y A;  3FG3 A;  3OXA A;  5FGO A;  1YIT 3;  3DUK A;  3MKI A;  1A90 A;  4RNZ A;  1GY7 A;  2IYJ A;  3NHX A;  3UL5 A;  2PNC A;  3V98 A;  5M18 A;  3AMO A;  5G2G A;  2QA4 3;  2P0M A;  2GBW B;  1IT7 A;  2LYX A;  2SBL A;  3G16 A;  2QEX 3;  1RGC A;  1I2F A;  3HZP A;  1OHP A;  3SYU A;  1GMQ A;  5JPU A;  1NJI 4;  3CC7 3;  5AIG A;  1QVG 2;  1TJD A;  3AGO A;  9RNT A;  2BT3 A;  4L8P A;  3EB8 A;  3DH2 A;  4KT3 B;  2W03 A;  2XH9 A;  4EV2 A;  5IEN A;  3CCE 3;  2FXT A;  1ULJ B;  1NO3 A;  1RCL A;  1HZ1 A;  3HIG A;  3CCU 3;  2FNQ A;  4O8S A;  1D6Y A;  1BAO A;  4WP5 A;  1NNV A;  1ISK A;  2GU1 A;  3LT8 A;  1S5A A;  1US1 A;  4HM6 B;  3E99 A;  1AVL A;  1L5G B;  1T3B A;  1LOV A;  2F5M A;  2IY2 A;  1DE3 A;  1YGW A;  5CK6 A;  1ROA A;  3UJM A;  2CFD A;  1W01 A;  2BMR B;  2XEP A;  4FCM A;  1T2H A;  3GZX B;  1IV9 A;  3F40 A;  2P0X A;  4JRF A;  3BNE A;  3LZA A;  1QJG A;  2IUJ A;  5GSP A;  1IQY A;  1RGF A;  1RGK A;  5TGN A;  4L8O A;  2BIR A;  3BB9 A;  1YJN 3;  3DGY A;  1AVK A;  3HOH A;  2CKF B;  5AII A;  3U97 A;  3K7C A;  2XR8 B;  5LC7 A;  1W7C A;  3QRD A;  1RN7 A;  1YVS A;  1VQ4 3;  1RRH A;  1Q86 4;  7STD A;  5IW9 A;  5IG4 A;  5LC6 A;  3K9M C;  2ZDJ A;  5HGR A;  3F9S A;  3D5G A;  1K8A 4;  1WMO A;  3NM7 A;  3ZG0 A;  1RNT A;  3Q1C A;  1O7N B;  4K90 B;  4BTW A;  3V99 A;  4O3V A;  1GOU A;  4AKZ A;  1GOY A;  2BO9 B;  4FCZ A;  4HM3 B;  3ROB A;  3QK9 A;  5HOH A;  1SAR A;  2IA7 A;  5IG5 A;  1X1X A;  1X1W A;  4IPB A;  3Q3F A;  2CHC A;  3PS8 A;  1E3R A;  3BNB A;  4LSO A;  1Q9E A;  1GMR A;  5BIR A;  2W9P A;  3LTB A;  4JF8 A;  1W00 A;  3IPT A;  1V74 A;  4FR9 A;  3OV4 A;  4H61 A;  5KP3 A;  1B2S A;  1BNJ A;  6RNT A;  1UCK A;  1AQZ A;  1BVI A;  2Y73 A;  3PXM A;  2KF3 A;  3X41 A;  1K9M 4;  1RN4 A;  4O02 B;  1BIR A;  1OPY A;  2B1X B;  4IT7 A;  1JBT A;  4HBR A;  2XGN A;  4X2O A;  1EQK A;  1NB3 I;  1BRK A;  2STD A;  1UW1 A;  1ZX2 A;  3KCH A;  1RJO A;  3N54 B;  1BSA A;  3UL6 A;  1MOL A;  4HM4 B;  2CFG A;  5KP1 A;  2WGO A;  3NM2 A;  1JB4 A;  1BGS A;  1UGH I;  1D6Z A;  2XRX B;  1OF5 B;  2RGQ A;  3PZW A;  4HZ9 B;  4DKI A;  4K1V A;  5BVB A;  3DGO A;  1VQL 3;  3GRD A;  1JV2 B;  1X1U A;  3F8X A;  3EBY A;  2B24 B;  1HYF A;  1RKY A;  3CCQ 3;  4XDV A;  5BXQ A;  1C54 A;  1PYL A;  1B2X A;  1O7H B;  4HM1 B;  1DMM A;  1LVN A;  1AY7 A;  2ZA4 A;  2XF3 A;  1A2V A;  1G02 A;  3BLZ A;  3FGY A;  4MMZ B;  2WGQ A;  3WMD A;  3LT9 A;  3KN4 A;  1WMN A;  2YFJ B;  1RRL A;  4HOH A;  4H3U A;  1FUW A;  1N8R 4;  3CD6 3;  5AYS C;  3DGN A;  4N6L A;  2GSP A;  3SED A;  4FCJ A;  2CH9 A;  3CCR 3;  3MWZ A;  3O8Y A;  2CK3 H;  2CFW A;  1OH0 A;  1N9J A;  4MMY B;  2CWT A;  1JB2 A;  2HMN B;  2HMM B;  1GD3 A;  1PFP A;  1W4N A;  4R4K A;  2OCT A;  1YIJ 3;  4LZI A;  1JN5 A;  1Q7Y 4;  8RNT A;  4EBG A;  1LXE A;  3DZL A;  3SXX A;  3OW2 2;  1B20 A;  4MJD A;  5EVH A;  2HOH A;  1VQO 3;  5AIH A;  5DRE A;  4AEQ A;  1G0T A;  4N6U A;  4MMX B;  1IVX A;  3EF8 A;  1FUS A;  1LRA A;  2HMO B; 
#chains in the Genus database with same CATH homology
 1LOV A;  1BNS A;  1BRG A;  2F5M A;  1I8V A;  1DE3 A;  1YGW A;  1B27 A;  5BU4 A;  1I3I A;  3URP A;  1A2P A;  1RN1 A;  2AAE A;  2F5W A;  1T2H A;  1TRP A;  2KF6 A;  4RNT A;  2AAD A;  3GSP A;  1BRN L;  1JBS A;  4J5K A;  1DET A;  5GSP A;  1RGF A;  1BSE A;  1ZGX A;  1RGL A;  1RGK A;  2BIR A;  3DGY A;  3HOH A;  1RNB A;  7RNT A;  1BRS A;  3RNT A;  1YVS A;  2SAR A;  1BRJ A;  1UCI A;  1GSP A;  1R4Y A;  1RHL A;  1BRI A;  6GSP A;  3AGN A;  3D5G A;  1B21 A;  1BNG A;  1PY3 A;  1RMS A;  1FW7 A;  1FYS A;  1BU4 A;  1B2U A;  1BAN A;  1CH0 A;  4BIR A;  1RNT A;  2C4B A;  3WHO A;  2KAA A;  1GOU A;  1GOY A;  1UCL A;  1RTU A;  5HOH A;  1SAR A;  1X1X A;  1X1W A;  3Q3F A;  1RGA A;  2KF5 A;  2KF4 A;  1Q9E A;  1GMR A;  5BIR A;  2BU4 A;  1FUT A;  1B2S A;  1BNJ A;  1RGG A;  6RNT A;  1B2Z A;  1UCK A;  3WR2 A;  1AQZ A;  1LOW A;  1BVI A;  2KF3 A;  1JBT A;  1I0X A;  1RN4 A;  3A5E A;  1BIR A;  1B3S A;  1JBR A;  1TRQ A;  1FZU A;  1BNR A;  3D4A A;  2F56 A;  1BRK A;  3KCH A;  1BSA A;  1YNV X;  2RBI A;  3AHS A;  1BNI A;  1I3F A;  1BRH A;  1GOV A;  1MGR A;  1UCJ A;  1I2G A;  1I2E A;  1LOY A;  1LNI A;  1BGS A;  4BU4 A;  4GHO A;  1I0V A;  1RGE A;  3D5I A;  4J5G A;  1RLS A;  1RSN A;  1X1U A;  4HAA A;  1B2M A;  1HYF A;  1RCK A;  2RNT A;  1IYY A;  1BSD A;  1C54 A;  1PYL A;  1TTO A;  1X1Y A;  1B2X A;  1MGW A;  1BSC A;  2F4Y A;  1AY7 A;  1BOX A;  1RGH A;  2ZA4 A;  1G02 A;  5RNT A;  1I70 A;  3AHW A;  4HOH A;  3BU4 A;  1BNF A;  1RGC A;  1I2F A;  1BSB A;  7GSP A;  3SYU A;  1GMQ A;  2GSP A;  1T2I A;  3AGO A;  9RNT A;  3BIR A;  3DH2 A;  1GMP A;  1RDS A;  1RCL A;  1HZ1 A;  8RNT A;  1B20 A;  1BAO A;  2HOH A;  1BUJ A;  1BNE A;  4GSP A;  1FUS A;  1LRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...