4GHOA

Crystal structure analysis of streptomyces aureofaciens ribonuclease s24a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIAADGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Contribution of hydrogen bonds to protein stability
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4ghoA00
1I0XA 1RMSA 3DGYA 1UCLA 1BRHA 1TRPA 1GMPA 3AGOA 1TRQA 2AADA 1RGFA 1T2HA 2GSPA 2AAEA 1BRNL 1I3FA 1I70A 1BNIA 1UCKA 1X1WA 3D4AA 1GMRA 1RGLA 4J5KA 1RNBA 1R4YA 1JBRA 9RNTA 1I8VA 3WR2A 1FUTA 5GSPA 1I0VA 5HOHA 1B2ZA 1BVIA 1GOVA 6GSPA 1B20A 2F4YA 1PYLA 6RNTA 2KF4A 1LOWA 1Q9EA 1BRKA 4HAAA 2KAAA 1GMQA 2KF6A 1BRJA 1JBTA 1GOUA 1LNIA 1HYFA 1I2FA 1BOXA 1BGSA 1RLSA 1RHLA 5BU4A 1C54A 1HZ1A 3GSPA 1PY3A 3RNTA 1RNTA 2F5MA 1BNFA 1GSPA 1DETA 1RSNA 3BU4A 1I2GA 1B21A 3WHOA 4BU4A 8RNTA 5RNTA 1X1YA 1I2EA 1BNRA 2ZA4A 2SARA 3DH2A 1FZUA 2BU4A 1BNSA 2HOHA 1RGCA 1FUSA 1UCJA 1B2XA 1BSDA 1SARA 1BNGA 1RTUA 1T2IA 7GSPA 3AGNA 1RN4A 1UCIA 1I3IA 1B2SA 1LOYA 1YVSA 1RN1A 1BUJA 2BIRA 4RNTA 1RGHA 1AQZA 4HOHA 1B2MA 3HOHA 1YGWA 1B27A 1YNVX 1LRAA 4BIRA 4GSPA 2C4BA 1X1XA 2KF5A 1CH0A 1AY7A 7RNTA 1GOYA 2KF3A 1RGGA 1RGEA 1RCKA 1B3SA 1BNEA 1BSAA 3A5EA 1X1UA 3KCHA 3D5GA 3URPA 2RNTA 1B2UA 1BRIA 1MGWA 1BIRA 1JBSA 1BRGA 3D5IA 3BIRA 1LOVA 1RDSA 1BAOA 1FW7A 1RCLA 1BRSA 1DE3A 1BSCA 2F5WA 5BIRA 1RGAA 3SYUA 1A2PA 1TTOA 1BSEA 3Q3FA 1MGRA 4GHOA 2F56A 1BANA 1BSBA 1FYSA 3AHWA 1BU4A 3AHSA 1RGKA 1BNJA 1G02A 2RBIA 1ZGXA 1IYYA 4J5GA
chains in the Genus database with same CATH superfamily
1OF5B 1RMSA 3D3LA 3DGYA 1GS3A 3FKAA 5IEOA 2ZL8A 1EQKA 1DMNA 4HM0B 1RGFA 2W2CA 3DXOA 1CYVA 1BNIA 1U5OA 4CCVA 5IG5A 2CG0A 1KQS2 1UCKA 1JBRA 1R4YA 1HU9A 3WR2A 2WOFA 2WGOA 3B7CA 3JUOA 3NBRA 4XDVA 2SBLA 1VQN3 5IG0A 5HOHA 2XFSA 2XF3A 1TUHA 1SIHA 3CPOA 2WO0A 5EEOA 1IT8A 3T0UA 4CDLA 1B20A 1STDA 3VF1A 1TP6A 3S27A 4EYCA 2GU1A 1VQ93 4LZIA 3S67A 1K41A 5D81A 5DREA 2XGLA 1LOWA 1Q9EA 1BRKA 4PEJA 2KAAA 3DZLA 3VGNA 4OUQA 2C11A 4L8OA 1JBTA 2OWPA 1VQ53 4IPBA 4JRFA 1RRLA 1IU7A 1QJGA 3EX9A 3OWUA 5D82A 1YIJ3 1UUGB 1VQK3 2UUGC 2F86B 1YI23 1HZ1A 2F99A 3GSPA 3OX9A 5M18A 1PY3A 2P0XA 2LYXA 2W03A 1V74A 6STDA 1Q40A 2HMLB 4WYKA 1DETA 1RSNA 5M19A 4I4KA 8RNTA 3NBBA 1I2EA 3Q90A 2ML6A 4R9KA 1JKGB 2SARA 2XH9A 2E2TA 2YX9A 2E2UA 3FF0A 4EBGA 3G713 2QIYA 3T8UA 1UCJA 2OOVC 1BSDA 3DMCA 3UJMA 3S5CA 1RTUA 1T2IA 3CNXA 3FG1A 3V99A 1G96A 1UCIA 3E99A 3LYGA 3MKIA 3PYJA 1FGQA 1OCVA 3SXXA 4AEQA 4BL3A 1B2SA 1GY6A 1K734 3H3HA 3G0KA 3BLZA 1NNVA 2CWVA 1RN1A 2BMOB 1MNLA 4L7KA 2W6JH 3NXJA 3CCV3 1CQSA 1UGIA 3MPHA 4J9AA 2R41A 1YGWA 1B27A 1HKXA 2B1XB 1QALA 1RRHA 2C10A 2H0HA 2KCDA 1ROVA 2KXGA 3HZPA 3DUKA 4GSPA 2C4BA 3B4OA 4EXRA 3F8HA 5M1AA 4HJLB 3TDGA 4XDWA 4N6OB 1R4CA 1JNQA 2YFIB 3F40A 4CJNA 4FCJA 1UW1A 3NUVA 1BNEA 1IVXA 3OXAA 2H0IA 4FMDA 4H3UA 3A5EA 4HYZA 4ORLA 4HZBB 1CEWI 1S5AA 2WGQA 3D5GA 1ASKA 5FW5A 1B2UA 1N8QA 2B24B 2L1SA 3X41A 1JV2B 1L5GB 1T3BA 4XM4A 1BAOA 1IT7A 2MF7A 1OF5A 4LMIA 2YFJB 4WYKB 1FW7A 4N6UA 3ZFZA 2F5WA 2XR8B 1RGAA 2Y74A 2UX0A 4IT7A 2F98A 1FGMA 1JB4A 3CPW2 4OK0A 1BSEA 1ROAA 3PXMA 1FGRA 4GHOA 3ALAA 3OV4A 4X2OA 4O2HA 5I97A 1O7PB 1W01A 2W56B 4HM2B 4KFEA 2W04A 1YJW3 2GEYA 4H61A 3I553 1IQXA 1T5YA 1IDPA 3JUPA 4N6MA 1K9M4 4HM3B 1IYYA 3DGMA 3DGLA 4LYLB 5IG3A 1TJDA 1UCLA 1BRHA 1AV4A 3KSED 3CCM3 3CCS3 2AADA 1T2HA 4FMBA 1I3FA 1I70A 3DGNA 3FCSB 1FA3A 3D4AA 3ECFA 1GMRA 1RGLA 2MC8A 1DVDA 1FGOA 1UDII 1I8VA 2CFWA 1WMPA 3GZXB 4LSOA 4RNYA 3S28A 2BHMA 5AIHA 1J2BA 3WA3A 3M8CA 1I0VA 3CCL3 3CNMA 3DY5A 3NV0B 2CFLA 2W0QA 1IVWA 1BVIA 2D42A 6GSPA 1VQP3 4GB5A 1VQ73 4I5QA 2STDA 1W6YA 4K1VA 1E3RA 2BMRB 2QGUA 3KE7A 4NHFA 2KF4A 3KSPA 1W6GA 3ER7A 3WODG 3G6E3 2XGNA 1YJ93 1W6CA 1O7WB 3BNDA 4BTXA 1JKGA 1GY7A 4HM8B 1OHOA 1MWSA 2RSXA 4FCMA 4HZ9B 4QWTA 2KF6A 1A67A 4AKZA 1GOUA 2R4IA 4BTWA 1HYFA 1KWIA 1W5ZA 4O3VA 1RHLA 5BU4A 3UL6A 3ZG0A 2IUKA 3JUNA 2IYJA 3HIIA 4MMXB 3CC23 4WWUC 5G1KA 1Q42A 1EG9B 4XBTA 1E97A 1I2GA 1B21A 3LTCA 3RGAA 3WHOA 3KIIA 1JB5A 4EW5A 4ILFA 4KFDA 5RNTA 4JF8A 1TFKA 2ZA4A 1TU5A 1LXEA 2IY2A 1FUSA 3MG2A 3CMA3 2PNCA 4MJDA 7GSPA 3AGNA 1RN4A 2M7OA 5AIGA 1I3IA 3K0ZA 4R4KA 2IA7A 3SEDA 4N6V0 3ZG5A 3QK9A 1YVSA 5TGNA 7STDA 1BUJA 2BIRA 4LGQA 1AQZA 3PCSA 1V57A 2HMJB 2GXFA 1B2MA 3HOHA 3B8LA 3HIGA 2QA43 3PZWA 1UI8A 1UGHI 3BB9A 2O9UX 4BIRA 1M9GA 2CWUA 1O7MB 2H0GA 3EBTA 5EVHA 3U97A 5CF2A 1JJ22 1VQ83 1VQ63 1WTHA 4HM5B 4HVNA 1OPYA 1AR0A 1C7HA 3I0YA 1N5HA 1Q7Y4 1B3SA 4GL6A 1E3VA 1ZO2A 4FMAA 4NPBA 3CCQ3 3F7XA 1ULIB 3NX0A 4K90B 5CLKA 2LQVA 4DKIA 3A76A 1X1UA 1DMQA 2CW9A 3CME3 2W56A 1RJOA 2RNTA 2J8XB 1CYUA 2K0MA 1BIRA 1SJWA 1WMNA 3GRDA 3K9MC 2HMNB 4HM7B 3X3ZA 1YGEA 2CFDA 1N5PA 4FR9A 1JZOA 1BRSA 1ZS7A 1LNHA 2IMJA 1DE3A 1KSIA 2KRTA 3CCR3 3SYUA 3EQQB 2OOVA 3PGBA 3F8XA 4IIAA 3X3YA 3RGRA 2D1WA 3UL5A 5IEPA 2UGIA 3EN8A 5IW9A 3Q3FA 5FGOA 3X42A 4ZM8A 2XSOB 3FGYA 4HM1B 1BANA 3JUQA 1GD4A 3O8YA 3AHSA 3EC9A 1RGKA 5IG4A 2RGQA 1BNJA 1G02A 2FXTA 4K61A 2PZVA 3EBYA 3NV0A 5CK6A 3MG3A 3L0RA 4RNZA 4J5GA 4RNTA 4CPKA 3EHCA 3K7CA 3BNEA 1TRPA 2A15A 2W9QA 3AGOA 1YIT3 3SOYA 1A2KA 1UUVB 3OW22 2GSPA 2AAEA 1EUIC 3MYTA 2BMQB 3NM2A 4EV2A 5BVBA 4R1KA 1SPUA 3HX8A 2CFKA 1VQM3 5IENA 1FUTA 5GSPA 2CHCA 3IJEB 4HM4B 4N6LA 3LTAA 3GZYB 3U1WA 1B2ZA 1GOVA 1OACA 1PU4A 1IQ8A 3HI7A 5G1LA 2Q07A 5JPUA 3LT9A 1KC84 4OVMA 2GU3A 1OGXA 1Q824 3G16A 3KKGA 3AMOB 2JDIH 3JVCA 3DGOA 5JPPA 3CCU3 1EA2A 2P0MA 3EN1B 5BXQA 2ZDJA 4XBXA 1BRJA 3WDGB 1S723 3MSOA 1LNIA 1I2FA 1BOXA 1BGSA 2GEXA 4O8SA 4R9LA 1MWUA 3NBJA 1C54A 3FLJA 1JB2A 3EB8A 5KP3A 3Q1CA 1NO3A 1ISKA 1BNFA 3FZWA 1JN5B 4WP5A 5AI1A 3BU4A 1BUQA 1YVBI 5AEWB 4BU4A 1ULJB 3NHXA 1X1YA 4WFOA 3DH2A 2OQEC 5LC6A 3WMDA 1MOLA 2HOHA 5EQLA 1W2ZA 1IVUA 3Q2PA 1SARA 5D83A 3LTDA 4X2HA 3OWYA 4U13A 2OTL3 1LOYA 2CFGA 2XFTA 5CXOA 1YHQ3 1N9EA 3GAXA 4L8PA 4XBYA 5HGRA 1QAFA 2CKFB 5A0OB 4HOHA 4KT3B 1STFI 2OQEA 2JQ5A 4Q53A 1DMMA 4KFFA 1D6ZA 1YNVX 3CU3A 5DRVA 2OTJ3 1FUWA 1W7CA 2KF5A 4KZ1A 1NB3I 5AYRB 2CG1A 3MG1A 1CH0A 2ZHXB 3JUMA 1M1XB 2P38A 1OUNA 2KF3A 1ZX2A 2BT3A 2CIUA 3N8BA 1M1K4 3RDEA 1QVF2 2IUJA 1PFPA 2Z6BA 3FG3A 4XB5A 3FG4A 1NU3A 5AEUB 1W4NA 4R80A 3UB1A 5G2GA 1TFOA 1MGWA 1BRGA 3D5IA 3BIRA 3K5TA 3LH4A 4MEIA 2BNGA 1RDSA 3LT8A 3EF8A 1IVVA 1RN7A 1NB5I 1EKMA 1BSCA 4TX4A 1NJI4 1SQWA 2RCDA 3LMLA 3PCRA 1RKYA 1A2PA 1TTOA 3F9SA 1W2B2 1NDOB 2P05A 3PS8A 3SVAA 5AIIA 1BSBA 1FYSA 1JZDA 1O7HB 2BO9B 1BU4A 1IV9A 3SX1A 2GBXB 5IF6A 3J7Yd 2RBIA 4NREA 3V92A 1A2VA 2INXA 1UI7A 3EJVA 3F14A 5LC7A 1Z1SA 3H51A 5KP4A 1I0XA 3N54B 4FMCA 4BTYA 3K63A 1GMPA 1NWWA 2W9PA 2YFLB 1DVCA 1TRQA 3AMOA 3STDA 1WNHA 2Y73A 1BRNL 5STDA 3CXC2 1RNBA 1X1WA 4J5KA 1IK3A 9RNTA 2HMMB 3HK4A 3GWRA 1K8A4 1VQL3 3LZAA 3NQZA 4K1UA 1Y4KA 2E2VA 2I9WA 3BNCA 3I563 1Q864 2WOHA 3G4S3 4RBNA 2HMKB 3X40A 1QMAA 2F4YA 1PYLA 1JN5A 1D6UA 3F7SA 6RNTA 1AVKA 2CH9A 1K28A 4N6NB 1VQO3 4HAAA 1OGZA 1US1A 1GMQA 3MWZA 5ELJA 2FGTA 3MHEA 1F8NA 2QEX3 1IV7A 1V58A 3BNBA 1O7GB 2Z7AA 3GZRA 1RLSA 2CC3A 3GZBA 2K54A 4HBRA 1QVG2 3CD63 1OHSA 1DYUA 1W02A 8CHOA 2CX0A 1QAKA 5CF1A 3RNTA 2P09A 4HKVB 1RNTA 2F5MA 3EE1A 4KVHA 1GSPA 5IERA 2HMOB 1VZZA 1BNRA 1AVLA 1JRQA 1FZUA 3N9HA 2BU4A 1BNSA 3IMAB 1RGCA 4EC6A 1OHPA 1B2XA 2Z77A 3NM7A 4MMYB 1BNGA 4O02B 3G8ZA 2ML5A 3SLUA 1LOXA 1IQYA 1G0TA 2XEPA 3KFQC 1FGTA 1MWTA 3OWSA 3NQYA 4EV5A 4AKYA 1Q40B 3QRDA 1RGHA 3D79A 1OH0A 4MMZB 1Q7HA 2V1LA 1D6YA 1LRAA 4J8TA 3CC43 3S29A 1X1XA 2CX1A 2CK3H 4LEHA 4N6TA 3V98A 3FSDA 1AY7A 1N9JA 2O3OA 2Z76A 5AIFA 7RNTA 1GOYA 1RGGA 1RGEA 3UNLA 1RCKA 1GYBA 3LOYA 3URPA 3B4PA 1UUWB 3DM8A 1BSAA 3FH1A 2FNQA 4BL2A 1YJN3 4STDA 3VSYA 3KCHA 1LQGC 1MWRA 1TIJA 1U8CB 2CWTA 1W00A 1BRIA 1VQQA 1EEJA 1WQLB 3D9RA 2OCTA 3KZTA 1VQ43 1JBSA 5AYSC 2GBWB 1LOVA 1LQMB 1SIIA 3IPTA 2XRXB 3WOFB 1RCLA 5JBSA 3CC73 1LVNA 3X3XA 2RFRA 5BIRA 3CCE3 5KP1A 3ROBA 2XSHB 3LTBA 3KN4A 4RZMA 1O7NB 1KD14 1Q814 1MGRA 4WHAA 3WOEB 2F56A 1A90A 4HM6B 3AHWA 4FCZA 3CCJ3 1M904 1GY5A 1WMOA 3FF2A 3LXUX 1GD3A 4N3VA 2K3DA 4G1MB 1ZGXA 2L4VA 3T8NA 3WA2X 3SOAA 1N8R4 5ELUA
chains in the Genus database with same CATH topology
1I0XA 1RMSA 3DGYA 1UCLA 1BRHA 1TRPA 1GMPA 3AGOA 1TRQA 2AADA 1RGFA 1T2HA 2GSPA 2AAEA 1BRNL 1I3FA 1I70A 1BNIA 1UCKA 1X1WA 3D4AA 1GMRA 1RGLA 4J5KA 1RNBA 1R4YA 1JBRA 9RNTA 1I8VA 3WR2A 1FUTA 5GSPA 1I0VA 5HOHA 1B2ZA 1BVIA 1GOVA 6GSPA 1B20A 2F4YA 1PYLA 6RNTA 2KF4A 1LOWA 1Q9EA 1BRKA 4HAAA 2KAAA 1GMQA 2KF6A 1BRJA 1JBTA 1GOUA 1LNIA 1HYFA 1I2FA 1BOXA 1BGSA 1RLSA 1RHLA 5BU4A 1C54A 1HZ1A 3GSPA 1PY3A 3RNTA 1RNTA 2F5MA 1BNFA 1GSPA 1DETA 1RSNA 3BU4A 1I2GA 1B21A 3WHOA 4BU4A 8RNTA 5RNTA 1X1YA 1I2EA 1BNRA 2ZA4A 2SARA 3DH2A 1FZUA 2BU4A 1BNSA 2HOHA 1RGCA 1FUSA 1UCJA 1B2XA 1BSDA 1SARA 1BNGA 1RTUA 1T2IA 7GSPA 3AGNA 1RN4A 1UCIA 1I3IA 1B2SA 1LOYA 1YVSA 1RN1A 1BUJA 2BIRA 4RNTA 1RGHA 1AQZA 4HOHA 1B2MA 3HOHA 1YGWA 1B27A 1YNVX 1LRAA 4BIRA 4GSPA 2C4BA 1X1XA 2KF5A 1CH0A 1AY7A 7RNTA 1GOYA 2KF3A 1RGGA 1RGEA 1RCKA 1B3SA 1BNEA 1BSAA 3A5EA 1X1UA 3KCHA 3D5GA 3URPA 2RNTA 1B2UA 1BRIA 1MGWA 1BIRA 1JBSA 1BRGA 3D5IA 3BIRA 1LOVA 1RDSA 1BAOA 1FW7A 1RCLA 1BRSA 1DE3A 1BSCA 2F5WA 5BIRA 1RGAA 3SYUA 1A2PA 1TTOA 1BSEA 3Q3FA 1MGRA 4GHOA 2F56A 1BANA 1BSBA 1FYSA 3AHWA 1BU4A 3AHSA 1RGKA 1BNJA 1G02A 2RBIA 1ZGXA 1IYYA 4J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0X A;  1RMS A;  3DGY A;  1UCL A;  1BRH A;  1TRP A;  1GMP A;  3AGO A;  1TRQ A;  2AAD A;  1RGF A;  1T2H A;  2GSP A;  2AAE A;  1BRN L;  1I3F A;  1I70 A;  1BNI A;  1UCK A;  1X1W A;  3D4A A;  1GMR A;  1RGL A;  4J5K A;  1RNB A;  1R4Y A;  1JBR A;  9RNT A;  1I8V A;  3WR2 A;  1FUT A;  5GSP A;  1I0V A;  5HOH A;  1B2Z A;  1BVI A;  1GOV A;  6GSP A;  1B20 A;  2F4Y A;  1PYL A;  6RNT A;  2KF4 A;  1LOW A;  1Q9E A;  1BRK A;  4HAA A;  2KAA A;  1GMQ A;  2KF6 A;  1BRJ A;  1JBT A;  1GOU A;  1LNI A;  1HYF A;  1I2F A;  1BOX A;  1BGS A;  1RLS A;  1RHL A;  5BU4 A;  1C54 A;  1HZ1 A;  3GSP A;  1PY3 A;  3RNT A;  1RNT A;  2F5M A;  1BNF A;  1GSP A;  1DET A;  1RSN A;  3BU4 A;  1I2G A;  1B21 A;  3WHO A;  4BU4 A;  8RNT A;  5RNT A;  1X1Y A;  1I2E A;  1BNR A;  2ZA4 A;  2SAR A;  3DH2 A;  1FZU A;  2BU4 A;  1BNS A;  2HOH A;  1RGC A;  1FUS A;  1UCJ A;  1B2X A;  1BSD A;  1SAR A;  1BNG A;  1RTU A;  1T2I A;  7GSP A;  3AGN A;  1RN4 A;  1UCI A;  1I3I A;  1B2S A;  1LOY A;  1YVS A;  1RN1 A;  1BUJ A;  2BIR A;  4RNT A;  1RGH A;  1AQZ A;  4HOH A;  1B2M A;  3HOH A;  1YGW A;  1B27 A;  1YNV X;  1LRA A;  4BIR A;  4GSP A;  2C4B A;  1X1X A;  2KF5 A;  1CH0 A;  1AY7 A;  7RNT A;  1GOY A;  2KF3 A;  1RGG A;  1RGE A;  1RCK A;  1B3S A;  1BNE A;  1BSA A;  3A5E A;  1X1U A;  3KCH A;  3D5G A;  3URP A;  2RNT A;  1B2U A;  1BRI A;  1MGW A;  1BIR A;  1JBS A;  1BRG A;  3D5I A;  3BIR A;  1LOV A;  1RDS A;  1BAO A;  1FW7 A;  1RCL A;  1BRS A;  1DE3 A;  1BSC A;  2F5W A;  5BIR A;  1RGA A;  3SYU A;  1A2P A;  1TTO A;  1BSE A;  3Q3F A;  1MGR A;  4GHO A;  2F56 A;  1BAN A;  1BSB A;  1FYS A;  3AHW A;  1BU4 A;  3AHS A;  1RGK A;  1BNJ A;  1G02 A;  2RBI A;  1ZGX A;  1IYY A;  4J5G A; 
#chains in the Genus database with same CATH topology
 1OF5 B;  1RMS A;  3D3L A;  3DGY A;  1GS3 A;  3FKA A;  5IEO A;  2ZL8 A;  1EQK A;  1DMN A;  4HM0 B;  1RGF A;  2W2C A;  3DXO A;  1CYV A;  1BNI A;  1U5O A;  4CCV A;  5IG5 A;  2CG0 A;  1KQS 2;  1UCK A;  1JBR A;  1R4Y A;  1HU9 A;  3WR2 A;  2WOF A;  2WGO A;  3B7C A;  3JUO A;  3NBR A;  4XDV A;  2SBL A;  1VQN 3;  5IG0 A;  5HOH A;  2XFS A;  2XF3 A;  1TUH A;  1SIH A;  3CPO A;  2WO0 A;  5EEO A;  1IT8 A;  3T0U A;  4CDL A;  1B20 A;  1STD A;  3VF1 A;  1TP6 A;  3S27 A;  4EYC A;  2GU1 A;  1VQ9 3;  4LZI A;  3S67 A;  1K41 A;  5D81 A;  5DRE A;  2XGL A;  1LOW A;  1Q9E A;  1BRK A;  4PEJ A;  2KAA A;  3DZL A;  3VGN A;  4OUQ A;  2C11 A;  4L8O A;  1JBT A;  2OWP A;  1VQ5 3;  4IPB A;  4JRF A;  1RRL A;  1IU7 A;  1QJG A;  3EX9 A;  3OWU A;  5D82 A;  1YIJ 3;  1UUG B;  1VQK 3;  2UUG C;  2F86 B;  1YI2 3;  1HZ1 A;  2F99 A;  3GSP A;  3OX9 A;  5M18 A;  1PY3 A;  2P0X A;  2LYX A;  2W03 A;  1V74 A;  6STD A;  1Q40 A;  2HML B;  4WYK A;  1DET A;  1RSN A;  5M19 A;  4I4K A;  8RNT A;  3NBB A;  1I2E A;  3Q90 A;  2ML6 A;  4R9K A;  1JKG B;  2SAR A;  2XH9 A;  2E2T A;  2YX9 A;  2E2U A;  3FF0 A;  4EBG A;  3G71 3;  2QIY A;  3T8U A;  1UCJ A;  2OOV C;  1BSD A;  3DMC A;  3UJM A;  3S5C A;  1RTU A;  1T2I A;  3CNX A;  3FG1 A;  3V99 A;  1G96 A;  1UCI A;  3E99 A;  3LYG A;  3MKI A;  3PYJ A;  1FGQ A;  1OCV A;  3SXX A;  4AEQ A;  4BL3 A;  1B2S A;  1GY6 A;  1K73 4;  3H3H A;  3G0K A;  3BLZ A;  1NNV A;  2CWV A;  1RN1 A;  2BMO B;  1MNL A;  4L7K A;  2W6J H;  3NXJ A;  3CCV 3;  1CQS A;  1UGI A;  3MPH A;  4J9A A;  2R41 A;  1YGW A;  1B27 A;  1HKX A;  2B1X B;  1QAL A;  1RRH A;  2C10 A;  2H0H A;  2KCD A;  1ROV A;  2KXG A;  3HZP A;  3DUK A;  4GSP A;  2C4B A;  3B4O A;  4EXR A;  3F8H A;  5M1A A;  4HJL B;  3TDG A;  4XDW A;  4N6O B;  1R4C A;  1JNQ A;  2YFI B;  3F40 A;  4CJN A;  4FCJ A;  1UW1 A;  3NUV A;  1BNE A;  1IVX A;  3OXA A;  2H0I A;  4FMD A;  4H3U A;  3A5E A;  4HYZ A;  4ORL A;  4HZB B;  1CEW I;  1S5A A;  2WGQ A;  3D5G A;  1ASK A;  5FW5 A;  1B2U A;  1N8Q A;  2B24 B;  2L1S A;  3X41 A;  1JV2 B;  1L5G B;  1T3B A;  4XM4 A;  1BAO A;  1IT7 A;  2MF7 A;  1OF5 A;  4LMI A;  2YFJ B;  4WYK B;  1FW7 A;  4N6U A;  3ZFZ A;  2F5W A;  2XR8 B;  1RGA A;  2Y74 A;  2UX0 A;  4IT7 A;  2F98 A;  1FGM A;  1JB4 A;  3CPW 2;  4OK0 A;  1BSE A;  1ROA A;  3PXM A;  1FGR A;  4GHO A;  3ALA A;  3OV4 A;  4X2O A;  4O2H A;  5I97 A;  1O7P B;  1W01 A;  2W56 B;  4HM2 B;  4KFE A;  2W04 A;  1YJW 3;  2GEY A;  4H61 A;  3I55 3;  1IQX A;  1T5Y A;  1IDP A;  3JUP A;  4N6M A;  1K9M 4;  4HM3 B;  1IYY A;  3DGM A;  3DGL A;  4LYL B;  5IG3 A;  1TJD A;  1UCL A;  1BRH A;  1AV4 A;  3KSE D;  3CCM 3;  3CCS 3;  2AAD A;  1T2H A;  4FMB A;  1I3F A;  1I70 A;  3DGN A;  3FCS B;  1FA3 A;  3D4A A;  3ECF A;  1GMR A;  1RGL A;  2MC8 A;  1DVD A;  1FGO A;  1UDI I;  1I8V A;  2CFW A;  1WMP A;  3GZX B;  4LSO A;  4RNY A;  3S28 A;  2BHM A;  5AIH A;  1J2B A;  3WA3 A;  3M8C A;  1I0V A;  3CCL 3;  3CNM A;  3DY5 A;  3NV0 B;  2CFL A;  2W0Q A;  1IVW A;  1BVI A;  2D42 A;  6GSP A;  1VQP 3;  4GB5 A;  1VQ7 3;  4I5Q A;  2STD A;  1W6Y A;  4K1V A;  1E3R A;  2BMR B;  2QGU A;  3KE7 A;  4NHF A;  2KF4 A;  3KSP A;  1W6G A;  3ER7 A;  3WOD G;  3G6E 3;  2XGN A;  1YJ9 3;  1W6C A;  1O7W B;  3BND A;  4BTX A;  1JKG A;  1GY7 A;  4HM8 B;  1OHO A;  1MWS A;  2RSX A;  4FCM A;  4HZ9 B;  4QWT A;  2KF6 A;  1A67 A;  4AKZ A;  1GOU A;  2R4I A;  4BTW A;  1HYF A;  1KWI A;  1W5Z A;  4O3V A;  1RHL A;  5BU4 A;  3UL6 A;  3ZG0 A;  2IUK A;  3JUN A;  2IYJ A;  3HII A;  4MMX B;  3CC2 3;  4WWU C;  5G1K A;  1Q42 A;  1EG9 B;  4XBT A;  1E97 A;  1I2G A;  1B21 A;  3LTC A;  3RGA A;  3WHO A;  3KII A;  1JB5 A;  4EW5 A;  4ILF A;  4KFD A;  5RNT A;  4JF8 A;  1TFK A;  2ZA4 A;  1TU5 A;  1LXE A;  2IY2 A;  1FUS A;  3MG2 A;  3CMA 3;  2PNC A;  4MJD A;  7GSP A;  3AGN A;  1RN4 A;  2M7O A;  5AIG A;  1I3I A;  3K0Z A;  4R4K A;  2IA7 A;  3SED A;  4N6V 0;  3ZG5 A;  3QK9 A;  1YVS A;  5TGN A;  7STD A;  1BUJ A;  2BIR A;  4LGQ A;  1AQZ A;  3PCS A;  1V57 A;  2HMJ B;  2GXF A;  1B2M A;  3HOH A;  3B8L A;  3HIG A;  2QA4 3;  3PZW A;  1UI8 A;  1UGH I;  3BB9 A;  2O9U X;  4BIR A;  1M9G A;  2CWU A;  1O7M B;  2H0G A;  3EBT A;  5EVH A;  3U97 A;  5CF2 A;  1JJ2 2;  1VQ8 3;  1VQ6 3;  1WTH A;  4HM5 B;  4HVN A;  1OPY A;  1AR0 A;  1C7H A;  3I0Y A;  1N5H A;  1Q7Y 4;  1B3S A;  4GL6 A;  1E3V A;  1ZO2 A;  4FMA A;  4NPB A;  3CCQ 3;  3F7X A;  1ULI B;  3NX0 A;  4K90 B;  5CLK A;  2LQV A;  4DKI A;  3A76 A;  1X1U A;  1DMQ A;  2CW9 A;  3CME 3;  2W56 A;  1RJO A;  2RNT A;  2J8X B;  1CYU A;  2K0M A;  1BIR A;  1SJW A;  1WMN A;  3GRD A;  3K9M C;  2HMN B;  4HM7 B;  3X3Z A;  1YGE A;  2CFD A;  1N5P A;  4FR9 A;  1JZO A;  1BRS A;  1ZS7 A;  1LNH A;  2IMJ A;  1DE3 A;  1KSI A;  2KRT A;  3CCR 3;  3SYU A;  3EQQ B;  2OOV A;  3PGB A;  3F8X A;  4IIA A;  3X3Y A;  3RGR A;  2D1W A;  3UL5 A;  5IEP A;  2UGI A;  3EN8 A;  5IW9 A;  3Q3F A;  5FGO A;  3X42 A;  4ZM8 A;  2XSO B;  3FGY A;  4HM1 B;  1BAN A;  3JUQ A;  1GD4 A;  3O8Y A;  3AHS A;  3EC9 A;  1RGK A;  5IG4 A;  2RGQ A;  1BNJ A;  1G02 A;  2FXT A;  4K61 A;  2PZV A;  3EBY A;  3NV0 A;  5CK6 A;  3MG3 A;  3L0R A;  4RNZ A;  4J5G A;  4RNT A;  4CPK A;  3EHC A;  3K7C A;  3BNE A;  1TRP A;  2A15 A;  2W9Q A;  3AGO A;  1YIT 3;  3SOY A;  1A2K A;  1UUV B;  3OW2 2;  2GSP A;  2AAE A;  1EUI C;  3MYT A;  2BMQ B;  3NM2 A;  4EV2 A;  5BVB A;  4R1K A;  1SPU A;  3HX8 A;  2CFK A;  1VQM 3;  5IEN A;  1FUT A;  5GSP A;  2CHC A;  3IJE B;  4HM4 B;  4N6L A;  3LTA A;  3GZY B;  3U1W A;  1B2Z A;  1GOV A;  1OAC A;  1PU4 A;  1IQ8 A;  3HI7 A;  5G1L A;  2Q07 A;  5JPU A;  3LT9 A;  1KC8 4;  4OVM A;  2GU3 A;  1OGX A;  1Q82 4;  3G16 A;  3KKG A;  3AMO B;  2JDI H;  3JVC A;  3DGO A;  5JPP A;  3CCU 3;  1EA2 A;  2P0M A;  3EN1 B;  5BXQ A;  2ZDJ A;  4XBX A;  1BRJ A;  3WDG B;  1S72 3;  3MSO A;  1LNI A;  1I2F A;  1BOX A;  1BGS A;  2GEX A;  4O8S A;  4R9L A;  1MWU A;  3NBJ A;  1C54 A;  3FLJ A;  1JB2 A;  3EB8 A;  5KP3 A;  3Q1C A;  1NO3 A;  1ISK A;  1BNF A;  3FZW A;  1JN5 B;  4WP5 A;  5AI1 A;  3BU4 A;  1BUQ A;  1YVB I;  5AEW B;  4BU4 A;  1ULJ B;  3NHX A;  1X1Y A;  4WFO A;  3DH2 A;  2OQE C;  5LC6 A;  3WMD A;  1MOL A;  2HOH A;  5EQL A;  1W2Z A;  1IVU A;  3Q2P A;  1SAR A;  5D83 A;  3LTD A;  4X2H A;  3OWY A;  4U13 A;  2OTL 3;  1LOY A;  2CFG A;  2XFT A;  5CXO A;  1YHQ 3;  1N9E A;  3GAX A;  4L8P A;  4XBY A;  5HGR A;  1QAF A;  2CKF B;  5A0O B;  4HOH A;  4KT3 B;  1STF I;  2OQE A;  2JQ5 A;  4Q53 A;  1DMM A;  4KFF A;  1D6Z A;  1YNV X;  3CU3 A;  5DRV A;  2OTJ 3;  1FUW A;  1W7C A;  2KF5 A;  4KZ1 A;  1NB3 I;  5AYR B;  2CG1 A;  3MG1 A;  1CH0 A;  2ZHX B;  3JUM A;  1M1X B;  2P38 A;  1OUN A;  2KF3 A;  1ZX2 A;  2BT3 A;  2CIU A;  3N8B A;  1M1K 4;  3RDE A;  1QVF 2;  2IUJ A;  1PFP A;  2Z6B A;  3FG3 A;  4XB5 A;  3FG4 A;  1NU3 A;  5AEU B;  1W4N A;  4R80 A;  3UB1 A;  5G2G A;  1TFO A;  1MGW A;  1BRG A;  3D5I A;  3BIR A;  3K5T A;  3LH4 A;  4MEI A;  2BNG A;  1RDS A;  3LT8 A;  3EF8 A;  1IVV A;  1RN7 A;  1NB5 I;  1EKM A;  1BSC A;  4TX4 A;  1NJI 4;  1SQW A;  2RCD A;  3LML A;  3PCR A;  1RKY A;  1A2P A;  1TTO A;  3F9S A;  1W2B 2;  1NDO B;  2P05 A;  3PS8 A;  3SVA A;  5AII A;  1BSB A;  1FYS A;  1JZD A;  1O7H B;  2BO9 B;  1BU4 A;  1IV9 A;  3SX1 A;  2GBX B;  5IF6 A;  3J7Y d;  2RBI A;  4NRE A;  3V92 A;  1A2V A;  2INX A;  1UI7 A;  3EJV A;  3F14 A;  5LC7 A;  1Z1S A;  3H51 A;  5KP4 A;  1I0X A;  3N54 B;  4FMC A;  4BTY A;  3K63 A;  1GMP A;  1NWW A;  2W9P A;  2YFL B;  1DVC A;  1TRQ A;  3AMO A;  3STD A;  1WNH A;  2Y73 A;  1BRN L;  5STD A;  3CXC 2;  1RNB A;  1X1W A;  4J5K A;  1IK3 A;  9RNT A;  2HMM B;  3HK4 A;  3GWR A;  1K8A 4;  1VQL 3;  3LZA A;  3NQZ A;  4K1U A;  1Y4K A;  2E2V A;  2I9W A;  3BNC A;  3I56 3;  1Q86 4;  2WOH A;  3G4S 3;  4RBN A;  2HMK B;  3X40 A;  1QMA A;  2F4Y A;  1PYL A;  1JN5 A;  1D6U A;  3F7S A;  6RNT A;  1AVK A;  2CH9 A;  1K28 A;  4N6N B;  1VQO 3;  4HAA A;  1OGZ A;  1US1 A;  1GMQ A;  3MWZ A;  5ELJ A;  2FGT A;  3MHE A;  1F8N A;  2QEX 3;  1IV7 A;  1V58 A;  3BNB A;  1O7G B;  2Z7A A;  3GZR A;  1RLS A;  2CC3 A;  3GZB A;  2K54 A;  4HBR A;  1QVG 2;  3CD6 3;  1OHS A;  1DYU A;  1W02 A;  8CHO A;  2CX0 A;  1QAK A;  5CF1 A;  3RNT A;  2P09 A;  4HKV B;  1RNT A;  2F5M A;  3EE1 A;  4KVH A;  1GSP A;  5IER A;  2HMO B;  1VZZ A;  1BNR A;  1AVL A;  1JRQ A;  1FZU A;  3N9H A;  2BU4 A;  1BNS A;  3IMA B;  1RGC A;  4EC6 A;  1OHP A;  1B2X A;  2Z77 A;  3NM7 A;  4MMY B;  1BNG A;  4O02 B;  3G8Z A;  2ML5 A;  3SLU A;  1LOX A;  1IQY A;  1G0T A;  2XEP A;  3KFQ C;  1FGT A;  1MWT A;  3OWS A;  3NQY A;  4EV5 A;  4AKY A;  1Q40 B;  3QRD A;  1RGH A;  3D79 A;  1OH0 A;  4MMZ B;  1Q7H A;  2V1L A;  1D6Y A;  1LRA A;  4J8T A;  3CC4 3;  3S29 A;  1X1X A;  2CX1 A;  2CK3 H;  4LEH A;  4N6T A;  3V98 A;  3FSD A;  1AY7 A;  1N9J A;  2O3O A;  2Z76 A;  5AIF A;  7RNT A;  1GOY A;  1RGG A;  1RGE A;  3UNL A;  1RCK A;  1GYB A;  3LOY A;  3URP A;  3B4P A;  1UUW B;  3DM8 A;  1BSA A;  3FH1 A;  2FNQ A;  4BL2 A;  1YJN 3;  4STD A;  3VSY A;  3KCH A;  1LQG C;  1MWR A;  1TIJ A;  1U8C B;  2CWT A;  1W00 A;  1BRI A;  1VQQ A;  1EEJ A;  1WQL B;  3D9R A;  2OCT A;  3KZT A;  1VQ4 3;  1JBS A;  5AYS C;  2GBW B;  1LOV A;  1LQM B;  1SII A;  3IPT A;  2XRX B;  3WOF B;  1RCL A;  5JBS A;  3CC7 3;  1LVN A;  3X3X A;  2RFR A;  5BIR A;  3CCE 3;  5KP1 A;  3ROB A;  2XSH B;  3LTB A;  3KN4 A;  4RZM A;  1O7N B;  1KD1 4;  1Q81 4;  1MGR A;  4WHA A;  3WOE B;  2F56 A;  1A90 A;  4HM6 B;  3AHW A;  4FCZ A;  3CCJ 3;  1M90 4;  1GY5 A;  1WMO A;  3FF2 A;  3LXU X;  1GD3 A;  4N3V A;  2K3D A;  4G1M B;  1ZGX A;  2L4V A;  3T8N A;  3WA2 X;  3SOA A;  1N8R 4;  5ELU A; 
#chains in the Genus database with same CATH homology
 1I0X A;  1RMS A;  3DGY A;  1UCL A;  1BRH A;  1TRP A;  1GMP A;  3AGO A;  1TRQ A;  2AAD A;  1RGF A;  1T2H A;  2GSP A;  2AAE A;  1BRN L;  1I3F A;  1I70 A;  1BNI A;  1UCK A;  1X1W A;  3D4A A;  1GMR A;  1RGL A;  4J5K A;  1RNB A;  1R4Y A;  1JBR A;  9RNT A;  1I8V A;  3WR2 A;  1FUT A;  5GSP A;  1I0V A;  5HOH A;  1B2Z A;  1BVI A;  1GOV A;  6GSP A;  1B20 A;  2F4Y A;  1PYL A;  6RNT A;  2KF4 A;  1LOW A;  1Q9E A;  1BRK A;  4HAA A;  2KAA A;  1GMQ A;  2KF6 A;  1BRJ A;  1JBT A;  1GOU A;  1LNI A;  1HYF A;  1I2F A;  1BOX A;  1BGS A;  1RLS A;  1RHL A;  5BU4 A;  1C54 A;  1HZ1 A;  3GSP A;  1PY3 A;  3RNT A;  1RNT A;  2F5M A;  1BNF A;  1GSP A;  1DET A;  1RSN A;  3BU4 A;  1I2G A;  1B21 A;  3WHO A;  4BU4 A;  8RNT A;  5RNT A;  1X1Y A;  1I2E A;  1BNR A;  2ZA4 A;  2SAR A;  3DH2 A;  1FZU A;  2BU4 A;  1BNS A;  2HOH A;  1RGC A;  1FUS A;  1UCJ A;  1B2X A;  1BSD A;  1SAR A;  1BNG A;  1RTU A;  1T2I A;  7GSP A;  3AGN A;  1RN4 A;  1UCI A;  1I3I A;  1B2S A;  1LOY A;  1YVS A;  1RN1 A;  1BUJ A;  2BIR A;  4RNT A;  1RGH A;  1AQZ A;  4HOH A;  1B2M A;  3HOH A;  1YGW A;  1B27 A;  1YNV X;  1LRA A;  4BIR A;  4GSP A;  2C4B A;  1X1X A;  2KF5 A;  1CH0 A;  1AY7 A;  7RNT A;  1GOY A;  2KF3 A;  1RGG A;  1RGE A;  1RCK A;  1B3S A;  1BNE A;  1BSA A;  3A5E A;  1X1U A;  3KCH A;  3D5G A;  3URP A;  2RNT A;  1B2U A;  1BRI A;  1MGW A;  1BIR A;  1JBS A;  1BRG A;  3D5I A;  3BIR A;  1LOV A;  1RDS A;  1BAO A;  1FW7 A;  1RCL A;  1BRS A;  1DE3 A;  1BSC A;  2F5W A;  5BIR A;  1RGA A;  3SYU A;  1A2P A;  1TTO A;  1BSE A;  3Q3F A;  1MGR A;  4GHO A;  2F56 A;  1BAN A;  1BSB A;  1FYS A;  3AHW A;  1BU4 A;  3AHS A;  1RGK A;  1BNJ A;  1G02 A;  2RBI A;  1ZGX A;  1IYY A;  4J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...