4GI5A

Crystal structure of a putative quinone reductase from klebsiella pneumoniae (target psi-013613)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
259
Chain Sequence
b'SMKVLLIYAHPEPRSLNGALKNFAIRHLQQAGHEVQVSDLYAMRWKAGYDADDSGAPPVGEFWRPTLDSKQAFAQGTQSADIVAEQEKLLWADTVIFQFPLWWFSMPAIMKGWIDRVYAWGFAYGVGEHSDRHWGDRYGEGTFVGKRAMLIVTAGGWAEHYSPRGINGPIDDILFPIQHGMLFYPGFEVLPPLVFYRTDKTDAGQFADQCAALAERLDTLWQTEPIPFRRQNHGDYLIPSLTLRPELAPGQSGLAVHLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords quinone reductase
molecule tags Oxidoreductase
source organism Klebsiella pneumoniae subsp. pneumoniae
publication title Crystal structure of a quinone reductase from Klebsiella pneumoniae with bound FAD
rcsb
total genus 79
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gi5A00
2BPOA 4Y9RA 1TIKA 4N65A 4F8YA 1RCFA 4BMOB 1CZNA 1OBOA 2ZKIA 4H2DA 2GSWA 2W5UA 1H69A 4QOHA 2QX9A 3K1YA 1I1OA 4ZVMA 3U7RA 1RLJA 4FGKA 1CZRA 3N39C 2KLBA 4C0WA 3K20A 1AKVA 3D7NA 3OWHA 1OBVA 3B6MA 4YQEA 3B6JA 1AKUA 4LA4A 1V4BA 2HNBA 2FCRA 4Y7CA 2RG1A 3EYWA 2OHIA 3F6RA 3F90A 2Z9DA 2MT9A 2FLVA 2FZ5A 2Q62A 3FJOA 1YOBA 3NHFA 1GG5A 2V9CA 4FX2A 4GR9A 4DIKA 3OWXA 3S2YA 3R6WA 1DX9A 1X77A 5EA2A 3NHKA 1CZLA 3OJXA 5LJIA 3O73A 5NLLA 1E5DA 1D4AA 4S24A 3FX2A 3LCMA 1VMEA 3NHUA 4LTMA 2MOKA 2OHJA 3N3AC 4QOGA 4BMPB 2Z9BA 1SQSA 2B3DA 1YCHA 3FVWA 1QBGA 2D5IA 3ESXA 1XYVA 3QFRA 3QFCA 3O2NA 3OJWA 5F12A 2ARKA 5F51A 1CZUA 3B6KA 1D04A 1C7FA 3G5MA 1DXOA 1BU5A 2X2PA 1FX1A 2XOEA 3OX2A 3TEMA 1OFVA 3ESYA 5LVAA 3RPEA 3FW1A 4ZVNA 4CETA 2BF4A 2BN4A 3L9XA 4ICIA 5FUQA 2X2OA 2MWMA 1KBQA 2M6RA 3NLLA 4Y9UA 3HR4A 2AMJA 3NFRA 2N1MA 3NHPA 1CZKA 1T5BA 3HA2A 1T0IA 1CZHA 4LTDA 1YCGA 3LT5A 1AZLA 3P0RA 4FGJA 4LAFA 4U7GA 4GQIA 1AG9A 2R96A 4DY4A 5LJLA 4YAFA 4YAOA 4ZVKA 4NLLA 3U7IA 3OX1A 4PTYA 1FLNA 3W78A 2FDXA 4ESEA 2BZSA 2F1OA 2FX2A 4QOIA 2OYSA 5LLDA 3NHSA 4N9QA 1C7EA 1QRDA 1AMOA 5BUCA 2WC1A 4QODA 4QOJA 1JA1A 4QOEA 4YALA 5LMCA 3SVLA 3JSXA 1BVYF 1JA0A 3ES9A 1H66A 1AHNA 3TE7A 1ZWLA 2V5UA 5JROA 3UXHA 1WSBA 3GAMA 1ZX1A 3KAPA 5TGZA 1F4PA 4YAUA 3OX3A 1AKWA 2FVXA 4R81A 3GFSA 4OXXA 2FAXA 5ULLA 1YKGA 3NHJA 3NHYA 1YRHA 1XT6A 3L9WA 4H6PA 2QMYA 5F4BA 4C0XA 6NULA 3FNIA 1J9ZA 2HNAA 4J8PA 1FLDA 1J8QA 1RTTA 3GFRA 1QHEA 4XDHA 5LBTA 4M0CA 1QR2A 1YDGA 5A4KA 1ZWKA 1D03A 4GI5A 2QX4A 3NHLA 3W79A 3HLYA 1AKRA 5B3KA 3OVMA 3B6IA 4C76A 4PU0A 3ESZA 5EMNA 2XODA 1RLIA 1AKQA 5EAIA 2KQUA 3QE2A 1DXQA 4PTZA 4YAWA 3ZHOA 2Z98A 1CZOA 1FTGA 2FZVA 4LTNA 5FX2A 3W7AA 1SG0A 1J9GA 3KAQA 2QX6A 4U7FA 4XDGA 2M6SA 2BMVA 3EDOA 3N3BC 2V5VA 4FGLA 4HEQA 4ZVLA 3TZBA 1FLAA 2Q9UA 2QWXA 3F2VA 1B1CA 3NHRA 5NULA 2R97A 3GFQA 3NHWA 3UXEA 3W77A 4D02A 4QOFA 1J9EA 2Z9CA 1XI2A 4DILA 1TLLA 1WSWA 5LBUA 1AKTA 4CF6A 2HPVA 4N82A 4HS4A 4U7HA 4C14A 3F6SA 3KLBA 4NULA 3KEGA 2OHHA 1FLVA 1KBOA 2QR2A 2A5LA 2MTBA 1XYYA 5B3LA 2QMZA 5FA6A 1FUEA 1FVXA 1NNI1 1YCFA 2FOXA 2QX8A
chains in the Genus database with same CATH superfamily
3BDIA 2F6RA 3AGQA 1EIZA 4PHCA 1X2EA 4N5HX 3QRWA 2BMDA 3AOEA 5KJ6A 3FMOB 3LBHA 1NVEA 4KFTA 4ZARA 5IJXA 1QQ5A 1XL0A 4YCMA 4OK3A 4X1YA 2ZJZA 1ABBA 2QD5A 1QGED 3HNRA 4Q9HA 2OBXA 3KNZA 4XVUA 1ODFA 4LA4A 2WJAA 2ZIZA 3EVZA 1C3XA 1M5TA 3EFBA 3RVKA 5JSUA 1JEAA 3QJYA 4FKBA 5FUYA 3U3DA 4BP8A 4CFYA 5FWXB 2W6NA 1H0KA 3QLJA 2GI4A 1U2GC 4AFNA 2R6JA 5EMHA 4G56A 4ZVUA 1DBQA 3JY6A 1L3CA 2PD6A 2QSUA 1QZTA 4CQLB 4EGCB 1P60A 4HDOB 4AZ0A 1TYBE 5HJEA 3MFQA 4QTXA 3GNQA 3Q9UA 1SCJA 3KJIA 4B6EA 2BGKA 3P2KA 5F5XA 2X1LA 1RXCA 1PCXA 2QTLA 1K97A 3SS7X 3DMHA 2GEKA 1N8TA 1BDJA 3G7UA 4LK3A 3SC3A 5BNWA 2XB8A 3PPYA 4O4LF 2HBQA 2QMEA 4FGZA 4OXRA 5AO9A 2XNJA 2E48A 3DM5A 3BF7A 4RV5A 3CCCA 4MYSA 5KVQA 3CA8A 3B3QA 1M2VB 4LECA 1A8PA 1SCIA 4B7ZA 3LQKA 2IY8A 2VVTA 5ER9A 4Q3LA 5BW6B 2W2OA 4CQJA 2ZJYA 4EMTA 2C07A 1UOQA 2C5HA 2QE7A 3E61A 3I9V1 2JGDB 3ZWQA 1LLFA 2RI1A 2A5YB 1VG0B 2VHYA 3I1IA 2DUMA 4OQLA 3VYRB 5JV5A 1CF4A 5ESWA 3D6MA 2EYUA 3VVMA 3CC8A 1V1RA 4R7TA 4WCFB 5EMMA 5KQGA 1E3TA 4RKEA 4YCJA 4Z54A 5ULLA 2IYPA 2NYVA 5JNVA 3EAQA 5KOJB 4R1NA 1DTSA 4BCDA 4DC9A 5TC4A 2W71A 1CDDA 2UZ4A 1ECFA 3JWPA 2OCIA 1WDMA 1Y3IA 1PHRA 2G06A 2O20A 3U9TA 4KPEC 4NY1A 1YDEA 3RSLA 4GQAA 1FB5A 2VSFA 2XGSA 5THQA 1UFQA 1N2JA 4YDSA 3TRHA 2P30A 4DPKA 4QPPA 5ABPA 5JDCA 1DO0A 3UPUA 1A9ZA 3GLUA 4MUYA 4IDNA 2LRHA 2XR1A 5AXAA 3V8EA 1K27A 2WJVA 4XVHA 1TCUA 4XSGA 4UVEA 2HREA 2XE6A 5TY0A 5FL3A 3ODGA 1K6XA 3S70A 3ZX4A 1P0PA 1K98A 1NLZA 1V8OA 3JALA 4JEIA 3ZDZB 4B4VA 3IHLA 3QF4B 4OHOA 3ZNOA 4C4TA 2NP6A 3EXEA 5JBIA 2JCSA 3E81A 1LSUA 4M3NA 5IT5A 3MJCA 3DAOA 2CT8A 5LMZA 2PS9A 4AG3A 3TOXA 5FWYB 1A0OA 4FI3C 1N33B 1A3CA 2JB9A 1XTKA 3O9VA 1B73A 1ZYUA 2BR5A 5DCUA 2W6PA 3H3JA 1A4RA 4G1MB 2ASVA 4LY0A 5GWXA 1KOLA 2CMGA 2B4AA 3L7NA 1R5NA 4O08A 1X1TA 3Q3EA 4KHPB 2W8BB 1OBOA 3H65A 2B98A 4E70A 4DHEA 2Q1TA 4B4WA 4DIUA 1ZC3A 1J0XO 3GG9A 5JOQA 3D43A 3L79A 5FO0A 5C5IA 1XJ0A 1MDFA 4Q47A 1WEKA 1GA4A 2OCBA 5HMLA 4AXBA 3ZDDA 1O1YA 4EUFA 1XTSA 1PS9A 2HMVA 2OCXA 2OOSA 4YRNA 2WUWE 2X9NA 4QD3A 4CCWA 2I4MA 4NECA 2JANA 3WAJA 1W88B 3S1AB 2NU7A 4DIKA 4DMHA 2DQZA 5I48A 1E1RA 4ZXFA 4L5JA 1EFVA 3ZU4A 5FPQA 5B4UA 3KQNA 4DV7B 1UDBA 4IIFA 4UZSA 2GN0A 1WCV1 5IPFA 4NTZA 3JASA 2P9FA 5LMNB 5K3CA 3EBPA 4URWR 4C07A 1TVKA 1WMEA 4PC2A 1FP4B 3RIXA 2XYQA 2EKBA 4IKOA 1LS6A 2BD0A 1WVIA 3JYHA 4I4CA 5F78A 3W9BA 1YMVA 2ONZA 4JVSB 1Z6PA 5L95A 1IH8A 2AB0A 1NVXQ 3F3MA 5FORA 4O4LA 3K9WA 5BQ3A 1C7ZA 4XQ0A 3T9EA 4G09A 1J42A 4R83A 1RD4A 1RKVA 1UMBA 1NATA 2HWUA 2MMCA 3COVA 1N25A 5AI6A 5H83A 4EPWA 5J4YA 1Z5OA 2B25A 2PCJA 5SZIA 3IDSA 4MMZB 3CN7A 1Q0TA 2CYCA 4GQIA 4H9GA 3PSAA 3N58A 1FRZA 3ZE7A 2VTBB 2R8YA 5KSZA 2XMBA 1H2HA 6AT1A 3AW8A 4XX1A 4C2UA 2ZRDA 3KQUA 3INTA 3FSGA 5F33A 1G21B 2WC1A 1BMDA 1Z0UA 1JA1A 4X97A 1GL7A 3AF5A 1KK0A 1YS6A 3CZQA 2PQ0A 2B7LA 4RTJA 3DXXA 1JH9A 3PHHA 4YXWD 2NM0A 5IAEA 2BSQA 4JYPA 4LWPA 3K6KA 4H1TA 5JDIC 1QLJA 1OKKA 1EGVB 2WT8A 1O9GA 1WDKA 1MAWA 2YWFA 4RTSA 1LQUA 1R15A 1ZC4A 2XE7A 3WLQA 1A96A 1QH8B 4C01A 2ANCA 1CUVA 5KYYB 4TVKA 4HXEB 4BNLA 1NXSA 3JSAA 1XNGA 4YYZA 4PYJA 1A71A 2LV8A 1JH8A 2XXAB 3I5MA 1JA9A 4IFEA 1PLKA 5A4IS 2H7VA 1NX6A 4MB2A 1YR8A 4PZDA 4WZAB 3ICEA 1DFHA 3QIAA 4DOMA 1CU1A 1N2CA 3TFOA 2JJ2A 1X7WA 1ONSA 1E2MA 1G8YA 2EJTA 4KXYA 1UWLA 1WETA 1GZSA 2YHSA 3P9RA 1YRYE 4CMIB 4P93A 5AVSA 1XAJA 4UARA 1A9OA 1V16A 2C9CA 3SSNA 4D6XA 1Y1KE 2HIAA 1ZKMA 4Q48A 1HR0B 1EJ6A 1GUZA 2V7QD 3O1HB 2AG5A 3SHVA 1NU8A 1XHEA 4OSOA 5CB8A 1X0VA 2O07A 1XDDA 4N4AA 3FHTA 1SA0A 2X4LA 2WAOA 2WVHA 5BRJA 2C3PA 4V1CA 3KEGA 1P5ZB 1XUOA 2A94A 3QEJA 1WXWA 3T0GA 4MRRA 4ZDIA 3JQDA 3VR5H 3L05A 4AYTA 4Z7OB 2CF5A 2GAAA 4UDNA 4Z49A 2AFHB 1VCNA 2NADA 5K0JA 1E5VA 3ZZTA 1SCUB 1IXYA 2V0GA 3WZ2A 3HKDB 4IYRA 4XDYA 3X1KA 4YP5A 2REOA 2QHXA 1KSFX 3LP8A 4S35A 2A0KA 5TPWB 4C4XA 1NF3A 1U0OC 3FJOA 5ALUA 4R9RA 2CNKA 5DTMA 1OPRA 1LC0A 4BASA 3L1IA 2VCYA 3I5AA 3W34A 2VIIA 3M6LA 1HNZB 2KX7A 1PKEA 4NXMB 4RQAA 2C2HA 3HZZA 4ZC1A 3MBOA 2WMYA 3TNFA 4ZJPA 5B36A 3KJHA 3T5CA 2GM4A 1MO5A 4U0KA 5D84A 4KUGA 1AO0A 4PXYA 1TJ4A 1SKMA 4Q66C 2ORIA 3G1WA 3LQ1A 3VPXA 3VC7A 4E46A 1USIA 2Z6VA 4DLXA 3BH6A 4CETA 1UKAA 3TW8B 2EWVA 1Y4DE 4N41A 3UJHA 2AHRA 2AMJA 4J9VA 2OQ2A 1SQGA 3LHSA 1TXGA 1JG7A 1KO4A 1QJCA 3NVMB 1T0IA 5E38A 1J0BA 1RJWA 1ZMTA 3GUCA 4R2XA 3C3XA 3ZHYA 3OM0A 3QBJA 4D3FA 3Q8WA 3AM3A 4ZT5A 1DKNA 4N5LA 1P91A 4I9NA 1T36B 3AERA 3TIFA 1IONA 1LBIA 3U31A 4OATA 4ZRMA 3WHLA 3K96A 1IXRC 1EWYA 4JU8A 3ND5A 4QM6A 1MLDA 3SQOA 2GAJA 1P7YA 1Q44A 2VSXA 1SJ9A 2YJGA 3GAAA 3LY5A 3LRPA 4YI5A 2G36A 4YALA 3WGVA 4IJMA 1K08A 1YUBA 4X8LA 3RS7A 3RAJA 3TRIA 1JXOA 4GO1A 5HVNA 3L4BA 1QYCA 2WZCA 3AFIA 2R11A 1PBNA 4MQEB 2ONJA 4FOPA 3UAWA 4OXKA 3S2ZA 1E5LA 3FMPB 3LE8A 3MUNA 5JSHA 1DC3A 3C6MA 3JQBC 3LC2O 1VPVA 1J0AA 3C8HA 2ZIXA 3LUGA 1WB6A 4IEIA 5BW4A 3QW2A 2JF0A 4GL4A 4MJLA 3DEAA 3B9RA 3E8XA 5DM4A 5KOJA 4EYEA 1GVNB 2JI7A 1WKBA 5AVQA 3HB9A 3EC2A 2WV9A 4RPLA 5A02A 4P3OA 3DDOA 3MJDA 4OP1A 3ZUPA 2QR5A 2J4CA 3GHHA 2G9VA 1XKQA 3H8VA 3ZZMA 3SLKA 1CHDA 4D79A 2X8LA 4RGQA 5ARBA 2VHVA 4YUXA 4KREA 1CZOA 4ZAGA 4HDCA 5CLFA 1XZBA 4KV7A 2BFFB 1WMBA 5EJMA 2VF8A 1C3JA 4H1UA 5CLHA 3PCTA 4JR2A 1FVHA 1BW9B 2RBGA 4B71A 3BDVA 3LLVA 3WQHA 2Q7XA 1OX6A 3MRXA 4TLAA 1WZUA 3S5UA 1WZEA 2NO7A 3N0VA 3ZCVA 3GY0A 3NG1A 3PXCX 1QFZA 5DK6A 3MUFA 3D6TB 2IVFA 1OFUX 3DQQA 4EHLA 1JHPA 3KZNA 3U2QA 2CVQA 1HQKA 3K70B 1U1GA 1VQ1A 1VSTA 3QEKA 1JEJA 4L9RA 2EDAA 4MNTA 4ZDWA 5KNBD 3UO8B 2BPOA 1GFZA 2C99A 3INYA 1VIMA 1EM6A 2YVQA 3IAUA 4BMOB 3PNSA 2M6LA 2Z6AA 2QAIA 2HDOA 1XG5A 3PE3A 1QO0D 3FOCA 4A10A 3E4DA 4U3JB 2ZB3A 2O3RA 2A4MA 3MS2A 4D9KA 2PSDA 1H2ZA 5CD1A 1VL1A 2C7VA 3LPAA 3WB1A 3LK7A 4OU4A 2ZT5A 1Y6RA 1OHHA 2IHUA 5M29A 2C88A 3MPOA 3NP9A 3F6PA 1EAMA 3H2GA 4AW9A 4RKQA 4CTOA 2RIRA 3FHCB 3C24A 1RE1A 2F59A 1O94D 4EF4A 1O6FA 4NCAA 1BEUB 4I9FA 1JHAA 1K66A 4RPHA 2GD6A 2B1RA 1BS1A 1PJSA 4JI8B 3QKIA 1JDTA 1TQ4A 3FYDA 2F8LA 3HCPA 4C7OA 2VNIA 1PX2A 4CMGA 4LZLA 3A2MA 3GFTA 2BF4A 1ZM7A 1A8UA 3JARA 1F51E 3H11A 3RHFA 4QULA 3DOEA 5L4SA 1MVOA 2ZIUB 3BKWA 2EWMA 3HG7A 3D7LA 4RK7A 1GGJA 4LXUA 4QWMA 4C08A 3UK7A 5HOEA 2CLEB 3MILA 1QHYA 4MYCA 3IVCA 3ESCA 1MENA 2PH5A 4ENRA 5EP1A 2HWKA 4AJHA 3EBLA 4OHWA 3CTMA 4B35A 5AUOB 3WG9A 4GOXA 4M86A 5KC9A 3M9WA 5DRYA 1F0KA 2VP5A 2YWHA 2ZU0C 2AK3A 1CLEA 1TD9A 3SG0A 1N2CE 2WTAA 2CCKA 4JUDX 1N78A 1CVRA 3KPWA 1VKOA 4JIGA 3I34X 5LNK6 3T3EA 1YQUA 5KAPA 3V3TA 5TDHA 1R6DA 4GPIB 1QV7A 4R9UC 3VKVA 4V1CI 2ZE5A 4WVFA 2POCA 3R3XA 1Q0UA 4V38A 1ATZA 1XRSB 1S3IA 5K0FA 5J5CA 1CF2O 2P0EA 1EVYA 3BMOA 3VU9B 1US8B 1KAMA 1GKYA 2GFHA 5JXGA 5KMGB 1TMGE 3AT1A 3H1EA 2EJUA 1OZGA 5C8YA 1JTFA 1NMSA 3Q3IA 3HY4A 4O2AA 3H04A 1TO1E 3BKXA 3MZ0A 2QT0A 4BBAA 2PKEA 4QBTA 3MQ2A 5EMNA 1WAMA 3KVYA 1G59A 4DF3A 1IBRA 3CMCO 3CEJA 3DAGA 4M55A 3I8SA 2Q4BA 1MHPA 1UDAA 1LI5A 1G8MA 3AKYA 1D8TA 1L7QA 1F2TB 1ZIPA 4UOQA 3GRVA 3UB3A 1PS0A 5DYNA 3TLZA 1QVZA 2G83A 3IUQA 2M1ZA 4CL8A 1IZZA 3LD9A 4OCZA 2B9VA 2WVJA 3FVQA 2NVOA 4OQ4A 1SXJD 1PLLA 1R5BA 3QA9A 5CJPA 3LOUA 5EZSA 4DR6B 3QPCA 2HRCA 1T9KA 1YJ8A 2HD4A 3FR8A 2O8NA 1H8EA 3GLHB 1FLVA 3MFYA 2BBWA 2HTEA 1QIIA 4QIHA 2J7PD 5DHTA 3H5WA 2JDID 2WSBA 5L8VA 2XCIA 1NT2A 2J67A 3AEKA 3IULA 3NEPX 4OMDA 1CZNA 1ZUWA 3QVWA 5ITSA 5JAOA 3OQJA 2HBZA 2ZOSA 3GN1A 1IAQA 2RHLA 4OJQA 1VA5A 2V1XA 3OZWA 1HPLA 5JY6A 3FRHA 5AJZA 3V3KA 3OPMA 3JVDA 2ZTMA 4LEIA 4E4TA 1IHDA 4QBIA 1GR0A 3WO0A 4Q34A 1TZ2A 1Q22A 5GVRA 3ZTYA 2XCRB 4X7BA 1Z4JA 2H1FA 4KB5A 4B43A 5JWOA 1ST3A 2ZI5A 2CMHA 4UUPA 3H1GA 4PSKA 3Q3VA 1WL8A 2O1WA 4YJHA 2WU4A 1YGYA 2P69A 3AY6A 4DJAA 4WKPA 5LIPA 1EUCA 3BD9A 3EIHA 4XD2A 3IBYA 1GTMA 2FZCA 2YRFA 1U8CB 2WPDA 3DEKA 4L8LA 5FUMA 4Q0MA 3NATA 1FX1A 1XJWA 4EO9A 3BIFA 2JHPA 1QIMA 2OSBA 4S1OA 4E0BA 2QNBA 2FW9A 1PFQA 3KUCA 5KINB 2XKAA 3C7DB 1QB7A 1LDBA 1F8FA 3BWYA 2YVAA 3CUYA 2ETXA 2VDNB 1AQUA 5DCYA 2DUUA 4I3FA 4I7EA 4O2LA 1Q5PA 1YCGA 4YJ2B 3B2EA 2YYZA 3BIJA 1QE3A 3LQFA 1P2SA 4IDEA 3D5EA 2RJ3A 3GYGA 1IHPA 2C5SA 4DLYA 1W36D 4YFYA 4FDVA 5CB4F 2ZS9A 3E9DA 3M6MD 1ZIYA 2R25B 4PS0A 1DBWA 5AOVA 4HFMA 4FYPA 4E1AA 2GHRA 3ZCQA 1K3FA 2EZUA 3NBYC 3NC1C 2GDJA 5HHTA 4MLCA 2I2BA 3B9QA 4PX5A 1K7XB 3U37A 3KQQA 2WUVA 4CI9A 1N92A 4ZZ0A 1RAGA 1THGA 2I7DA 2ZANA 3OCVA 1Y9JA 1BA2A 3L7AA 4BNMA 4ND8A 3GV0A 4TLBA 3D6FA 1MT3A 3A3NA 5DIFA 2IYSA 3PC2A 1E3MA 4X66B 3CG0A 5LBTA 3RD5A 4CUJA 5BV0A 2BCGY 3BICA 1R74A 2RBKA 1XEAA 3N7TA 1DBPA 2W2KA 3RLIA 1OSNA 5HJ5A 2GPNA 4TQGA 3SAJA 5K3OA 4H1WA 2J3KA 3A28A 1XP8A 3CZCA 4BNWA 3R9XB 1GFSA 1H1DA 4M9XA 4XR9A 4F2DA 3WK7A 1E7SA 3KSRA 3T4EA 3R8FA 4RGBA 1EVJA 3FPEA 4AM8A 1W5BA 1R4NB 4AZSA 1JQ3A 4P5PA 1KGSA 2GM9A 4R3UC 5AP9A 2OM2A 2Y4NA 4O4IF 2I7TA 3HZHA 5FOWA 5HUQA 1M34A 3H3FA 4PQYA 4TMXA 2Z43A 2GYVA 4F84A 3O7WA 3OKPA 4QQ8A 3I2HA 2AL7A 4FWIB 2FV8A 3SYLA 1QRAA 3MOGA 3WICA 2ORWA 3ZG6A 1K7EB 1XTVA 2WTBA 1KOFA 2V9ZA 4L85A 2IX3A 4QJ4A 3G59A 2FPMA 3HFSA 2BDUA 2V7QA 3PDIB 1K68A 3DWIA 4MLDA 2VAWA 4OUDA 4Y6RA 3RU2A 1G20B 4BVFA 5KJEA 1W46A 3OY2A 4MYRA 2VWPA 1ZMXA 1X7ZB 1LX7A 4QLOA 4X1IB 1PZMA 3ZK7A 1Y34E 3I0MA 4C1BA 4ER6A 5A06A 5IDQA 2Q2VA 1GL9B 1E79A 4HB4A 4U6NA 4UBOA 4CTMA 2BYTA 3EJWA 1NKSA 4WXHA 4I5EA 2OXEA 3WB0A 4MIOA 1F17A 5J2TF 1DQRA 2OHIA 2PKYX 4Q05A 2VQ6A 3ORFA 4D4GA 4Z7NB 5A0VA 3GWGA 3H99A 3ISVA 5IW8A 3RJ5A 2H1VA 2GKSA 4BIIA 1A7UA 1T5TA 4UUBA 2YJ6A 4Z99A 2EFGA 1S0UA 2XYRA 5G3ZA 1TJNA 3DHWC 5NLLA 3FX2A 3V00A 3L4BC 3LLCA 5IF9A 4HDMB 2UXCB 3CISA 4RSRA 2PIAA 2ZJ8A 1JDSA 2JJ1A 3TOCA 1NZDA 4FU0A 4WUTA 3VZDA 2Z1DA 2F3UA 3MIIA 1RZUA 1BDMA 3LQRA 4GZLA 1C3EA 4QDTA 2C2OA 1YE3A 2BEUB 4IFBA 4UU1A 1QTNA 4D8XA 8ABPA 2VUTA 3W4IA 1CUUA 3FYUC 2C5BA 3VUFA 3CN9A 4A5OA 3IB6A 1B8UA 2M6RA 1Z2OX 5C81A 4CIAA 1L8LA 5TMEA 4GX5A 3ESDA 4HXFB 4U5XA 2PXXA 2WD9A 1P5FA 2WJHA 2Q28A 4NP6A 1HT2E 3JAWB 1WXXA 5H16A 4BKPA 5JYCA 3AHJA 1E6UA 2BCJQ 1J4AA 5JC8A 4IWXA 3THOA 1C80A 4FB5A 3UAXA 1E2BA 5I7AA 2H54A 2CN1A 4TTJA 1E9BA 3OM8A 1YZNA 3IOBA 4E07A 5JNWA 1LRJA 3W78A 5JXIA 1NKVA 5LYJA 4NCNA 1U80A 2LTAA 3FUWA 4ZOEA 4D3SA 2FI1A 2PHZA 2DCMA 1KPHA 1AV6A 2HT6A 1UJ4A 4WA8A 1BVYF 2CLKB 2JJ2D 5AIBA 4GMDA 4MRSA 1S2MA 3Q9LA 1U3WA 2Q9CA 4RF3A 4YGYA 4F6RA 1L1RA 3HO1A 3DKRA 1CETA 1ZGJA 3BRWD 4K40A 2YJ3A 2YXPX 4M36A 5HS6A 4AY2A 1BE6A 1GRQA 1MQSA 4N0EA 1XZKA 3Q2KA 2IBMA 5ICFA 2V7GA 4KXQA 1L0BA 1DIRA 2QAGB 2JAXA 1FTWA 2E6UX 4ND4A 1MABA 1Z6XA 5JQGB 2UVDA 1Q3KA 3CNEA 1NC3A 3OPVA 4L6AA 2QPOA 1XKXA 1ZOSA 2QYOA 2XNKA 4WXYB 5TB5A 4D92A 2H5IA 3GIDA 5CNKA 4BNVA 4FINA 5DTIA 2H31A 4Y2HA 2IC5A 1XRPA 4EBBA 5B7PA 4IF6A 4F38A 3N1UA 4HJRA 4B6FA 1NG9A 3MS4A 4DZZA 1OLSA 4J9UE 4RELA 2O1SA 1JT2A 1ISHA 1P77A 3FFXA 1GV1A 4OP3A 2PXHA 3SKYA 1VG1A 4N18A 2FA9A 5LA6F 2CDAA 1M8KA 1O8CA 2ZQZA 3PHIA 1Z5WA 3BE6A 4X84A 5DLYA 2ZBQA 3SJBA 3KETA 5E7MA 4B32A 1ONBA 1B8NA 5JTUA 4C21A 4GS5A 2P77A 2VK1A 1F1BA 4QFBA 3KB1A 4PLYA 4BQFA 2JLQA 3PPVA 3DF7A 2RHTA 4J49A 1QGDA 1ZK2A 3HGQA 5I7OA 5I7HA 5G0SA 1EESA 8OHMA 1H9CA 2Y93A 1QZXA 3PTZA 3QELA 1H4SA 1XCOA 2C4VA 4EEKA 1MUUA 4CKZA 5L4NA 1LWOA 3U7RA 3OAAA 4RH3A 3ZE8A 3L8MA 2GM3A 3G13A 4MIYA 3RS9A 4E5YA 2AC7A 4NMWA 1EP3B 4KR6A 4FUTA 3MWJA 4FHGA 1MB9A 2CGEA 3PDJA 4TX1A 1JIQA 1Y8QA 2BGWA 2NLOA 4D56A 3KE8A 3K5IA 4MCAA 3B51X 3LHDA 2XA9A 1EJ2A 5FQNA 3MERA 4RLFA 4WVLA 1WD7A 4G5SA 2QRHA 2BZGA 1ZEMA 5B6JA 3MCUA 4X3PA 1C2TA 5IKPA 3ZGNA 1Y81A 4N3NA 2YZKA 3C0KA 4NI5A 3J81A 4TSFA 3TTSA 5C8DA 2PX0A 1J39A 1TAQA 1U0FA 2P41A 3GRUA 3AVPA 1E1NA 4RIFA 1JLRA 2DKOA 1PU2A 2ES4A 4A6EA 3V4VB 2QTWB 1ZH2A 3AI3A 4MRMB 3AOEC 2QQEA 3OCWA 3ND7A 1CUBA 1D6MA 2B4YA 1GEEA 5DSXA 4U8GA 3A58B 3G0GA 1AF7A 3U6KA 4MIEA 2CKMA 4FKMA 1WLYA 4A0SA 2XUQA 4X41A 3HEAA 4JDPA 1JAYA 5DHSA 1SCBA 3D2CA 2I6QA 3E82A 3V1TC 2ASEA 1DKQA 2E4AA 3IOCA 3L04A 4GGPA 2W6MA 4J0KA 5FBHA 4JLSA 2FX2A 3QNWA 4B6QA 3LO5A 2O8FB 3HKBA 2FZ4A 4JUCA 2JAUA 3AUUA 1E9DA 1J8FA 3T3MB 3OIUA 3OZBA 4ABTA 5D5PA 4IHJB 3H4VA 3DP7A 4ZEOA 1JBEA 1BJTA 3WP0A 4EFDA 3KAPA 2D5BA 1I6MA 5LQUA 1F8GA 4U7DA 1AKWA 5CIQA 1P2UA 2YWGA 4P92A 3M1IA 4N3GA 2R4UA 5ENDA 3ZGYA 3WKAA 3AX6A 3Q85A 3VMMA 4EY5A 3RYCB 4ZO8A 5BOSB 4MR8B 4IUYA 4MVYA 3AVWA 2PZGA 1NN0A 2XDAA 2FSFA 2YVLA 3IJEB 3QOXA 1A1SA 2ZVDA 3UMVA 5BWLA 1AX9A 1Y4ZA 3ZXXA 3MGKA 2Z2ZA 4WASA 1EAYA 1RLOA 2I4IA 3IDZA 1QHHB 1F8XA 1XA3A 3BRCA 2P4HX 3EUAA 3TLYA 1R88A 2J3EA 4HEA1 2OESA 2QXYA 3RAPR 2IVZA 1O96A 4DR5B 4OGKA 4RDCA 3UB4A 1NBOA 3PQ7A 5LZ8A 2M9MA 4PTZA 4DZTA 2NAFA 2C4MA 2XWPA 1V45E 1ZD8A 3KAJA 4X20A 2OXIA 4F1JA 1D4FA 1N8SA 3G23A 2AD5A 4YJFA 1VLJA 4RV4A 2DQKA 3L8YA 1FDTA 2D1TA 3FSRA 3NHWA 3HPRA 4WRRA 2EQBA 2V55B 3QVTA 4XPIB 4QOFA 3LMKA 4DVJA 3U4DA 3T7SA 4EPVA 3EMBA 3HXLA 1UOPA 4HWTA 5ICMA 3R44A 1TAUA 2P2YA 4KXLA 5GM1A 2J6CA 3I73A 5G4LA 3OT4A 4BO9A 1RI2A 2CW5A 1YHYA 1VBMA 4I36A 4DDMA 2Z6QA 4L78A 1C9EA 4AWBA 4FYKA 1ZISA 4GXNA 3RGGA 3ASYA 1LBEA 4K86A 3G88A 5J4KA 1RWXA 2AI3A 2V8OA 3CJQA 3D81A 3BG5A 3K0EA 1A77A 1U1FA 5HR5A 4D80A 2H2HA 3F9CA 2ZYTX 5DGIA 2GAIA 4XCXA 2BGGA 2HQSA 3IAS1 1OCEA 4YT8A 2A2ZA 2IU3A 2QN1A 2X6QA 4JI4B 2O19A 1M72A 1U3VA 4WJLA 2Q41A 3UOAB 4C1NA 4D02A 3QPVA 4AYXA 1OXBB 2BJHA 3HMKA 3EEIA 1KYYA 5D7NA 2NVUA 3HV2A 1DX9A 2Z2JA 5AKZA 2ZDHA 2TECE 1TTPB 1YJXA 4F4UA 4S24A 2VUIB 1G66A 1UADA 5DM2A 2BFAA 4IICA 2PZFA 4S05A 3FG9A 3M6AA 2GGSA 4H4DA 4F2PA 5AMXA 2JG3A 4G24A 3GP8A 1WTCA 4WQMA 3T1HB 5REQB 1Y1TA 3FHOA 3HWSA 1EFCA 4JQYA 3T0IA 4BLQA 2BN4A 2I3DA 1TC2A 3I1FA 4PCVA 5EQTA 3WVNA 1G16A 3MELA 2KSQA 3TAXA 3LBIA 2OBNA 1KJWA 3I2FA 5CMLA 4CM8A 1W44A 1C9NA 1P4RA 4KUEA 1LPBB 2VBCA 5CIWA 2YJTD 4AS1A 3SZGA 2YHBA 4EVQA 4GBGA 1GFWA 1F6WA 1M2VA 4KPYA 2XLBA 3IXMA 1D2EA 3N07A 4AIIA 1R16A 1VC2A 2QLNA 3T0FA 1XTJA 2WSMA 1BRTA 1L1EA 3OX1A 1UJBA 2ZE6A 4S1TA 3CF4A 4WW0A 3HBFA 5DULA 5A3RA 4CHTA 1RCUA 1IMOA 3V7UA 5LLDA 1YR7A 4AJOA 1AGRA 3NB0A 3GUYA 3I4CA 1V1RB 4BN4A 2HW8A 1PS8A 1OUMA 2O0LA 2IOQA 2DWPA 3O2QB 3QBEA 5JNRA 2NSDA 1BXGA 1NY5A 4BO5A 4ER0A 1R0RE 1ENPA 3QEMA 4O1HA 4G89A 3OLYA 3OX4A 2JGLA 3OZRA 4DHWA 4DXDA 4ZVQA 4JR1A 3D31A 5DM1A 2WHQA 5HIKA 1I1NA 2E1RA 1LPPA 3ZS8A 2C0PA 4FLEA 4AJKA 4W5WA 5KDDA 1EJBA 4U9UA 5SV2A 4CI0B 5GJVC 4J7XA 3NPMA 3FCOA 4E32A 3MJSA 1XXLA 3LRXA 4JSTA 3HCWA 4W7HA 3T12A 4DCGA 1AXGA 2CE2X 4MQLA 2VP6A 3KXIA 2H9AA 2FSGA 3V2GA 5JJBA 1SG0A 5BN5A 3S29A 1VSBA 4AS2A 4BJHB 4TSKA 4X54A 1RXEA 4ZOAA 1TJPB 3KEOA 2FU5C 3FJYA 1JQ5A 2OSVA 2PANA 1R8YA 4AC9A 4EM6A 3T7CA 1OX4B 1IJFA 2CJFA 4U2FA 5HCIA 4Q12A 1ENOA 4CV3A 3L77A 4YUYA 1P3Y1 1YZHA 3V8VA 3R5FA 1KK3A 3C6XA 1XRQA 3JPWA 3QQ5A 4HAYA 3WGLA 4N82A 1ZA1A 2CMDA 4PO8A 4RENA 3LA6A 4C0QC 4HDSA 2MSDB 5EGNA 4B4OA 4DUGD 1NW5A 3TTUA 5FA6A 4EB6A 4TGLA 5DKFA 3DVAB 3L46A 3KBOA 1JEOA 2R7MA 4DRZA 4HNVA 4AKHA 1O0SA 4EEZA 1JIUA 1P1BA 2MHCA 3FR7A 3GJ5A 4PC3A 3SYKA 4EB8A 3UHJA 2DSTA 4HG2A 1DEKA 4EENA 1UC8A 5FBQB 1ZP6A 4NMXB 1KK2A 3TXAA 2GH1A 3C7KA 4WOPA 1FJHA 1EK0A 3R23A 2FQXA 3UXEA 1OIXA 2ZULA 3LS2A 3PVSA 3QNUA 2UVPA 2SNIE 1VB5A 2G3YA 3CB2A 4OXQA 4FEYA 5CEJA 3E9RA 3PX7A 3KKZA 1U8TA 2BV3A 5JE8A 3CVWA 1RPJA 4I1IA 1G5TA 2WA2A 4KDCA 2Z3VA 3HM9A 1BE0A 1D2CA 2CFTA 1RADA 1ZGGA 2O1XA 3K0BA 4BLTA 1QPZA 3GLIE 4GT1A 4M1MA 2FSUA 3O2NA 2CLSA 3QXJA 2X3FA 2EFYA 4HAOA 4J1TA 1LK0A 2IY9A 4KN6A 1FDUA 4CCSA 1E2GA 4NZYA 3QA3E 3REOA 2XE4A 2HYIC 2GM5A 3T7AA 4YMUA 1QHNA 1H3EA 4HDNB 3AVVA 3U5ZB 4GE3A 5DBOA 2CUZA 3RKUA 1SULA 1GQRA 3KCNA 3VH2A 4TUYA 3D54D 3GEDA 3QE4A 1E2QA 1XVUA 2ZIAA 2ZUWA 5EFOA 5HW0A 1CZHA 3AONB 5E4YA 5EEGA 2VYVA 4RUKA 1ZBQA 2YBEA 5L3ZA 3FNBA 1M8FA 2V6GA 3VH4A 1JL3A 2QTMA 3VZQA 2QY6A 4MI3A 1FW6A 2C2GA 2AOXA 5ISMA 5F9HA 4DCTA 7AT1A 1DAIA 2WHEA 3PFHA 2PGIA 1IYZA 4H0CA 4U2KA 1W96A 2JCGA 1SOVA 4HB2A 4HHEA 4RFSA 4YT5A 3EQ2A 1P29A 1R0YA 4MQ6A 4II3A 4QJIA 3ZZ1A 1WWKA 2QZ4A 3BB1A 3D8SA 3P0FA 1MIOA 3RRMA 2PKQO 2V98A 3C1OA 1ZU4A 5G1NA 2I5PO 2O2YA 3OZVA 10MHA 1H5NA 3OFVA 4P8RA 3RSOA 1MV8A 2CXPA 4H08A 1QF6A 5DNVA 2BHLA 1ZINA 1YE5A 4EYQA 1DWOA 1SURA 3O82A 4IJVA 3G0HA 1Y1PA 4H6PA 4NBSA 3ZHSA 1NSYA 4J91A 4DG9A 1ZRNA 2IEYA 3PIIA 1Q7RA 2EWWA 1A82A 2B9EA 1I10A 1B7GO 2WD7A 4KK4A 3RYCA 5L6LB 1PL0A 2I9KA 5M3BA 3V5NA 4KR3A 1LDNA 2IF2A 4WIAA 3AMVA 4Q39A 2FFQA 4YHBA 1T1SA 4I50A 1COWA 3O8QA 3CTPA 2GKGA 1N2ZA 1R3DA 2XWSA 3DV0A 3RFXA 3HJFA 2FWRA 1Z6YA 2JLXA 3ZKWB 4EQ6A 4YV7A 3REQA 5JLJA 3HJAA 3O4FA 1M54A 2ZBDA 1ODTC 2CK3A 1M8PA 2X3YA 3OFNA 1RRVA 3DLTA 4CLHA 2Y3IA 3NVAA 4JVOA 2ECKA 5C8YF 1X39A 4RVHA 3CR8A 1IOWA 3GFQA 5C46F 3UWSA 5AW8A 2QSZA 3I01M 3RABA 4H17A 3FOAA 3SYRA 1NMEA 1E1MA 4N47A 4A3SA 5BNIA 2ODQA 3IQFA 1QIGA 4KW7A 4L5AA 4U39A 3UFBA 3DL4A 5HEKA 1FSPA 1SKYE 4Z3DA 1UBLS 4ZP1A 1V96A 1B6GA 5H82A 1DC4A 3QKTA 1MFPA 4ZVMA 3IV6A 4PAOA 1P2GA 3KQLA 4R6WA 5EE5B 1PFWA 3I39X 2AEEA 4MK4A 3QVMA 5HM6A 2CKDA 3P26A 1CQPA 1M8JA 5HIAA 1U90A 3B6JA 4NEHB 5B12A 3LKZA 1AQIA 1TNDA 2LBPA 3OG9A 3NHFA 1PJTA 2KWIA 4FMPA 1Q1QA 2XTMA 3Q5GA 5AK6A 4YMHA 2WWFA 3P0EA 1XMVA 4K9RA 3ER9A 4KI7A 4WXRA 1TM1E 4J3FA 1UKYA 3ENVA 3N3AC 1EDDA 2EFDB 1I32A 2R8XA 4BVKA 2PO7A 2XBMA 1DO2A 2PQ6A 4ZK2A 4QE3A 2PT9A 1PZGA 1Z16A 4AN1A 3W6OA 5HGXA 1VBFA 2D3WA 2VF7A 3MNFA 3PHJA 2AMYA 1B93A 2BR4A 2CLFB 4JP3A 4DLAA 2HIGA 3WJ1A 2GB4A 1M73E 4FYHA 4AP9A 2O0JA 1JSLA 3Q8XB 2OHVA 2NYRA 2QN7A 3NTOA 4H6XA 3G8CA 5P8WA 2IHKA 2VZ8A 5ICEA 1QOZA 4L4UA 5IFKA 2XTZA 3U09A 2XBUA 2RJNA 1WD5A 2UUPA 3VZCA 4BFUA 1GUAA 4FGJA 4LXYA 5FBWB 2EX0A 3M7IA 3FLAA 4G2NA 1EVQA 3BE8A 4MV3A 1M75A 2AG6A 2JGRA 5LBIA 1UFVA 3C3BA 4XFJA 4A8TA 2HZ7A 5KWVA 1CP2A 1PL6A 2CXXA 4QYIB 1JEDA 4WH0A 4JI1B 4FMCF 3HS3A 2X22A 3SKVA 1HY3A 2NO6A 4IOLA 2GXAA 4LNUB 5ICSA 4JGGA 4DVGA 4IQFA 2C77A 2C3OA 3OCCA 2CXSA 1X7HA 3QUAA 3DONA 1M83A 5LA6B 1RQLA 3RU7A 2VRNA 4EUHA 2XUAA 3WGHA 4BNGA 5C5DA 3L9WA 5AICA 4J8PA 2AHOA 4UAGA 5TSDA 1O7JA 4IGFA 3N5CA 2NXWA 4IIEA 1JKXA 2JH3A 1XNHA 3OZEA 1CUSA 2Z0MA 3EOZA 1UH5A 3TUJC 1Y1LA 2RB5A 3A36A 4DSNA 1PDOA 1GYRA 2BTQA 2HJSA 3OTIA 4M46A 4U3JA 3RS2A 3VSEA 3FI9A 3ICVA 4ZCLA 2R44A 1EX6A 3S2EA 5FAKA 3U40A 2H1IA 4A2WA 4ZCTA 3D7RA 1YZUA 1Z4KA 2YJNA 4UM9B 1FMJA 1VPWA 3ZWNA 3DD1A 1TL7C 1K5DA 4KQCA 3C41J 5CPFA 4IYJA 5CW1A 4ZVTA 1V2GA 3WMFA 4ZVLA 4N5MA 4GP7A 3WIVA 2ANBA 1X14A 4Z1MD 3GGPA 3CWZA 4D9CA 4XUGB 2Z8ZA 5LU9A 1SUCA 2J3DA 2LZ0A 3G5AA 2XNCA 3N2NA 3KB6A 4P80A 3SBOA 3NX4A 5E2AA 3FWYA 3S3TA 1KDOA 1PGQA 1Q7BA 4NCKA 4ZZIA 3C7AA 1PWYE 5G4KA 3L0ZA 3R3VA 4M0KA 3T34A 4BJ5A 1GKLA 4DGSA 4OXYA 2AZDA 1HGXA 1YWGO 3GPBA 1O6GA 2DG2A 4FR0A 4FWBA 4X85A 5KYXA 3W5IA 5J2TB 3E22B 5CDUA 2XQKA 5FTWA 2M98A 2VDPB 1UMKA 1Q50A 5J4VA 2E5LB 4P4GA 1BHSA 3SZMA 3E4CA 1DLJA 2E3JA 3GBVA 5J2UB 5GZ3A 2O8DA 1XZDA 4DCVA 3P96A 2OHXA 4LZWA 5EFZA 3MWDA 5AT1A 4EF5A 3ITNA 1FSGA 1QDUA 3C1TA 4GI1A 5AVTA 3BWEA 5ITWA 5DGTA 3L4KA 1QNLA 2HQOA 2COKA 3O95A 4LJSA 2YNMD 2YZMA 4ARUA 3O8OA 1OTXA 2JFZA 2CLCX 3COSA 2WMOB 3IESA 3N8KA 4Q19A 2W2NA 1LJUA 4J6FA 2ZWVA 4MWBA 3RSFA 4MQBA 4ZALA 2R6CA 4F2HA 3U26A 2DLNA 2E37A 5CYPA 1WBBA 4INAA 3KTDA 4C7BA 3OKFA 4CE6A 3A2LA 3CRVA 3X44A 1OILA 1N9GA 3H2IA 4LG1A 2Z2XA 3ZDYB 3ZV4A 4QVIA 3Q11A 4LHZA 1DNPA 1KQNA 3IP3A 1PZXA 2BEJA 3L0DA 3N6VA 1ESZA 3Q7PA 3HXQA 1XHFA 3EODA 1C7RA 1XK7A 2XOEA 2AMFA 4PHGA 1OFVA 4US2R 1F14A 2WU8A 4FEEA 3RPEA 4M60A 1Z0IA 2II6A 4ECAA 3LT4A 1ETHA 2DX7A 3OC6A 4FR5A 4OHCA 4P81A 3T1QA 4P7KA 5IN5A 4BB6A 5SYNA 4L6CA 3VU9A 2HCJB 2CB9A 2QY9A 3EVTA 4MP3A 5DN6A 2JHCA 1NTOA 3CY6A 1E2FA 3RFUA 4ARZB 2QG6A 2YIDA 5AW9A 1QCZA 4XIFA 1K9VF 1IXSB 1WCIB 5ALYA 1PN3A 1PE0A 4JJ4A 4S1WA 4G0OA 2X3UA 1KZ7B 4MO2A 4TWIA 3K0AA 1TEXA 5KX5F 3F6BX 4Y2TA 1FY2A 4R0MA 4KL8S 2QV0A 4BXOA 2ENWA 1NPYA 1JXMA 3CXUA 1N6NA 4H3SA 1PSZA 1UFRA 4PG4A 1VDMA 4Q7JB 4UZEA 4TQ9A 2QXUA 1ZXLA 4KQIA 5HKKA 1LI4A 2JEOA 2O7VA 4OP2A 3H2HA 4WZ6A 3HZOA 4WLUA 3AIOA 1IBCA 3ZGXA 3DLCA 3OOYA 2RE8A 1E1CA 1GPJA 5EPOA 2VLIA 3E9YA 1YXMA 5E4JA 3A4IA 3VO1A 3ZWOA 5K99A 1LTQA 2ISSD 3OUUA 4YAIA 1NOIA 3NTRA 3S4YA 4FJ0A 4DMKA 1TYEB 1K7SN 1YMUA 1RPAA 1EK2A 1SVKA 2R8EA 2WABA 2FX3A 3BWXA 4GPD1 4OU5A 5L7YA 2G1KA 2GJ8A 1WZCA 4XXHA 4MR9A 1QR6A 2OILA 1V5WA 3TDKA 4CM7A 2ERYA 3A3OA 3WLRA 1E4EB 1UUFA 1N36B 2AXEA 2HHLA 2TRSB 3COZA 3PX3A 2ZQ5A 1WMDA 5FX2A 3EXHB 4BLOA 5CYGA 3HYNA 2BEVA 3KAQA 4HO1X 1Z4PX 4D0RA 1NQXA 3C4JA 2XYGA 5IAJA 2EBHX 5AJYA 4CM9D 3QKSB 4D8TA 5CDHA 2NU6B 2R7KA 4X6XA 5CJ2A 4Y6GB 1SXGA 2R1VA 3RTGA 5KYUB 1TLLA 3WJ7A 3PR1A 1I5EA 3SNHA 3FBWA 1QAMA 2O2HA 1PJRA 4UOZA 2IBSA 3DZDA 4RJTA 4LYHA 5KOHB 3B36A 4CUZA 2Y1GA 4DADA 4UTZA 1X92A 2Q9AA 4FHZA 4WA7A 1ID1A 4U2GA 3L1VA 4ABYA 1GZVA 4Q9LA 3M49A 2WWHA 1EFRA 1K7FB 2W6JA 4R84A 2JRLA 3Q9NA 4WOBA 4IX1A 3JXEA 3UJBA 1GSOA 2PLNA 3EZGA 2KHZA 4Q15A 4RLSA 4S1VA 4MR7A 2I6TA 2XUJA 1XKTA 3SEFA 1TAHA 4J6EA 3W6PA 1GG5A 1Y80A 1BGVA 1G98A 1Y63A 3CZPA 4KE6A 3I37X 2RAPA 3RVRA 2BZ1A 1ZUNA 4YLEA 3DZFA 1IQPA 3QJ5A 1BXZA 2HU7A 1IOZA 4RETA 1B6SA 4NFSA 3D4OA 2GZ2A 4I81A 5AXDA 3T95A 4KXUA 1FFCA 4C3ZA 4E4YA 1VOTA 1KERA 3U3OA 1R66A 4BMYA 1BKDR 1CE8A 1WKVA 2I4TA 5T3UA 4ITUA 1KKMA 2RJOA 1CXZA 1W94A 4KTTE 4GNRA 4ZQCB 3Q87B 4KO1S 4EGJA 3B1JA 5FBLB 2QRJA 4FCWA 4XIYA 4MQ4A 1E2KA 1GTL1 3SQMA 4TKVA 4B80A 3M4XA 4NATA 5CRIA 2FP3A 2BMAA 1ULSA 3V6LA 5JY1A 1KMCA 4LKOA 3W5CA 3RKRA 4Q93A 4J7AA 4CKCB 1SG9A 1ZY2A 1TYZA 2KBFA 3L07A 3WK9A 1PW5A 1L3IA 1QE5A 3KOMA 3QM1A 1H1LA 1ZVMA 3F8SA 3LT0A 4GPEA 1GQSA 4RF4A 4BDSA 1J2RA 3FPSA 4I3GA 1I2AA 3WKCA 1TUBA 1JYFA 1EINA 2PUTA 5F3RA 3R24A 2O2GA 3KC2A 1WLSA 2DHCA 4MDHA 1RXWA 1AUOA 5CB4A 3DFZA 3ILSA 4YRZA 5CFMA 1FS5A 2D8MA 3G68A 4PLCA 1C29B 1RFLA 3FPGA 1MP0A 1YD7A 3SF8B 3IUPA 3H2JA 1HZJA 3Q3HA 4RGYA 4JYZA 3RAFC 3JQRA 1FJXA 4GMXA 4R2MA 5H9VA 5BYBA 4NH4A 4PFSA 3U17A 3LDHA 3LW8A 3W5DA 3G2LA 1HDYA 2YNMC 2DJ5A 4GYJA 4BPBA 3QUTA 1FYXA 1U2ZA 2UYYA 1WUJS 1SXJB 4UDOA 3NHLA 1P9WA 4R1MA 3NBUA 1UQTA 4UPDA 4QZVA 3PEUA 5JXHA 4CKXA 2WP8J 3OF3A 2OA0A 1OBHA 2BTQB 4TLMB 1YK1A 3QXCA 4LJRA 3ZHOA 1GEGA 1HQDA 3AHHA 1JG1A 4RWZA 1I3CA 1NE2A 2BEWA 4OAQA 3SIWA 4DR7B 3MPUA 5H5JA 3R5JA 2XB6A 5AM5A 4O02B 3RGWS 4DIEA 4ZO4A 3ZXSA 1ZL0A 4D3XA 1N34B 1TT5A 3IDOA 3OIFA 2RGDA 5ER6A 4W5QA 4X3OA 1EBBA 3MEQA 1Z68A 2YW9A 3WNBA 1ZW1A 3UJ6A 1OA1A 4XUEA 4YMWA 4QG3A 2W6ZA 2F1IA 1E6LA 2JJQA 3PEYA 3GP3A 4GD3Q 1RJDA 2RKWA 3C14C 3ETHA 5KNCH 1NTRA 2WYVA 5FUQA 4WLVA 1PR6A 1UT6A 1Z6QA 1MAVA 3A6FA 5JAQA 4BZZA 1UL1X 3ELYA 5TPZD 3V1NA 4CFZA 2PD3A 2C95A 3JQEA 2G77B 2VI5A 5CGQB 1ULTA 3IBTA 5FNVF 3TTYA 4PXSA 3NJ8A 5J2TA 3TBKA 2ZYUX 4FE4A 2FZWA 3PJFA 1IXZA 2P27A 1MH9A 1V48A 3NUGA 5DYGA 1SELA 4GZ6A 1EE9A 2AJDA 3LKBA 4ZCPA 5JD6A 5KNDA 2B82A 4M7RA 3Q98A 3DO6A 1L1FA 4YRAA 3T5GA 4BLUA 2PGLA 4EAQA 4HTAA 5LQSA 4HUJA 3LCMA 1WBDA 3GJXC 4C4PA 5BWBA 1RLMA 2P8SA 5DNUA 2Z9BA 3AI1A 1GNQA 2WIGA 4EKIA 3ESXA 4G36A 2QD2A 3BFPA 1LK7A 1MOQA 2OC4A 1C7FA 2EX4A 1J1IA 3OX2A 4DG5A 4DQLA 2V7BA 3PNKA 4E30A 1VRCA 4DR2B 1QRUA 3EG9B 2FDRA 3BIWA 3DBVO 3VYUB 2GNAA 2P35A 1LB1B 1PNQA 1HDGO 5ALHA 3OQPA 4EKYA 1MTOA 3GUHA 5EHNA 1NW9B 1C14A 2EFCB 3P5SA 3MW8A 1AQYA 4ZVPA 5T4EA 4EPYA 5CNJA 1L4YA 4I8DA 1B0ZA 2ECQA 2HBRA 2OQIA 1IZYA 3RTAA 1KQ3A 2HDWA 4BX2A 3PUWA 1YO6A 1TU0A 2AMVA 4CMAA 1LV7A 4G63A 2BBOA 3RT1A 1HFJA 3BORA 5T3YA 3SXUB 2I78A 1X86B 3JQ6A 3TW4A 1SK8A 1MEOA 3CX8A 5JVDF 2WICA 5KKNB 1T0BA 3A4TA 4TQUS 4OQQA 2RGYA 2AN3A 4WESA 4YMIA 5HF8A 1FSFA 3N76A 3HVHA 2XYHA 3PA6A 4BE4A 2BHNA 5IBCA 4L9SA 4J7UA 3EZYA 1QIEA 3DYIA 4UUOA 4FT4A 5K8UA 2PGAA 3T3GA 1XBTA 4G0UA 2UUAB 4IIBA 1CV2A 5ES4B 3IIEA 1EWKA 2V3WA 3WIOA 2AVNA 1CY4A 4YH1A 4WN3A 2HF8A 2VDOB 5ALXA 1X1AA 3T35A 5ENZA 3JQGA 5U4QA 3PFFA 4FDAA 4HX2A 1WXIA 3GP5A 4IIJF 2NU7B 1RQNA 3MB5A 4O4HF 4DJEC 1FP7A 4X1YB 5KCMA 4H7FA 5JC1A 5LZ4A 3NJRA 1WCYA 4CKEB 4EHIA 1LBQA 3RREA 3E48A 2JIRA 3KL2A 1Y3FE 1PGPA 3K6JA 2F7SA 3C6YA 4FOSA 3IYLW 5C31A 3DTVD 1NUPA 2JFXA 5DWVA 2GK7A 2VNJA 1T3TA 3UCEA 3OJEA 1FNNA 1I01A 1R6UA 3DKVA 5D86A 1GXSB 5HQ3A 5AJWA 3AR7A 2DE0X 2HUPA 4UBKA 3PL1A 2GPJA 4OTZA 3NGLA 5CLLA 2OXTA 1ZNZA 5TGTA 2BI8A 4A1OA 3T9DA 3L41A 1II8B 2X4DA 3VOTA 1C1DB 3ROPA 3TJZA 2NU6A 1NBIA 2I1LA 3MBIA 4YCLA 4LI3X 3ZJ5A 5KX5B 1YB5A 2CNDA 2JI9A 2R1VB 2ZJ4A 1UBRS 2HNKA 2DKFA 1CLUA 2Q8PA 3L0YA 2J9RA 1FDIA 3ORSA 5ITZB 1M6NA 3LYUA 2FEKA 1ZHHA 4I55A 3H0EA 4ZVSA 3ZVKA 3G2IA 4EG0A 5AJTA 2OLKA 2PN1A 3E9QA 1TKRA 3CZRA 2M32A 2FW1A 2J0UA 4LJYA 3GLIA 3M4YA 3KYIB 2HA3A 5ALQA 1EDEA 5AM4A 4P9NA 4UTPA 4ZHSA 2RBEA 2WF6A 3FD8A 1XMIA 4X8MA 1JQEA 2WHPB 2EFHB 1KPIA 4LBYA 4BB0A 5COQA 4BC0A 4CN9A 2Y2UA 2IZ6A 1LF0A 1JFTA 3D2AA 2QTVB 3S55A 1YQDA 1JGTA 1Z2AA 2L2QA 2VSQA 1PR0A 3IIMA 3JATB 2DPMA 2AN5A 1FTNA 2JGKA 4QAJA 1E7WA 5T5QA 4DY6A 5JTTA 5LWQA 4N76A 3B7WA 4U9IS 3WE7A 4QEKA 2R1TA 4BTEA 3TGLA 3R09A 2AG0A 3TEMA 2ONYA 5SZKB 4WZAA 3VV2A 4YV1A 5IT4A 3O75A 1Q77A 1KVRA 3LQ4A 2NP7A 4UNNA 4LE2A 3BIOA 4F06A 4EP1A 4M7OA 3UWPA 4K28A 3OPQA 1IY9A 1RAHA 3EX7C 3C1UA 1O97C 4JCOA 3DMRA 3V8NA 5AVZA 2EP7A 1G5FA 1M2KA 2X5NA 3DHVA 1TCVA 1NYLA 1U7XA 4TKVB 1KZ9A 5HKBA 4Q3BA 4NLLA 4FPXA 2XQIA 1WA5A 1E9EA 3O21A 4BUJA 3O38A 2FMFA 2REQB 2BM0A 1U8UA 1KI4A 2ZJBA 4N9QA 1P2VA 1QRDA 4PSUA 3SWWA 3FOZA 2YVKA 3FNEA 2ZK7A 3OTQA 4KQHA 3D6AA 2YV2A 1SVWA 3KUKA 4KQEA 4KE8A 4YQZA 3IEKA 1L5HB 3ZI4A 1AQJA 3ADKA 5CDTA 1KBZA 1TGVA 2YWJA 1F06A 4JA2A 3UV7A 1QKJA 4B3FX 4C0LA 3HI6A 3R76A 2WE8A 3KX2A 4QXQA 3K9QO 1VKJA 3DNFA 3V2IA 2BFWA 4XAQA 2HQRA 1Q57A 2C31A 1G8SA 5FFNA 3AKDA 1KH3A 3IMFA 3B1WA 4KQ2A 1ZH6A 3HUDA 2IYUA 4QPNA 2XUOA 5TIIA 1QHEA 3VR2D 5TPWA 1MXFA 3B9PA 3ZZUA 3QKWA 1YDGA 2VEDA 5K3DA 3ZZ0A 4B2IA 1L7OA 3D4BA 2EGUA 1EI9A 2FSSA 3TSAA 3AEXA 4WERA 5F23A 1M2JA 1V6CA 3OFSA 1P6QA 2FUCA 2DWUA 4DLKA 4RZXA 4M6WA 1LQ2A 4WMLA 1KEEB 5HJ7A 3T1YB 1Y6JA 1GL6A 1L5QA 1QLWA 1X15A 1XWIA 2X6TA 4L22A 3S2UA 2FZVA 1EUQA 3NTXA 2HC9A 4MLZA 4RHXA 1A9TA 5DP1A 4OI2A 4AO8A 5E6RB 2OGSA 1TB4A 3N3BC 1QANA 4HFRA 2LCQA 4A23A 5GGXA 2PYIA 4J75A 1D4OA 2H57A 1V11A 1ECJA 4FQ5A 1M6VA 3TR5A 3U0BA 1OZAA 4XWWA 2P3QA 2OGZA 4QRDA 5MGNA 2FKAA 2DLCX 1YNSA 5COAA 3SZLA 1I0LA 1NN3A 2O4UX 3MQ4A 5LQAA 2HZBA 5FUVA 4B46A 1AUVA 1RBZA 1OYYA 2VK2A 1W7AA 2EKQA 3D8UA 4IIJB 4GM4A 2XQFA 2ZSHA 4JLWA 3QXSA 2P3LA 4NJEB 1N7HA 3VZBA 4BNYA 2QVCA 2O8CB 1SPXA 4U8HA 5BVGB 1E69A 2X1MA 1PYDA 1B3BA 4LNAA 3T9AA 1MR3F 1AVTA 4XYBA 2ZPUA 2LKCA 1NW3A 3AETA 4ZI7A 4F3NA 221PA 1ECBA 2V7UA 1E89A 2E5WA 4GVLA 1Z37A 2IW3A 3H2BA 4INOA 2MYTA 3H6KA 4UEKA 1HLGA 1L5WA 2FSVA 1JG3A 4O29A 3GLQA 4DL9A 4YP6A 3TLKA 2L17A 2YW2A 1CEYA 1H0RA 5F7OA 1W35A 4CV1A 1XCGB 5IJZA 1D0IA 2QD1A 1Y8QB 3K1TA 5DMHA 3E18A 1B8PA 4RF5A 1IZ8A 2WWXA 2ZPTX 4JJIA 3FPHA 1XD9A 3UMJA 1BYUA 3KZKA 4LZOA 2VTEA 5FBRB 3QSGA 2FW7A 4KIJA 2ZB4A 4RPJA 3T7IA 3JVUA 3VV3A 3R75A 3DHYA 2NACA 4Y9UA 5LP6C 1RPNA 1VIVA 2GBLC 4D97A 5K0CA 1F3LA 2R84A 1USGA 3FZGA 4NONA 2EZTA 3FGPA 3FXAA 4LJ6A 4UM8B 4Z4FA 5B4TA 1PEAA 1L4HA 3OZGA 4P0TA 2VUUA 3CEPB 4RC9A 3RAEC 1G8AA 3A9WA 1UM9A 3I01A 3WNCA 4DPMA 4E2FA 5I6DA 4HQRA 3AF1A 3RNOA 1NLYA 1DJOA 2F4VB 3JQ7A 2YC2C 1EQAA 3F9RA 1VL0A 3MOSA 3R5HA 3CGWA 4LV8B 3ROXA 3ESRA 1P8JA 1XMQB 1PVDA 4UEQA 5ALDA 5BO5A 5HKOA 2G7MC 3FRJA 1OAKA 2PWBA 3O5AA 3QX9A 3EG5A 1ISJA 1YSCA 2QQFA 2GCOB 4WK6A 2JFVA 4D5EA 2YVUA 1T9AA 2ZWAA 4ASUD 1XZIA 2V3VA 2IYAA 1R9NA 2ZYAA 4O33A 5GJWC 3RK4A 1WXFA 3TKLA 4QX6A 5J23A 4ME6A 1GLGA 2WT9A 1GAJA 3V6MA 5JCJA 2AQKA 3NCHA 4DLSA 2I6UA 3DE4X 2YQ4A 1JG2A 2B78A 3KJNA 4YC7A 3WI7A 4F3YA 4K9DA 4L5CA 3GCGA 1EP1B 3SZUA 4HVLA 1VXRA 1N6LA 1QUFA 2A9QA 1RBYA 2WT4A 4IJKA 4PZYA 4R1OA 1RAFA 2XUHA 3MGBA 4FGUA 2D2XA 2PPVA 1XN4A 2J31A 3O4JA 3M4JA 4MR8A 2AW5A 2C2MA 3KB8A 4U7WA 3MT0A 2QMQA 1N2CB 1L3BA 3TTTA 3EPLA 4B4KA 1Y5RA 3FAZA 4ILKA 2Q4DA 3WDSA 3ZD6A 3KSMA 3F98A 1T6BY 1LVHA 2EIXA 3B1KA 4OHUA 4PAQA 3AVQA 4PTLA 3Q3GE 3ZBPA 3W7AA 2WIJA 3HCCA 2B34A 1E9VA 3KDSE 2ZETA 2YWEA 2MYPA 4GIBA 3R3UA 2VNHA 2XVYA 3I9JA 3KXLA 4H3HB 5JYEA 3TTWA 1QFYA 3UWMA 5IWCA 4BEVA 5JFOA 1H2BA 2WF5A 4FLFA 4GLLA 2Q1UA 3JTMA 2PZJA 3A4VA 1RZ3A 4OBXA 4IQGA 4MPJA 1G6KA 3GGDA 4Q1EA 3ENZA 3PC8C 1EVLA 2C58A 3FCXA 3KQSA 4QTUB 4TVOA 3RUDA 2H3HA 3RTEA 1SD1A 3U0VA 1HOXA 2QF7A 4P54A 3SEQA 1M10A 2OO5A 2JD1A 1JJIA 1QX3A 2GZMA 1SCUA 3CWCA 2ZJ1A 3GDGA 3K09A 3OJOA 4FN4A 4WCFA 4F4CA 2VUHB 1JX6A 4G3XA 4KMOA 1EQ2A 2QX9A 1J8VA 4KQFA 5LP6A 1C9DB 4XOIA 3DL0A 3TOZA 3WRWA 2BZ0A 3OPYI 4DT1B 2QJFA 5AM3A 5FAXA 1T36A 3AERB 1IHXA 4GLJA 3F90A 1QE0A 2ZVQX 1JJBA 2L18A 2J0UB 3PQDA 2FG5A 5FUWA 1K6JA 4ZCRA 3HCBA 2Z95A 4A6XA 2IPLA 3O94A 5IJ9B 1O0BA 1GLVA 5L7WA 1V8ZA 1UJ6A 4MULA 1Z7YA 5FOTA 2LNDA 3HDTA 3JALB 4IHQA 4MQEA 4B6OA 4YRDA 4MROA 3JQAB 3DJYA 3TG2A 1JKJA 1I4DD 4JOBA 5EWLA 2ID4A 3WL7A 1QUEA 2JZOA 4KUHA 4I14A 4AF7A 1WXQA 1W0KA 3EMDA 2YNMA 3AO0B 4Y1RB 1E4YA 3NPAA 5IVDA 2R00A 5CA0A 3RF6A 3ZHRA 1GRNA 3AVYA 3RIHA 5IK2A 3RC3A 3O3MB 5E9JA 5H80A 3GNLA 4Q7EA 1ZH0A 4AX8A 4D0LB 4QM7A 3SZRA 4ZHQF 5DNCA 5KTPA 3HDJA 5I9BA 4CM4B 1EFPB 3QVVA 4DNFA 1L7EA 1NQTA 5EIBD 3JU3A 2VZEA 3IPXA 4NU5A 3HFJA 2FEOA 4J90A 4GMKA 5DSZA 3SJCA 1JEQB 1CR0A 1L5YA 3O6VA 2E7ZA 5BUZA 3OMLA 4X1KB 4XWYA 4W9MC 3FKQA 4GVPA 5K8JB 5KC8A 2ZUEA 4LXGA 4Y6QA 5A7GA 1IPHA 5HIJA 4Q03A 5KHAA 4QHSA 1L4EA 2X86A 2XUKA 1TVCA 4AX4A 5E7IA 2GN8A 2W2LD 3D8TA 3MCWA 4EMSA 3AEKB 3ETEA 1M2FA 2VRBA 5A3QA 5L53A 3H9QA 3C3KA 2EJVA 4C4AA 4Y2JA 4MI9A 1TC1A 2P3OA 4RF2A 4EF6A 5AW3A 4Z4GA 1U9IC 4LY6A 3GU3A 4MVJI 4RQUA 4LFBB 2CZGA 3UJAA 3Q7EA 2KPOA 2H2IA 5CIYA 4B8YA 2V54A 3H97A 3WYFA 4KLRA 4KR7A 4Q6BA 4V24A 2A5GA 1KFEB 3A3YA 5SY6A 4NZNA 2HA6A 5EP3A 1WG8A 3ZKWA 3REQB 2QB5A 1FFAA 4EQ6B 4NBTA 4B34A 3M70A 5E1OA 1YJBA 1QS0B 3BSWA 3O8DA 1Y3CE 4MQMA 1PJ3A 4JLNA 4NX2A 4UEJA 1A8QA 5EJ4A 3RODA 2GEFA 5FWNA 4Y67A 3WL5A 2YJ5A 1G2QA 4L3OA 3KTAB 2W4IA 2V1UA 3MOIA 2C2KA 4IG9A 2Y9PB 1BWSA 1O4VA 1E6MA 3VZSA 1EIWA 5CH3A 1ACMA 1T8PA 3H84A 4D42A 1U7ZA 1RHJA 4KNWA 5AI9A 3TIVA 5KWSA 2IEZA 2OFOA 3JRXA 1NDQA 4RAQA 4CCAA 4REQA 1QTRA 1E1YA 1KRHA 1RVDA 2JFHA 4KODA 4P58A 4HQOA 4FT2A 3LYAA 3ICQB 6REQB 3CNNA 2FYTA 4NYIR 3MSCA 3MRTA 3IAFA 1V43A 1W30A 5B58T 4Y9RA 3WGIA 4FSHA 5EG5A 5JAUA 4A0RA 2F64A 4PLVA 2JVKA 3N05A 4YP0A 1OQAA 4ZAZA 5FEMA 2I1QA 3CQ9A 4Y6SA 4NJEA 1JBQA 4O2BF 1KJ8A 1GGNA 1SZJG 1TZBA 2C8KA 2FX5A 2VDWA 3EF1A 3G9TA 4MRPA 4JI0B 1NLUA 3NAMA 5EXTA 2CJWA 2RKBA 2EAUA 3NONA 4OV6B 2ZKLA 4L57A 1AZTA 4MI1A 4B3JA 1YS7A 3BQNB 5HRAA 5I4BA 2IHNA 1DIHA 1VCIA 4D4KA 1BCSB 3BTSA 2OHFA 1NJ6A 3ELUA 4R4JA 5K0GA 1YT5A 3VC1A 5A3JA 4FW9A 1X7WB 1B4DA 2BUBA 2IYXA 3TPCA 2QRMA 1T2VA 4B3BA 5CEFA 2IPOA 4RL4A 5IJ0B 5HSGA 5AVKA 2LDXA 3O1IC 4TRRA 3CKYA 3AGPA 1V3UA 3TQSA 4TLDA 3ABRB 1U63A 2D0IA 3OIVA 3PGLA 1I13A 3AV0B 3O4RA 1SK9A 4QUAA 5CAEB 5NULA 4B85A 4BKUA 2O0MA 2I55A 1C1YA 1T15A 2B5WA 2W2KB 1PYOA 1HYHA 1D9ZA 4OXIA 4HLQB 4K0KB 1NVFA 2GT1A 4ZAFA 4XR4A 4B4DA 1JE0A 3TQCA 3WMXA 13PKA 4QU5A 3QSYA 1SA0B 4EMBA 2IGTA 2X8BA 4M9RA 4WBNF 3VYVA 1A88A 3DE6X 4YY3B 2G5PA 3VNSA 1WOMA 4EKDA 4ZODA 3MC1A 3KELA 4Q3EA 3VM6A 2FMHA 3GLFA 1J49A 5AOAA 2W93A 3AVOA 5JSFA 4PVDA 3BGSA 3VKHA 1W2HA 4YUVA 3TTVA 2VF2A 3A14A 1M2HA 3CF6R 3FLEA 4LISA 2YOGA 1Z34A 2AMLA 3OZTA 5B3JC 2DZDA 3DDUA 2GXUA 3ZJ4A 4IKPA 4ZQGA 3A3KA 4GXQA 5ESDA 1FXSA 1V95A 4A0HA 4C3UA 1YOVB 2A1IA 1EHYA 1D1QA 2IOFA 2DT5A 1T1IA 1WRBA 1W75A 2W9XA 3KO8A 1XDGA 3TZ6A 5AD1A 5BUQA 5EYPA 4LF6B 3KS9A 1MIOB 2PZKA 2A30A 4D25A 1FW8A 1RJEA 1QF9A 2B6HA 2BGLA 3GPDG 3OX3A 1KAEA 4HLUC 4RO0A 2PKQP 4FYMA 5F35A 5TQ2B 2HU5A 4UXIA 1SAYA 3M8KA 4GX2A 3B82A 4MW4A 4U6SA 5I4CA 1Z8HA 4S1NA 1CUWA 2ZUCA 4NZ9A 1BWPA 2FR8A 4PPGA 4DA8A 1JSCA 3JQPA 1FQJA 5J63A 1D03A 1CUDA 1QCYA 4KRGA 3A1VA 4PO9A 4RJIA 3ZCSA 2O8DB 3Q0TA 4BO0A 3WIEA 4CMBA 4NESA 3OPYA 1Y8RB 1R7RA 3FFBA 4JJ7A 1V8BA 4A8JB 5DM60 3GK3A 1VHWA 1REQB 2IQIA 1V5GA 2ZI6A 2ZUUA 4EYKA 2L0XA 1HRDA 1ETUA 4G0NA 1O58A 1WABA 1YS4A 3QV1A 5CM9C 5EXDA 4BO1A 1G63A 2I0FA 4RIHA 1O54A 3TZLA 1JJAA 5JS7A 3E0QA 1LGYA 2HA5A 3MHTA 3HEMA 3TOVA 5B37A 1DAOA 5E9WA 3OTGA 3UAVA 2ZIWB 4KH1A 4D8WA 5LFAA 5AUNB 4B3SB 1E5QA 1XQVA 4M54A 3O4HA 3UCFA 1ND6A 3VGJA 1VG9B 4YP7A 1STOA 1XEWX 1GPLA 2RH4A 3O8CA 3O47A 1GN8A 5BQ5A 4DQXA 5KKCA 2XZOA 2D5LA 2QX7A 3HH8A 4MSUA 5BW5A 3HKEA 3O4VA 3E22A 4FYIA 4Q7LA 2KM1A 2JAPA 2FW0A 2KI5A 2R7NA 1OYVA 2YWDA 3OHSX 4FI3F 5JRZA 4RTPA 4ENSA 1JIKA 4ER3A 5KS2A 3C3EA 1E1QA 3AEQA 3BWVA 1VBNA 2D59A 2WYUA 1IEXA 3AEUA 3DMGA 3IB3A 3K8YA 3NAGA 4KQ9A 5BN4B 1UT5A 4KNVA 3LPCA 3CPHA 2KLBA 2O3SA 4M87A 1VLHA 4DLPA 3D7NA 3MYYA 5CVCA 1VKHA 4R1LA 5D00A 4AL4A 4RDHA 3C45A 3TAUA 2IU4A 4CL0A 1DS6A 3L06A 3LDFA 1T34A 3QXHA 2Q3BA 5CK4A 2VP2A 3FMVA 4O0LA 4YROA 1N5IA 1HT0A 5CITA 3FTNA 1K6IA 4YPOA 1FA9A 2FLWA 1VCMA 1E6WA 1S7CA 2XDQA 1BQEA 3DC2A 5JIBA 1PD1A 1U1IA 1XVAA 2NNLD 5HIMA 3HYRA 1OZHA 2ZB7A 4M83A 3ZWMA 2IDKA 1QGZA 1G5PA 3GCXA 3QLTA 2IEDA 3EFOB 1WR8A 3FMIA 2Q5OA 2WTNA 1JEEA 1ZM3A 4O3FA 2B21A 1Q1GA 1T9DA 4I2VA 1FQKA 4EKEA 1ZVJA 2EBWA 2XIJA 4XQGA 3W9YA 5I4KA 3UXMA 1FFYA 3GGCA 1Z56C 2HLNA 3OEWA 3ELDA 4OK6A 4G41A 4RTKA 3WLJA 4EA9A 1QG0A 2P91A 1S1MA 2I2AA 2DOKA 2IX9A 2AFRA 1ZM9A 2OLJA 2Z2YA 5FADA 1XVIA 4LVNA 1LJLA 3WYAA 5LL6P 2NUTB 3FM9A 3HSKA 5DASA 3UUEA 4RD4A 3WGQA 1D6NA 4R31A 5LUAA 1BO6A 2JVJA 1DC7A 2WSSA 3PICA 5FLYA 1L4MA 3PIRA 4PIMA 1HNWB 3AY0A 4JUFA 1HT3A 3IEIA 4NQRA 5ILGA 3KIPA 4GGMX 4CM4A 2I3GA 4YR9A 2F48A 3UAOA 4RVNA 2B35A 1HC7A 4E5DA 1W4AA 3R7NA 3IQGX 1CY1A 4JT9A 1VFPA 4UFNA 2YUTA 5I5EA 4CG0A 2IIQA 3AEZA 1NGSA 1NA5A 4QUEA 3G79A 1QHXA 2VH5R 4BLPA 3AR3A 4QARA 2POQX 3WY9A 2HB6A 2X5KO 3QHQA 2VHZA 2QN9A 5BWCA 5GGYA 5C5CA 3GFSA 2YTZA 3E2PA 1TKBA 2XMQA 2D06A 2AN1A 2Z5LA 4EFLA 4EGFA 2I7CA 4MUNA 4EPRA 2V7XA 4I1YA 3UH1A 1SIBE 2I22A 1ZFNA 1WB4A 2PFSA 3GWZA 4PFQA 1KU0A 2XKKA 1J23A 1N1DA 1PWXA 1RTTA 1KYXA 2FR1A 5DHQA 4CQMD 2MINA 3K32A 5FBVB 4UREA 1RWMA 4YMLA 4B3MB 2J87A 4B4UA 3K8QA 2O2ZA 2P9YA 1X7ZA 4Z8YA 3DUFA 3C5CA 4AYWA 3AJ8A 4H35A 4BUCA 3OQIA 1GQFA 2IK8A 3RIGA 4W8HA 4GM1A 3AHIA 5D87A 5KYVA 1GRVA 3D02A 2EKZA 4Y2SA 5IN4A 2XXBA 2ZI3A 1MX1A 2B1JA 2X0FA 4JYMA 4MGIR 3U61B 3QY9A 2BP7B 2ZM6B 1QH0A 2KS6A 2VQSA 2XDYA 3DBIA 3LX8A 3VDXA 1M2NA 5JATA 2ONKA 4MUBA 3TXYA 2N3ZA 1FBTA 2RC6A 4GOOD 1XZAA 2YC4C 4JXJA 3GUZA 3HJRA 3W05A 2C20A 4KFUA 4TYNA 5CDYA 4JLDA 4UBIA 1H2FA 3DTTA 2G63A 2VPPA 1ZUHA 3DYBA 2XE8A 3EGXA 3PPIA 5GOTA 3ZLUA 2J5XA 2D1YA 4MRMA 2P1ZA 3G85A 4Q4DA 1RXUA 4N7BA 3A9UA 4QJ3A 1ZGAA 3WKEA 2MMGA 3IKLA 2AIRA 5JNLA 3DAPA 1JMKC 1RPZA 2QX8A 2VZLA 2WPDD 3C4QA 3EYAA 4JX8A 4TKMA 4P3KA 1UZMA 4DB4A 3GX1A 4OFXA 4YJ3F 2GILA 1Q7CA 2JLRA 4UUAA 4TMVA 4UU7A 3HFGA 2JGMA 3HXKA 3DEHA 4PZPA 2H2DA 2O8FA 2XD9A 5DYTA 3PXXA 5D3QA 1LLDA 2QVGA 4N3AA 4Q37A 4AIRA 4CTNA 3KCQA 3PGKA 5B58C 4KBYA 5B3JA 5BRAA 2IXEA 3REGA 2XCOA 1W4RA 3EULA 5EJ8A 4BGEA 2K7ZA 5KNCA 1EUZA 1X3LA 4TV8A 4EHKA 5MN4A 3L92A 1D1SA 4FX2A 4IILA 3U7QB 3WGNA 2OWEA 3MD9A 2ZUSA 1TEVA 3BBLA 1R0WA 3FKSD 2YWRA 3IBSA 1E5DA 1EMDA 4I5IA 2HIMA 3AXTA 1ZCJA 3CU5A 3L0BA 4HYEA 4K8OA 1LV8A 4Y2XA 5DHAA 1YASA 4J1NA 5KU1A 3CIOA 4PG5A 4NAUA 1C4KA 1WHSB 1L1QA 2AJCA 2GR9A 2PCLA 4BGIA 4AQDA 2ISQA 4HYQA 1I24A 1KJZA 1Z25A 4AURA 2PBLA 2PRZA 2XHEA 3NWPA 4KITB 2FQYA 2PUWA 4TWBA 1OC2A 3K2IA 1OFTA 1OFHA 4FEGA 4P35A 1PJCA 2XCLA 2YYAA 2M2IA 2XDWA 2J1LA 4P84A 2V58A 1QFMA 2Y1KA 3F74A 1LD3A 4V3CA 5YASA 3FOEC 1DG3A 4DYDA 2WQ6A 4NIMA 4JCCA 3K31A 3K73O 3SDZA 1NAIA 5K01A 5DDIP 3BGIA 4MWSA 2A3NA 1PTKA 4JASB 3E8SA 4YAOA 3TLBA 3FCAA 4DRXB 1SC6A 2W42A 5IMBA 5JALA 2BLNA 1JKFA 3IAM6 2BEWB 3OUTA 1XQWA 4MPDA 2WJYA 4PRLA 3OA0A 4JOQA 4F4HA 4B75A 4C7JA 2FPOA 5FTJA 1UMCA 3F5SA 4Q24A 3ZV3A 3UA3A 3GDOA 5C7YA 3WQRA 1ZKDA 3DH0A 1C41A 2DGDA 1LSJA 5IVKA 3OOEA 4LMAA 4UHJA 3WHPA 1GZ6A 1J90A 1NRJB 2OK7A 3HBJA 2DERA 1JXAA 2V6MA 3VZPA 3ZQ4A 4G0YA 1XC7A 1XB2A 4J07A 4ED9A 3UCXA 4FFDA 4KBFA 2IYNA 3W8FA 1H8HD 2P90A 3DB2A 2CE7A 4HQKA 3I8OA 2ZRGA 4FE7A 1C50A 2OZPA 5E1DA 3T5DA 4O3MA 3VOAA 4LZAA 4DLWA 3HM2A 1IHUA 4M0FA 3JPYA 1KRWA 3D1JA 1VLQA 4GMFA 5U1PA 1UMDB 4HADA 3X2FA 3LU1A 3ZXIA 2W83A 1NQWA 1TTHA 1UBUS 3SC2B 2WHRA 5ALNA 1Y8RA 3JWJA 4RSGA 3ROFA 1W5SA 4E5SA 4EA7A 1QZUA 3TLGB 4QUIA 5I47A 1Y33E 2H3EA 3NIGB 1KOGA 4KGXA 1J24A 2ACKA 3TB6A 3V4OA 2P7HA 3RVQA 2R2AA 4RM3A 2GO1A 3EDOA 4UC0A 5JASA 3SYTA 5MHTA 2AUMA 2JA1A 4JAVC 2W0SA 5TMPA 4LQCA 2Z9CA 4Q9JA 1RJGA 2MYNA 4GEGA 4RY2A 4MV8A 4CF6A 1ZIOA 4UNQA 4YJ3B 3JWEA 3U1VA 2FQ1A 3PQ8A 3ABIA 2OORC 5IVIA 4NBLA 4JHXA 4QOEA 1E0SA 2VOEA 2I4LA 1SC3A 2V7VA 2NXCA 3R7AA 5JJKA 4F3TA 1IZ7A 2VBGA 3DCNA 3NYIA 3PS9A 4IIXA 5JI2E 3THWA 3WGKA 1Z2CA 4KPUA 4XOUA 3SMVA 3OT1A 1QSGA 1V5IA 4DJFC 1VL8A 1XN1A 3V7YA 1B1AA 2MSLA 4BAUA 4HGRA 1E3DA 3B38A 1YKSA 1C7QA 2AJBA 1JN0A 1P73A 1UCFA 5HF6A 3C15C 3MMXA 3W8RA 4W5HA 1E2HA 3NFYA 1KQFA 3NTQA 3NNSA 1JUDA 2R0QC 1BFDA 1T8WA 1RDFA 2A7XA 4LTMA 1MQ9A 3KQWA 3UC9A 4EHAA 1H4QA 2AOTA 3QVSA 3F6YA 1CNFA 3LCVB 3UBMA 4OI4A 4R2KA 2HSJA 4IWNA 3E23A 1G64A 2HJ9A 3K5HA 3OZ7A 1I6LA 4NWIA 2EERA 1D6SA 3I1YA 4DXAA 4M9ZA 2AE1A 2G5GX 2G9QA 1E3EA 1SC4A 2BWJA 1HYQA 2CCJA 1HWYA 3HQ4O 4P53A 4X65B 1Y9EA 2WTEA 3P1JA 4YUZA 3LDAA 4LVUA 2R00C 1OE0A 1S6YA 1X42A 2B2NA 2E4ZA 3AHFA 3LM8A 3PFKA 2NU9A 3W8DA 4MTCA 3HBAA 4B8ZA 3S7TA 2RGWA 4EJSA 2OGUA 4KLNA 2XWQA 2XY4A 3EEBA 3PZBA 4Q1BA 2G70A 2M1XA 3P0JA 4DIFA 5TE9A 5KVCA 2P9GA 4P0QB 2VJMA 2VT2A 3H6HA 3EDMA 2MSNA 1RLUA 1Z06A 4AKSA 2IH4A 3H83A 4H7PA 1MVLA 1JU3A 3LT5A 1KI8A 1P5RA 1PAUA 2RHBA 4GYWA 4LAFA 2GN2A 4AO6A 3DOOA 2GBLA 4QQRA 2ZSFA 3AL0C 1D9XA 2E18A 3HU3A 3LRTA 5F2NA 3RAGA 1QAOA 2F1HA 3E7WA 4LZZA 2WJGA 3ED5A 4M8SA 3IP5A 4X20B 2OD7A 4X1IA 4E3WA 2HADA 1L9KA 1EGHA 1PL8A 2OYCA 5AKGA 2J6HA 3FI0A 1HSOA 2B30A 1BHO1 1VJ5A 2YFYA 5CLIA 2ZWPA 5EWJB 1QIDA 1T9CA 2GEDA 4YP9A 3RVMA 2BGMA 1K8XB 3AY7A 5DXAA 5F2OA 1FU7A 3KXDA 4NE7A 4MWOA 1MKYA 2GJ4A 1GZHB 4NMMA 4UDXX 4D4MA 5AVUA 5I3CA 3CKKA 3SICE 1YVPA 3Q6NA 1VSQA 1UKVY 2DJIA 2YIVX 3KWMA 5C1OA 3B1ZA 3PD0A 4PHHA 2C4KA 4YAEA 2OP0A 2H6EA 5ALEA 3CT6A 2EW8A 2DMRA 4W5OA 2ZTUA 2XNDD 1RXIA 5LP1A 3EGIA 4L51A 2C0QA 2JK1A 4LGCA 1C9YA 1YTLA 1R4AA 2ORYA 2CFSA 4HWGA 3LXRA 4J16A 5JFGA 1JQKA 4ZYVA 2V5AA 1EX1A 2FSPA 2JIMA 5CT8A 1NXOA 3IDQA 4O2BB 3TNDA 1T5OA 3KKNA 3L6OO 3OSZA 5CT5A 3B1YA 5CLQA 1HE1C 2YZ7A 1D3AA 4U2EA 4XDZA 1CC1S 2BVNA 3PKIA 4S3MA 5KDLA 3GJTA 5UKDA 3RARA 3ZVLA 1FDSA 3O3CA 4FEAA 4MIKA 5CBKA 4P82A 5IASA 1JFRA 3HADA 4HR7A 3PWSA 3W77A 1F12A 1SXJE 3BL8A 1T4BA 1BX0A 1ZUIA 5EESA 2B37A 3COPA 4ZVVA 2A6PA 2CXRA 3OFJA 4IUDS 5LBUA 4YRIA 1Z18A 1WE2A 4WNCA 1TM2A 1XU7A 1E7RA 2Y8EA 4ZXPA 4DA0A 3OO1A 1K89A 2WMNB 3EGXB 2OHHA 1MA0A 3CSDA 3E9MA 4GWKA 1CQJB 4M21A 3P9CA 4F3KA 1RTKA 2VWHA 2PWPA 5G1PA 1ADJA 1P4AA 4N65A 3D5QA 1DUVG 4YRPA 2FUG6 1NI3A 4PW0A 1L5LA 2DKNA 2YQ5A 3LVRE 1GSHA 2QMOA 2OGWA 1VB3A 2VSOA 2OBMA 3E5NA 3OEEA 3IHTA 1FXUA 3IQHX 1QWOA 4RPGA 1JP7A 4WEQA