4GI5A

Crystal structure of a putative quinone reductase from klebsiella pneumoniae (target psi-013613)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
259
Chain Sequence
SMKVLLIYAHPEPRSLNGALKNFAIRHLQQAGHEVQVSDLYAMRWKAGYDADDSGAPPVGEFWRPTLDSKQAFAQGTQSADIVAEQEKLLWADTVIFQFPLWWFSMPAIMKGWIDRVYAWGFAYGVGEHSDRHWGDRYGEGTFVGKRAMLIVTAGGWAEHYSPRGINGPIDDILFPIQHGMLFYPGFEVLPPLVFYRTDKTDAGQFADQCAALAERLDTLWQTEPIPFRRQNHGDYLIPSLTLRPELAPGQSGLAVHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords quinone reductase
publication title Crystal structure of a quinone reductase from Klebsiella pneumoniae with bound FAD
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Oxidoreductase
total genus 79
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gi5A00
3B6KA 1CZKA 1V4BA 2X2PA 1RLIA 2FZ5A 3ESZA 4YALA 2BZSA 2KLBA 2QX6A 3NLLA 4LA4A 4PU0A 2AMJA 3QFRA 1FTGA 3SVLA 4S24A 1TIKA 3OVMA 4CETA 3NHUA 2FVXA 2QMYA 4QOEA 4QOHA 1BU5A 2FX2A 3OJXA 3OWXA 1YOBA 1YRHA 4FGJA 3B6IA 3ZHOA 1F4PA 3FX2A 4YAFA 3FJOA 2R96A 3L9XA 3EYWA 4C0XA 1VMEA 3TZBA 3QFCA 5LVAA 3NHYA 2FAXA 1WSWA 5NLLA 3UXHA 2V5UA 3KAQA 3RPEA 4R81A 2XOEA 1B1CA 2Q9UA 1OFVA 3B6MA 1FLVA 5NULA 3ESXA 4H2DA 4GI5A 4N82A 1AMOA 3GFQA 1E5DA 4YAUA 1CZRA 4YQEA 1FLNA 1XT6A 1JA0A 2HNAA 1J8QA 1AKRA 5B3KA 4GR9A 5F4BA 1RTTA 3W78A 1I1OA 1CZOA 3OX2A 3P0RA 3N3BC 3OX3A 3NFRA 2QR2A 1D4AA 3NHFA 1QBGA 1SG0A 3L9WA 3ES9A 1XYVA 1KBQA 1RLJA 3N39C 4LAFA 4LTDA 3TEMA 1AKVA 3GFSA 1ZX1A 5EMNA 2BMVA 4QOJA 4D02A 2WC1A 3UXEA 1CZHA 2MTBA 5LMCA 1TLLA 3FVWA 1AKQA 2HNBA 2Z9CA 1AHNA 6NULA 1ZWLA 4BMPB 3U7IA 5TGZA 2Q62A 3F2VA 2A5LA 3LT5A 5LBTA 4U7GA 4QOGA 4C14A 4DILA 4XDGA 2X2OA 1YCGA 1AKUA 4Y7CA 5LJIA 2OHHA 5A4KA 5EAIA 1YCHA 2QX4A 2HPVA 2Z9BA 3F6SA 1OBVA 1AZLA 1JA1A 3TE7A 5FUQA 4NULA 3R6WA 1D03A 1C7EA 4ZVMA 1D04A 4M0CA 1FUEA 2R97A 1GG5A 1NNI1 3O73A 3NHRA 5LBUA 1DXOA 3HA2A 2M6SA 1J9ZA 2F1OA 1H69A 5BUCA 3W79A 3NHJA 1QRDA 3K20A 1QR2A 2V9CA 2BN4A 4U7FA 3GFRA 2V5VA 2BPOA 3OWHA 4H6PA 1XYYA 2N1MA 4J8PA 4BMOB 1FVXA 4PTYA 1AG9A 1YCFA 2MT9A 3FW1A 3LCMA 1CZLA 2GSWA 2MWMA 3GAMA 3B6JA 2FCRA 5ULLA 1KBOA 5LJLA 5FX2A 4C76A 3U7RA 1WSBA 4QOFA 4ZVNA 2FOXA 3F90A 2QMZA 1FLDA 1RCFA 4DY4A 3K1YA 2QX9A 4ZVLA 1ZWKA 4F8YA 5B3LA 4QOIA 2MOKA 1YDGA 2OYSA 2OHIA 4N9QA 3N3AC 4CF6A 4YAOA 3S2YA 4U7HA 3NHPA 2W5UA 1T5BA 2ZKIA 3ESYA 3W7AA 4YAWA 3OX1A 4HS4A 5LLDA 5JROA 2Z9DA 4LTNA 3EDOA 3W77A 1XI2A 1DXQA 4LTMA 1T0IA 4XDHA 4QODA 3O2NA 3KEGA 4NLLA 2BF4A 4FGLA 2FZVA 1SQSA 4ZVKA 1J9GA 3NHKA 2OHJA 4HEQA 4FGKA 1OBOA 4N65A 3HLYA 1CZUA 2Z98A 4ICIA 4GQIA 3KLBA 4Y9UA 3FNIA 2QWXA 1X77A 5F51A 1DX9A 1AKWA 4DIKA 2QX8A 4ESEA 1AKTA 3JSXA 3NHWA 1FLAA 2KQUA 3QE2A 2XODA 4OXXA 3D7NA 4C0WA 4Y9RA 2FLVA 3NHSA 5F12A 3F6RA 2D5IA 1BVYF 2ARKA 1QHEA 4PTZA 2B3DA 2M6RA 1YKGA 3KAPA 2RG1A 3OJWA 1C7FA 1J9EA 4FX2A 3HR4A 2FDXA 5FA6A 3NHLA 1CZNA 1H66A 3G5MA 5EA2A 1FX1A
chains in the Genus database with same CATH superfamily
2OAQ1 3PEEA 5FAKA 5JAIA 2O8CB 1AHHA 1HDYA 3GJ4A 4BO6A 1L5WA 2JLAA 4B48A 2J8ZA 4JC5A 2J5XA 5GM2A 5TE9A 2BFWA 3DPUA 4E14A 1VSTA 5DTIA 5HMMA 1RBZA 4OMCA 4WUVA 1WU7A 1I3MA 1V1RA 3N0XA 1NVTA 3QVWA 1OTHA 2YIJA 3KSZO 3Q9LA 1XLUA 2IXBA 3VYUB 2XECA 5CW1A 4WGGA 4RTPA 1KF0A 4RULA 3KOYA 1SRRA 2PUVA 1R4NA 4HNTA 4LBZA 2OGWA 2Q0XA 1E61A 4TL9A 2OK7A 4QDTA 5JZ9A 1U8TA 4PX2A 2IH2A 1VECA 4RCZA 1O5IA 1XMVA 3JX9A 3GLIE 5FH9A 3UA3A 4NS1A 4LHVA 1P80A 4KXUA 4GL2A 4YAEA 5EHGA 3B9PA 1W36C 4ALJA 3OMWA 3HHPA 4RF3A 2I4OA 4L16A 4EQZA 4HWTA 3CR3C 3CNNA 3BWVA 4Z0NA 4CMIB 3GC6A 2Y27A 2DUWA 2W2MA 3FPBA 4NYIQ 3I2HA 1ZN9A 4HNRA 1O94D 4B73A 3G6WA 4Y1RB 2WLTA 1ULAA 1ZD4A 4QUEA 3C3DA 3GX1A 4W7IA 5AI8A 5DW0A 5EWJA 4KN6A 4EJ2A 4Z4QA 1J2RA 2PWBA 2TRSB 4L4RA 4MWBA 4KL8S 5GY7A 3RTAA 4BTEA 1YOBA 4CEHA 3V46A 2PWYA 3I9FA 2F3RA 2NSHA 3WBJA 4IEIA 4EJMA 4IRMA 3JWPA 2ACEA 1T6YA 3H0KA 4ZQHA 1DIRA 1MORA 4OHFA 4RH0A 2ZATA 4CU2A 4F06A 2P4SA 1Q5PA 5HR5A 2VBCA 1M67A 3DBLB 3FJOA 5FT9A 1V35A 3HRKA 4Q9JA 2X5XA 2XUZA 4HUQA 5JMPA 4YI3A 1RXYA 4Y2YA 2PGLA 1M0WA 4YK7A 1FMFA 4GD3Q 3GLVA 5TEWA 2OXFA 3ZWVA 4BLWA 5EIFA 3WGQA 4BS9A 3B3GA 3JQAB 2BGJA 2OXCA 3RNLA 3CNOA 1E8MA 4F38A 5HRAA 4LV5B 1E8NA 4NK4A 1Q16A 3OZXA 1KJJA 4E4RA 2LNDA 3CPHA 3LY9A 4LWOA 1YL5A 3ZIUA 3W6PA 4EO9A 4CLRA 4WBNF 1ZUIA 1J0AA 3D2CA 1IOVA 3JAMA 4CIWA 4JLOA 3RPEA 3RYFB 2O4UX 4YQZA 5LXTF 2C61A 5J2UA 1FMJA 3QU5A 3ROEA 4IKEA 3JQAD 3LUDA 3AJAA 4QUKA 5K3CA 5HQ3B 1ZRMA 4M9QA 3A4IA 5JCPA 4JENA 1IXRC 1QFJA 4OUDB 3G1TA 2QU7A 5HBRA 5IK2D 4QPNA 3A6ZA 4KLNA 3W2GA 3VR4H 2BM1A 5IDQA 3U16A 3UIEA 2X3UA 4C6SA 2P91A 3OPQA 1JILA 3EWSA 4KNVA 1KDOA 1EYZA 4WBNB 1GPNA 1CS4C 3Q3CA 2JIDA 1BQ3A 2GD1O 1NW5A 5BV2P 5LXTB 5JQGA 3AVOA 3ETLA 2X0DA 3JTMA 4DKJA 3FSGD 2F59A 1Y4DE 4A6EA 4EGFA 2YX1A 2NXJA 1YE5A 3FNHA 4JR0A 4MV3A 3ZX5A 2ZRCA 2X22A 3OD1A 3THSA 3ZWNA 3D6VA 2DHEA 5FULA 4ZVVA 5JAOA 2BLNA 1FNMA 2WLSA 2WTBA 2W11A 4WT7A 4WJLA 4FHZA 2O4CA 3TX2A 4X5OA 4I4LA 5F52A 1WULS 1JPJA 2NLOA 4GRDA 3W5HA 3NFRA 4BZXA 2YIMA 4YBRA 1Z3IX 5K0ZA 1E8DA 5G0SA 3TBKA 2Q6KA 3WJ7A 2VHUA 5FUBA 2DWOA 5LP6C 1WMSA 5I4KA 1K7YA 2AEMA 4LWZA 2YWHA 2HWWA 1VOTA 1Y0BA 2GO7A 5AKIA 2WYUA 3BDVA 4FBGA 1CB0A 3KOOA 1AD2A 5ECYA 5SZIA 3RUEA 3D6AA 5JALA 2FR8C 4Q00A 5JCJD 1DAGA 4TMZA 1Y7TA 4PCUA 5HQJA 1ID1A 1JHXA 1H0RA 2JIBA 4XIJA 3WLHA 3D59A 1ZIXA 1M7HA 2JGDA 4KVFA 4K3VA 3EIUA 1F8GA 2QRPA 4N5HX 3FUWA 4QECA 4EZIA 2BFEB 2GLXA 4PO9A 2V3CC 2H00A 4Q4AA 1N2GA 5MFPA 5H02A 2DWQA 4MS1A 2PEZA 5BW6B 2BVNA 4WK2B 2EL9A 5JS2A 1PJQA 1N57A 2FVYA 2I66A 3RTEA 2D5CA 3ROZA 1WEHA 4NYMR 3HYSA 3UK1A 3GCWA 2V6BA 6NULA 1TEHA 5HM8A 1OXSC 4LSZA 4FFBB 3BGWA 3SZGA 3F2VA 2Z6QA 2O3RA 1JECA 4P0PB 3D6FA 4R6XA 1UBNA 3ICQB 4PYMA 5HJEA 1W7AA 4DCCA 1AGPA 1PUXA 3B36A 2QIPA 2QG4A 4BVAA 2HSGA 2QVCA 1FYXA 1G5QA 2IYQA 1OV4A 2WHXA 3EHEA 3I72A 3AKCA 3P0IA 1WHSA 1GGEA 3WA6A 5BN3B 5BRJA 2X0KA 4JEIA 3S68A 4II7A 4Q19A 1BRTA 3PLNA 4P4UA 3UCFA 1MAHA 2GS9A 4G9BA 1EFCA 3QUBA 5D8DA 2PFSA 2PANA 2AI2A 5EUBA 5EKTA 4BNMA 1ZVKA 1KZGB 1VL2A 3FYDA 2GYYA 2PJDA 1MR3F 2HPVA 3ET4A 4LDRA 1Z0AA 4NMXB 1I3KA 2REXB 3VR5D 5I7EA 5JY1A 3AUTA 4EATA 4QG7A 2A1IA 2WHYA 5LP1A 4ZHSA 3GBSA 3CTMA 2VNJA 3H6KA 3R6WA 2JF0A 3TLCA 1T34A 3ZE7A 1RS0A 3R7FA 1QQBA 1DMRA 4YMIA 4AZTA 3PRJA 4P54A 4JXZA 3WLNA 2JA1A 3RROA 9ABPA 4OBWA 1AHIA 2OV3A 1P1HA 1OFUA 3INNA 1PK8A 2NO4A 3ZJ5A 4XYEA 2QTHA 3TAHA 1IZ9A 4XX0B 3MUNA 3ZQUA 1W47A 5EUMA 4AW9A 4IOMA 1UKBA 3T7KA 2XUKA 1J9ZA 4B79A 1L5HB 3HDJA 4TM8A 4DCVA 5KTNA 4ENVA 3DEYX 3EMDA 1RPNA 3G3EA 2JI6A 2BFBA 1I5EA 2O7NA 2PA3A 4PLYA 1QRDA 4NOKA 1A9XA 2RH9B 3QVUA 1RIFA 1G7RA 4JBGA 3ILVA 3V55A 2I3DA 2JIRA 2VHCA 2X3FA 3UJDA 3FTQA 3PF8A 2DBYA 3F47A 4P93A 5C46F 5HZKA 1QZTA 2Y68A 3SQLA 4JI6B 4AC9A 3VNVA 1OXBB 4U7FA 4G0XA 2QDKA 1OKKD 3OWHA 1FU7A 1R5JA 3HVUA 5CTJA 2JZOA 1MTZA 2QZJA 3I04A 4ZU1X 4CTNA 1NYLA 3JD1A 3TDMA 3UCXA 2SECE 2TS1A 3PQFA 5FTJA 4X8LA 1GNTA 5CCEA 2WQ6A 1VIVA 1UAYA 1SQFA 1EI9A 1Y5IA 4N18A 2OLKA 2VUSA 1X1TA 2ADMA 2AW5A 2R2AA 3L1KA 4G4GA 4M9XA 4UBMA 4XXHA 3TKYA 3KWFA 4NU8X 4PN7A 1WXXA 3SC2A 4BOYA 4K0KB 1AG9A 1UJBA 2VZ8A 5HCIA 1QUEA 4AP5A 1E1CA 4W99A 2JK1A 1OAOA 1Z47A 4D4LA 1ZHHA 4O4JF 5FOQA 3FKSA 4FHEA 3Q4GA 4QJBA 1TB4A 2IYNA 2FDCA 3KJFA 3MPOA 3VA7A 2X1VA 2PQMA 5F64A 1DPGA 4FIDA 4KC0A 3WRYC 1GL6A 2G67A 5CURA 5CT5A 1AX9A 1XCJA 3LXRA 2BW0A 3I9V6 1WU8A 1YK1A 4LIPD 3H9EO 2SHKA 3K1AA 3UWDA 4QTUB 3V7YA 3UA4A 2YY5A 4HRVA 2BFPA 2RBKA 3IUJA 3FTEA 3OU6A 3VX4A 2YWRA 5EQFA 3RTGA 1N5OX 2FOXA 5KVAA 4PLPA 4URYR 3WC4A 2GHQA 3DZFA 1JG4A 4O4JB 1DBIA 1SCAA 1JDBC 3HB7A 4H0NA 4ZVLA 2PWZA 5LN1A 1I1NA 4G1EB 4U2CA 9LDTA 5GONF 3WV4A 1KIMA 4OI4A 4BE9A 3HJRA 5DBHX 4QX6A 5B3LA 1QP0A 3D3EA 1QV7A 1OSNA 3JQDA 4I19A 1QHIA 3TOVA 1CY0A 5CXUA 3IJPA 3FZQA 2Q5IA 1CVLA 1Z7GA 1Z4JA 1ZEMA 4GOXA 2J3MA 3EXHB 4MR7B 4UREA 5FBQB 3W8FA 4BZQA 3I01A 5JPDA 1OQAA 4UEKA 5ALXA 1X7YB 3VKUA 4E6PA 5K2OA 1M34B 3C3XA 3CLTD 2PL3A 2RHHA 3LL7A 3AI3A 4KYVA 3BDAA 4KMOA 5A4MS 1DARA 2AN4A 3EQ2A 3KFVA 4DM7A 1Z6PA 3P32A 1DP4A 5IVIA 3CCBA 2JGIA 5FL3A 4PQEA 5GONB 2K87A 3E7FA 4KXVA 1NXWA 1D5CA 1ZISA 3PSAA 1Y7PA 2KPOA 1P75A 3PF9A 4IFIA 4DA0A 5TLSA 4C0HA 4NAVA 4Z49A 3FE2A 3ACDA 3N05A 3HJAA 1UBGA 1ODSA 1YJ5A 1VLMA 5TT0A 1JHVA 1XP8A 2YWJA 3LGSA 4GL4A 4Q37A 4HNVA 1SO8A 2Q41A 1JEOA 3CV3A 1AN9A 1EX7A 1Q7GA 4REMA 3KYDB 1YIAA 2VBGA 5L4NA 4ZT7A 5K4HA 2V03A 4HB0A 4TTSA 2Y2VA 1FMCA 1X2EA 4A8JC 4Y6OA 5I8WA 3GRKA 5TY0A 3FRIA 2PKRA 4LDAA 4O5AA 3DAYA 2Q0QA 1EGMB 4CT4B 1TJPB 2ORVA 3DO5A 1ECFA 1T3GA 2G8NA 2BRUA 2DUJA 4N47A 2NG1A 4IDAA 1E18A 2IYLD 1XO1A 2AG8A 3JWHA 2Z58A 1OJLA 2QJOA 4MKFA 3RS5A 3EEFA 3LKBA 1XCGB 1BDJA 1QH1B 1Q22A 4P2GA 5C81A 4EPYA 4RZHA 3HO1A 4QDKA 1ESZA 1LTQA 5G0VA 4BP1A 2Q1YA 2X19A 3PITA 4L78A 5DN9A 2P4UA 5KIAA 3QEAZ 1HYGA 4NFLA 3CLRC 4NCNA 4CMHA 1GLNA 2G5CA 3DEIA 5A9SB 3N0WA 1FK8A 2KBFA 3EGVA 2NSJA 3PR3A 5AK0A 2IHJA 3UMYA 3U4QB 1YQXA 4G0QA 1GZDA 1OVMA 2D0DA 2IPNA 1PDWA 2D0PB 3SF8A 2ONKA 1T5HX 3RRFA 3WSTA 3F1KA 2A1TS 2YVUA 3CX3A 3FWPA 1CLEA 4JJAA 1Z5ZA 4R2JA 3WB0A 6Q21A 4GKJB 1XEWX 2H8KA 1VE6A 1U2DA 4L7VA 3PD0A 1QAOA 4YMHA 3OOWA 3W6UA 1V9LA 2FN8A 3WKBA 4RK6A 2COEA 1XU4A 2HA3A 3WJAA 4K6KA 4N8EA 4N41A 1K8XB 5J1SB 2GJ4A 3WDSA 2Q4RA 4R9NA 3WHKA 4YMTA 1OXUA 3DFFA 4A2QA 1HX7A 2CVQA 4R8KA 1QTQA 2P9FA 3EAFA 3N2NA 5G02A 1DO2A 3DWIA 4UU1A 5HGJA 2AMVA 1VSBA 1LPNA 2W2QA 2AQIA 3H1EA 1QC5A 2ADOA 4ZO4A 1YKSA 3BQ9A 4KPGA 1DC3A 4B85A 2HRQA 3A3YA 3CW8X 3LJKA 3UAGA 1P1CA 2DC1A 1DJLA 4Q03A 5EWMB 1DL5A 4JJ7A 5F1PA 5A1JA 5K6RA 1FRFS 3AXSA 1P81A 3GBPA 4M87A 4GXNA 5IFKA 4WXEA 5TQ2A 4LOKA 4EDFA 3REQB 1Z0DA 2YASA 3VJKA 4JBHA 4PZLA 1XPUA 2QM8A 3JWJA 3B3JA 3IKVA 4B40A 4CUZA 2WAAA 1Z06A 4QTYA 3HK2A 1JG6A 2HC9A 2WSLA 2AYZA 1ZP6A 4MQ4A 2NADA 2H65A 3ZYCA 3DTVD 2J4FA 4WUTA 1R0CA 4AB1A 4EW2A 2JRCA 2BEWA 4D9CA 1BJRE 1K7XB 1TFUA 2XSZD 3E9MA 4R8SA 2JC3A 5AICA 1JIVA 2A0WA 3L0PA 3S2EA 5IEJA 3D7RA 2HQ1A 4QJ5A 3GFBA 1YAHA 1U3TA 2IYVA 3EXFA 4JGBA 4IIBA 2IPLA 4DZTA 3CVXA 2FMTA 1ZCFA 1ACLA 1MNAA 1WE2A 2LIVA 1R9NA 5CMLA 4PGMA 5FYDA 1BDBA 3RHTA 2VPTA 3B82A 2A5YB 4RH3A 4O2RA 1Y82A 2MR5A 3TQCA 2R4QA 2GJAA 1P8AA 3GFFA 1ETHA 4MO9A 3UN1A 2IQ5A 1VJ0A 3DLHA 3ETNA 4JEMA 1GPKA 2QTMA 4BAZA 1UDCA 1PNOA 5JXHA 2E1PA 3ZXIA 4TWJA 1M2OB 1UINA 1JYEA 3WIVA 1II8B 1TJ4A 2GUWA 4ZQEA 4ZVRA 3DMPA 5DLQC 2C2HA 3FUCA 2A0FA 4C7KA 3QVJA 3FNGA 5ADVA 5CPFA 3B9RA 1QRRA 1K7EB 3HR4A 4ZAYA 4GYJA 3IDOA 2IHNA 1UK9A 1LDEA 2RHJA 3EMVA 4LQLA 1OILA 1ZM2A 5L40A 3E48A 2QRUA 1EP2B 3UKOA 4DWVA 1SBHA 2CL0X 4KG7A 1PX0A 3V7WA 2WZQA 4UE3S 5CLFA 4OQZA 4AIIA 5I5GA 2X58A 4DQDA 2WI8A 5JAZA 1MOQA 1DG3A 4IBOA 1KFEB 4XRGA 2GBIA 2WA1A 3RU3A 2M9MA 4RTLA 1JLMA 4RGBA 5EIEA 4UHDA 2HSEA 3Q3VA 5IM5A 5H8WA 2I7DA 1NFQA 4AZ3B 3FTCA 2R66A 2AOTB 2IF0A 3GLSA 2PE5A 5FPPA 5H80A 3WB1A 1TVCA 4HN9A 2VXBA 2I67A 4XWAA 1TT5B 4BV3A 1Y3BE 3NR2A 5K5EA 3DV2A 2D7DA 3M1IA 1ZL0A 4LA4A 2ANCA 3CGGA 2OBXA 4IX9A 3ZY3A 2EKLA 4AYXA 3VDMA 4BB9A 4EMSA 4GMHA 5A71A 1WJGA 4JSRA 1ZJ4A 3HJTA 3MK31 3RF7A 4I3HA 1TIKA 2HIHA 4YHHB 4L5BA 4EP1A 5ICGA 3X1KA 2WD7B 1MB9A 4JQYA 3WYFA 1LZLA 3GLIB 1R3UA 3U3KA 1Q17A 2QU8A 3ADBA 3FR7A 2XEXA 2CJPA 2IS2A 4MKGA 1D2HA 1PR3A 1F0YA 1BXRA 2FX2A 2M1ZA 2I2FA 2RONA 2Q4BA 3CZ9A 1JQ3A 1VE3A 4GPEA 3M81A 4F5WA 1XZEA 3M7IA 3PNYA 3WZLA 3MBKA 1X1AA 4E1VA 4PG5A 4NK5A 3U4GA 4QRHA 5T41A 4WBXC 1QP4A 1AQJA 1WB4A 1YVUA 3KLMX 4OLBA 3AINA 1T13A 3Q3EA 3PJRA 4BXOA 2C5SA 3H3FA 3LIPA 1EINA 1YRHA 3WBBA 2BKLA 4DCTA 1P9WA 1L5RA 2NTEA 4JR1A 2IH5A 1A7AA 2OR3A 5CIWA 4MVJG 4YBZA 2P69A 2ZR0A 3HJCA 5BQ5A 3TM5A 2ZR8A 5ICMA 5C5IA 1MAUA 4IM7A 1U9CA 4NMHA 5TF4A 4RW0A 3G0HA 4EB6B 3SHTA 4CLXA 1L5SA 2N0SA 2B8NA 5DHQA 2HADA 3IOBA 3L8HA 5EC8A 3TZBA 4EHFA 3NHYA 3LOUA 2CUKA 1LB1B 1DX4A 4M53A 2AFHE 5DW3A 1P33A 2WMNB 3DD5A 4LDZA 1B42A 4ZP1A 3O7WA 3UXHA 3KG2A 1C7QA 1NVVR 3ZE0B 2DJIA 1W49A 4CCYB 4Y6PA 5EXEA 3EPKA 3QU2A 4DB4A 4B3FX 4I55F 4R81A 3G79A 3WKCA 1CC1S 2R65A 4PTLA 2Y1GA 5B53A 1FMTA 1VB3A 3HPQA 3IERA 3P4UA 3VHLB 4V24A 2HV9A 1L5GB 5F77A 1WZCA 1ABEA 3EGWA 4G0PA 2JLVA 2NQTA 2IEAA 3LQRA 1P2UA 4MV6A 3CZPA 6ABPA 5A2GA 1GTG1 1PUJA 2F1HA 2QUKA 4K05A 1IZ8A 2FHPA 2H0QA 1E6KA 4PFQA 3G17A 5K0GA 1LBEA 1Q0ZA 3BB4A 3UGJA 3V4PB 1RI1A 1DKNA 1ESEA 1FPQA 1ZKMA 2V6IA 1XNJA 4XUCA 3UQYS 1R6BX 1EFHA 3HWX1 2YHIA 4W9MC 1WZ2A 1V37A 1I2MA 3FNRA 2CHUA 4I55B 5FI1B 2BISA 3K4PA 1QRUA 3RO7A 2W8BA 4MROA 2J3KA 3WB9A 1JEEA 3LY5A 1U99A 1UQUA 2FI1A 4G4SP 2QZZA 1E2HA 1XFDA 3L5OA 4WOCA 3W78A 3N74A 1ZVVA 1ZSVA 1Z33A 3A1DA 1PEKE 4CMCA 5EIHA 1JR3A 2QRLA 2W4IA 2XBUA 5DTMA 1USVA 1QLHA 1S1CA 4TQUS 4I4NA 4IV0A 4UC0A 1WUKS 3QWAA 2FPOA 4PO1A 4KGZA 3GJ6A 2BD0A 2W2XA 3MQ4A 4HSGA 3VPBA 4XZ3A 4CWAA 3HXMA 2OKGA 2VDOB 3HH8A 4DJEC 1XYVA 2JJ1D 3V7NA 5BURA 4FQ8A 3H99A 1RLJA 4INOA 3WMGA 5CDHA 1GGJA 3PE4A 4LTDA 3U9LA 3EZ2A 3VZBA 1BOOA 1LQ2A 2XMZA 1ZX1A 4IDGA 3TOSA 1U8CB 3WQRA 1L7BA 1LV8A 1P1IA 2YBDA 4MUEA 4P08A 4QU0A 4S12A 4F86A 2D2FA 2J9FA 2GR9A 5CA1F 4TYMA 1X14A 3ZWKA 4AJ4A 3GPBA 5I7VA 3CO5A 1A9YA 3S8EA 4Z4IA 2FW1A 2OAGA 1K4YA 2P6PA 4RO0A 5EQTA 2FFQA 4PZYA 3EQ6A 2E0IA 5DT9A 3KKOA 3KVYA 1TLLA 2JHAA 2YV4A 4KK4A 4NH4A 2JGLA 4TYQA 3FNQA 5HTKA 3FAKA 1JMKC 2Y4OA 1VXOA 4UEQA 1WMAA 3MJEA 1CQJA 3FSRA 5INTA 3GHHA 2XCRB 2YNMD 3O83A 4OI1A 4BU1A 2H1HA 4J6EA 5BUQA 5IWAB 5J43A 3GFGA 3UUWA 1G8HA 2PYIA 1E2JA 2PL5A 1P4AA 1NVWQ 2O3SA 4NFSA 5CA1B 4WMLA 2FWJA 5D3ZA 4JGIA 1RMQA 1TQ6A 1U5BA 3GOQA 4NMLA 3T5GA 3JZIA 3WMRA 3ACCA 1C8BA 2CDBA 3HBAA 5TX7A 3TQFA 1XZMA 3AILA 3L8YA 1QM5A 2QV7A 3AF2A 3MF4A 2J9YB 2II6A 2LWIA 3L7BA 1SC4A 3TQQA 3T7DA 2FRXA 3IR5A 4GUDA 2VWGA 3BIOA 2E2WA 2YXPX 3ZCPA 3TO5A 1X9IA 4XVCA 2QYSA 3OT5A 3Q87B 2ZWIA 1QV6A 1T9HA 3H97A 4ETMA 5ADHA 3W5BA 1BS1A 3QIAA 3PL1A 2I65A 3IV9A 4XJSA 3REGA 2J6HA 2TMYA 4AJEA 4EQ6A 4V1CA 3ZJTA 1CX9B 1JA1A 3UB3A 4ARUA 1UEXC 1GRNA 1FE8A 2F90A 3FMVA 1AJEA 3FWNA 2OXRA 1MFPA 4ND8B 4L07A 4IEEA 1VCIA 1GQYA 4OU5A 2QTVA 1U1FA 2QXUA 3NEYA 4HUJA 3R7WA 3C3BA 3DMNA 5K09A 2O8FA 1DLJA 1A0OA 3THOA 2Z5LA 1VIYA 3GVXA 4MVJF 3CE6A 1JDTA 3S1AA 1FFAA 1U0RA 2OENG 2DLDA 1DRWA 2IITA 4K1XA 1C9EA 1TK3A 4H3HB 5LU9A 3CLSD 2MYPA 4BC0A 1KQFA 2ZYWX 3W6OA 1NVXQ 1PRYA 4Y30A 4HNQA 5IUJC 4PG4A 5EYPA 3PXDA 3P9IA 3UGQA 2Q3DA 4JOCA 1CG6A 4KQEA 4N6GA 3W2TA 4YIHA 5SY4A 1JWLA 1YDWA 1E1YA 1YBHA 2CNDA 2QGFA 3GW8A 3X1MA 2XBMA 4CMEC 3TW4A 5B6JA 2WB2A 3ONWA 3IQWA 4YJHA 5JHGB 2VO1A 4UOEA 5EEGA 5F1OA 1JA9A 4L9RA 4ZYXA 4KE7A 4LJYA 1YZQA 3BMOB 2VLIA 1TYAE 2ZT6A 3KU1A 4GOLD 5C5EA 1G3MA 3S8MA 2YWCA 4IMIB 2OSVA 4OGLA 5D00A 2Z6AA 4D6XA 2FR1A 4XIIA 1RQ2A 3F6PA 4OJTA 3PJGA 4DGQA 1NNSA 4Y98A 3GYBA 3J81A 4HXYA 1NLZA 4DMCA 2C2XA 2VT6A 5AW5A 3Q6IA 4H6PA 3L5KA 5HWSA 1GFSA 3DLTA 4V38A 1Q1QA 5KC9A 2ZJ0A 3MLBA 1OYVA 4MVJD 3VM6A 2I4NA 4J16C 5DT2A 1TCBA 2FPIB 2H1FA 2D2IA 1XDSA 1KZ9A 2PM8A 2WMYA 5C8XA 3EWIA 1NPYA 3GNTA 3TL2A 3ZE8A 4LE0A 1A1VA 1ODIA 1W1UA 1ECGA 2AWNA 4PG7A 4HCJA 2WHPB 2J9GA 2ZZMA 2GM5A 5DTQA 4CLOA 5KINB 3G49A 3KXPA 1Z73A 4DLYA 5JWOA 4RETA 1K7CA 2YV2A 3WLJA 5KWSA 2I87A 3KYCB 3IPRA 4B3HA 4KU4A 3MWDA 5FX2A 5H83A 2BBSA 1EZ1A 2Q4TA 2DLNA 4GRIA 4Q7QA 5T4BA 4EHHA 4I1VA 3DMTA 4M8KA 3WWDA 4DG5A 1RWOA 2CJXA 1LDBA 4ZTUB 2MJLA 1DWOA 1DBSA 4XJVA 3U3JA 3IV7A 2BIFA 2ZRFA 1RJFA 3UG7A 5F2KA 2ZIGA 3H9UA 1N1GA 2D2VA 1DEOA 3JY6A 4QARA 3I5AA 4RA9A 1H6BA 3JYHA 3KSDO 5KSPA 4JROA 4QM7A 4UTZA 2ZCJA 1JIJA 2HJRA 1PTJA 1XELA 3CNEA 3FWYA 4UCXA 2CVOA 2XZOA 5JC8A 3RSGA 2GZ2A 1DUVG 4A8TA 4YAKA 5TPZD 1AURA 1QFMA 3N53A 4ZKEA 2L18A 4UDOA 3STWA 3Q6MA 4EEZA 3SGLA 3AEYA 4GIBA 4GXRA 1L7XA 4KHPB 2J5QA 2F1IA 5JO0A 2Z6UA 2VEOA 1NBMA 4YIKA 3FETA 3QMWA 3K70B 1J07A 4ALLA 5K6AA 1L4EA 4PAWA 3TL6A 3OLVA 3ZEAA 3OA0A 4Y2XA 3KKZA 4RF4A 3VYVA 4F0JA 5BYAA 1U3DA 1ZJYA 2XKJE 4INPA 5DHUA 5AM4A 3ZBTA 1YJ8A 5KTRA 4NBKA 3UPTA 1TI7A 4Y9DA 4EUHA 4XJXA 3E5HA 2AE2A 3GGJA 3H65A 4FYMA 3HQ4O 3B48A 2DHDA 3DMYA 3LP5A 4IDPA 5CLQA 5C1DA 1BDMA 3NHPA 3K70D 1EP1B 3ZJVA 3OEED 3QUSA 1DINA 2A5DA 2EZTA 1F48A 3JQPA 1QPBA 2DJ5A 2XHZA 3WGGA 4CG0A 5JSQA 3RANA 3UAWA 1YI0A 1EK2A 1YDFA 2G9VA 2FKAA 1YS4A 1SVNA 3JYOA 4OYRA 3VAZA 4BN0A 4BBJA 3OQOA 2V8OA 4P33A 1DAOA 1SFRA 3G5AA 5B1DA 3LXUX 3FUVA 2FZ4A 1XROA 2QUBA 2Y0EA 1T5TA 2CXHA 4HN2A 4WN9B 4LC1A 2IUSA 1NM5C 2IPOA 4EUFA 3DE4X 3NIDB 2ODEA 2P2YA 1IY2A 3MBIA 1MOSA 1F2UA 2JLQA 2AEFA 4N1AA 4ASUA 4IOKA 3DM5A 3AL3A 3KXKA 1UDXA 1X7ZA 3ER6A 3A9CA 2RGWA 1IXSB 3SIXA 4K9MA 3LC2O 1QVRA 4BO9A 1X8KA 4D8UA 5FKJA 3CNQS 3GXOA 3IQFA 3QYAA 4IINA 4RD3A 4C22A 5FHQA 1ORDA 1DKPA 3FOCA 4QGGA 1ITZA 3JYQA 3OCCA 1EUDB 3P26A 4PQRA 4MUNA 2OO7A 2RHLA 2JH9A 1WZNA 3B1WA 3QE0A 4KLRA 4OGKA 5G2OA 5H68A 1TUGA 3KUKA 4LUCA 4EJ0A 3LFHA 4B82A 2FZVA 2QUZA 3WKAA 1SC9A 2YXBA 5AVTA 4NU6A 2JAPA 4LZNA 4UUOA 2GYUA 4MRMA 1QGOA 3L4KA 2Z4RA 3EIHA 4W6ZA 1SCIA 3C5VA 5KYWA 4F4IA 1USKA 1C8KA 2HX1A 3G2KA 4JQOA 4NBVA 3HC7A 1M10A 3K0CA 4RIHA 1RCTE 3MQ2A 4DCSA 4ZJPA 3UCEA 3FN4A 1EWQA 3ENNA 3HLYA 4WNAB 1NT4A 1RYMA 4D2IA 4EKEA 1WUYA 4FQ5A 1C30B 5LQKA 4BQNA 2GM4A 4W5RA 1N5LA 2ZI4A 5FUYA 4RLFA 4H6WA 5KX5F 3BQNB 3OPNA 2QV0A 1ZUHA 2BGMA 3OIGA 1U8XX 2C9OA 1DX9A 1XZDA 1J99A 1X42A 4PLTA 4G5FA 5EJ8A 2WFZA 4LE2A 2D0IA 1H5NA 5L8VA 1MCZA 3SVZA 4MS4A 2WKWA 3QUTA 2QX8A 3GVPA 3LTEA 1LI5A 4PFJA 4ESEA 5D3MB 4NC9A 5EIBD 4OMUA 1EVKA 5G1PA 3WTBA 3EPPA 1CUWA 1RXEA 2E4UA 1SM4A 2H18A 3IT1A 4LY9A 3U3OA 5DMHA 5HRCA 2FPPB 1U90A 2QRHA 3NAGA 5JARA 5KX5B 4FQ7A 1ULHA 3RLIA 1JG3A 2NAFA 1HNXB 1R4MA 2GBFA 3LFUA 4JITA 1W96A 4AF8A 5C52B 4GOMD 1BHSA 1D6MA 3D7NA 4KO8A 3MILA 2O07A 3AESA 4C0WA 2ZUEA 1UMKA 3HCBA 1E6LA 2CE7A 3IMEA 4J4TA 1SXJA 2QTLA 5F12A 5LNK1 4P3OA 4EGJA 1OHHD 4RPKA 3BL5A 5C9ZA 2LKDA 1ANKA 4OB7A 4OGGA 4KQ1A 3FF1A 2R8EA 4EJSB 4MYCA 2P2DA 1QHEA 3Q9SA 2X5JO 1TZCA 3N59A 1G4AE 1RAFA 4ZYLA 2JCGA 4BE4A 1KY3A 3S29A 4WERA 1DHTA 2NGRA 2I6SA 3RRYA 3CT6A 3GGOA 3HUFA 5ICFA 1FNCA 4A0SA 1PZFA 3C4QA 1RQ7A 3ZWBA 1XTQA 4PSUA 1UR5A 4ZOAA 1C2TA 1E2UA 5JS6A 2RHGB 3GRRA 3T95A 2XIJA 4CMKA 1IQPA 3EIEA 2OLEA 1Z16A 2B1RA 3PQDA 4J07A 4X1OA 3CMMA 1IMOA 2DULA 1NV9A 1PFQA 1GCUA 3DDUA 4FYWA 3NHLA 1QXSA 4KR0A 2ZPAA 5DWVA 2IUYA 5FOUA 2GJSA 4MUXA 3H18A 4G5XA 4ZC1A 2IUUA 3W9SA 2HPAA 5C3MA 2QA5A 4ZOLF 5I7OA 4H7JA 2HHHB 1UBLS 1U7OA 2EFGA 3ID6C 1DKQA 4IIFA 5IXYA 3I4FA 3PUHA 4GMDA 5COBA 2BUAA 4QNRA 2A5JA 2AC2A 3SEFA 4C2BA 3IEMA 1M8KA 3QNWA 1PHRA 3GLFE 4W1SA 6CHYA 4JIGA 5CVEA 4M55A 5EXSA 3AUKA 4OHKA 2D4HA 4NOJA 1JGTA 1YJQA 1PBNA 1E3DA 1L7QA 2LUOA 1LBQA 3IDQA 4ZT4A 2QHXA 4TLEA 1EFVB 3GBVA 3WFZA 4NP6A 3BSFA 4A0HA 2Q1SA 2D1QA 2QW8A 4MQEB 2VP0A 4M9UA 3GUHA 3SSMA 1SELA 1XJWA 2HA2A 3AF0A 4ZOLB 4R3UC 4QICA 4TXMA 5EIAA 4BQSA 1P73A 4AJIA 1PZGA 1YUBA 1MD9A 1BKSB 1E9SA 3OCWA 3SK0A 3L8FA 2EDAA 5F7ZA 2H5EA 5KWVA 1V39A 4AKHA 2FJUA 2X76A 1LW7A 4CTMA 2HSJA 4FOSA 1DWUA 1KHTA 2A67A 2CJWA 4EJSA 2XZLA 1IN1A 4DLLA 1PW5A 1TM5E 2HRBA 3BA6A 1U1DA 4GU5A 3WJ2A 2ZB3A 1CVIA 5JYEA 2QN1A 4AVYA 3AVPA 1U7ZA 4HB3A 4HLNA 4KGDA 4M6WB 5BSRA 3EVGA 4EA8A 5HX7A 2GB4A 3MJVA 4FD2A 2NZJA 2WV7A 1N3YA 3LQFA 1GRRA 3MWFA 2Z56A 1FRNA 4E1AA 1MFZA 2WD8A 1MQSA 3B9QA 3M4YA 5DASA 1MDBA 4N8SA 1CUGA 2UUPA 1IBKB 4EG8A 3IE1A 5H7XA 3RVDA 1W5FA 3JD2A 2H3EA 1ZG3A 1AT1A 1U2GA 2GDJA 2EYQA 2PT7A 2VOEA 4OPMA 5B2ZA 2OECA 2A5FA 2WJHA 4XPIB 3D7SA 1BC5A 1GT6A 1D4FA 2BFMA 2C1EA 2TMKA 4Q1DA 1B15A 3U7EB 3BIFA 1R66A 1PR6A 4FBLA 4HVTA 4MV0A 3L1IA 1NFFA 1KAMA 3FX2A 4FUTA 5JVDA 3LECA 3M8KA 4ND1A 5K4AA 1ZJ5A 5FBZA 1QP8A 4NX2A 1VE5A 4M22A 2O50A 1R1DA 5AVRA 3NYQA 4R9VA 2FN3A 2ZKLA 3GLTA 5DM4A 4WNAA 2PKEA 3PEUA 3NBMA 1M7GA 1FVHA 3NWPA 3NC4A 4H7EA 4YDRA 5EINA 3C6MA 4Q4DA 1E1MA 1EU1A 1KQPA 1RXIA 2EJWA 1MB0A 5HK8A 4GG1A 2ONYA 1V5IA 1EBUA 5KYUB 4AT1A 4B2PA 3LCUA 1YVPA 2OP1A 2XZTA 3EA4A 4ES6A 3URKA 2C20A 4OXNA 4EJ6A 2VN8A 3FDZA 3STUA 5JT1A 4JNCA 4KRXA 2ZM5A 1NFRA 1SB8A 1TEVA 4BZPA 2HTEA 5CH5A 4ZN6A 3C3MA 2XA1A 2XB4A 3QKTA 1ZONA 1TAUA 2Q3CA 1G21E 1UM9B 1NT2A 4KQGA 3ANNA 3ZPXA 3G8AA 2AR9A 4X97A 1NIPA 3VU3A 4I9FA 4ZYYA 2EFYA 2Y0DA 4FU0A 3AUFA 3H75A 1NR1A 1E3WA 4L0QA 3RS7A 1NKVA 3RFCA 1C4KA 2NQ2C 3HE3A 1V0JA 2ZZNA 2DF8A 4G65A 4JVMA 2XQJA 4E5KA 5JE8A 1FLNA 3PVCA 2GD0A 1Y42X 1H8HD 4M1WA 2HNAA 4RXTA 3D2BA 1ISFA 1L3BA 1WQ4A 2QF7A 3NOXA 1CY6A 3U0VA 2GUGA 5HEKA 3F4KA 5CFZA 1YU6A 2QRMA 1ORHA 3N8HA 3OX2A 1KYIA 2QG6A 3B7PA 4L4UA 4DNFA 1ADJA 3N3BC 1RYBA 2I34A 2A9JA 4RORA 5PGMA 2R6R1 1USUA 1Q3TA 2WQZA 2XUAA 3LUGA 1E1RA 2W6IA 5BWMA 4KR7A 2CW5A 2JLSA 3EMBA 4BJ6A 4AMBA 1EBBA 2R6HA 2V54A 4RTQA 4G36A 4R0NA 3VDXA 4CFYA 1MQ8B 3FCOA 3IEKA 2E89A 2V7QD 1HLGA 1H9BA 5HOEA 1FFWA 1ECPA 1F17A 3OQPA 1IUNA 1JVBA 2KM1A 1WCWA 1U9IA 1H2BA 1UJ4A 1H8EA 1V9CA 2MSKA 4OQ4A 1OXVA 2VBFA 1JNYA 2P11A 1XJCA 5KO2A 1XPOA 3W7VA 1UM8A 2FA9A 3K0SA 4YJ2A 4M1KA 4OOFA 2PT9A 2YJ4A 5CTAA 1EJ6A 1WY5A 1Z0IA 4FNGA 5EJ4A 2HNBA 3E3NA 1T9GR 2QD1A 1GZ6A 1VI5A 4A82A 1JAXA 4Q3AA 4BMPB 1S8AA 4Z54A 1KSGA 3MMXA 4MS3B 4PAMA 3OY2A 1VTKA 4ZMSA 4ACBA 4ZDWA 3NBFA 3AVVA 2HSZA 1DHRA 3OLZA 2DETA 3G68A 4JU8A 5AM3A 5LOVF 3V2IA 2QMUA 2W6JD 1J21A 1DDGA 1YUMA 2P30A 3GFTA 3A9TA 4R31A 2IZ5A 4K2AA 2ODPA 3IXLA 1NKSA 1UP7A 2FW6A 2PJUA 2WSBA 3FI9A 4J0QA 4NE9A 2WMOB 1SHKA 5EAIA 3RVBA 5KCZA 4N3AA 3QBJA 5B4VA 1XMQB 3UTCA 2W4QA 1DXHA 4PS1A 3IAXA 1QZXA 2ZBPA 2GPYA 2XB8A 3LWNA 3SIRA 5KQPA 1DKMA 2ZU0C 3DC2A 3F7TA 4X94A 4EDHA 3TWOA 1N6NA 5MDHA 3AFIA 2WW8A 2CJYA 5LOVB 4LXYA 1U6IA 1VHJA 1G5IA 2JGAA 3ITKA 2B5VA 3PJDA 4ZHQA 2IDKA 1ZCAA 5BVGB 1VCOA 4WA7A 4REQA 2NIPA 4LEIA 3NCTA 4WEOA 4X7BA 4HXEB 3RWBA 4L4SA 2WJ3A 3Q12A 1IK6A 1IQUA 1J22A 2PY6A 5M04A 1E79D 4TKUB 1Q7RA 3DHYA 4HDAA 4ISCA 1QG2A 4JL6A 3UANA 4O5OA 4JLMA 2H2FA 1G0OA 3ND5A 1TRKA 3OLYA 4XARA 3VZQA 2QS9A 2M6SA 2QUHA 2J0EA 3R0JA 2GF9A 2R2GA 1DAPA 1FS4A 4IX1A 1BEEA 1W94A 3A70A 3ZWCA 3AFHA 1JG1A 2ONZA 3ZDZB 1Z0FA 1N3BA 3R0QA 5I9SA 2EFCB 1CY8A 3K31A 3VYTB 3RVNA 1Z18A 4ZALA 1MB2A 3OCYA 2ZIXA 2ZUCA 3FMGA 3U7FB 1WB6A 1XDZA 1M1UA 5B58T 1W2WB 4NZZA 1HFKA 1Z5WA 1QVAA 1IM8A 1T4CA 4FOTA 1OGYA 2VA8A 5CBPA 1ZC4A 2ACKA 3F2IA 5A5FA 1N7JA 4TVOA 4JLUA 1DBWA 3G59A 2IHTA 2JCVA 5FP0A 4J9UE 4UAGA 3JQ9C 1IB6A 3OM1A 7YASA 5HYVA 2VHTA 5BSWA 1MX3A 4XCQA 1J0BA 1QNFA 2CHEA 1E1QD 3RE1A 3ZNQA 5FI5A 2V5AA 1E2EA 2Y1EA 2C1ZA 4DBLE 2O8BA 1CQWA 4RZ3A 1NX6A 1J0XO 3A2LA 2B7CA 4FB4A 1L8QA 1S4QA 3IEXA 3AG6A 2IHYA 4J0GA 1SK8A 3DXFA 3CXUA 3HCAA 2MSWA 3AZPA 5BNIA 2HA5A 4UNSA 4D9HA 4A5SA 2AFVA 1IN6A 3NVAA 3EUFA 3ZWPA 4ZCRA 4I4TF 4RLSA 3FW1A 1T5SA 2X0JA 4BJ1A 3QLUC 5CDTA 7REQA 2C07A 1REQB 1U0NA 2C1XA 3DOCA 1N5MA 4G3XA 3D0QA 4X1YA 4EUNA 5CDYA 3KB2A 1NBIA 3SOZA 3BXPA 1CQIB 3NTUA 3DE2X 3WO1A 4U2DA 4X54A 1D2MA 1SD5A 2F67A 4Q12A 2NN3C 3B60A 4OHCA 2PS3A 4D4JA 2R47A 3PUVA 5C53B 1H9AA 1ND6A 3FPEA 5AKYA 3F74A 5AI4A 1E3MA 2P27A 1NSFA 2GCIA 1JVNA 3VDNB 1XCLA 3F5QA 4CM1A 2XT9A 3TQTA 1Z5OA 4I4TB 1LBHA 3PQ5A 3T3DA 5B1EA 1Z6TA 4P32A 4LSGA 1GZSA 3DP7A 4DLUA 1UBFA 4GR5A 2WF7A 3E9NA 3OE7D 4F5DA 5GV7A 5FWXA 1ECBA 2P9JA 3IRUA 2I6XA 3OE1A 1YRWA 5C8YF 4TS4A 1D2EA 5LFAA 3IOCA 1PJCA 4OV6B 4R2IA 3ETHA 2REOA 4E46A 1RACA 4TT3D 2H9YA 3LF1A 2VNSA 3QLTA 3BRSA 1SHJA 2Q49A 1CUIA 3T9AA 5IMSA 3K15A 5DYYA 3KQQA 3NQ41 4ETIA 2QY9A 3VAAA 1D1QA 3IJ5A 1FYFA 4AMUA 5KOHB 2DUUA 2JCSA 2JH8A 3PIRA 5BUZA 3N9IA 2XYVA 4WDRA 4HLUC 1PAUA 2FYTA 1EFPB 2VHVA 3G8CA 3L46A 5LNK6 4Y2UA 1NI3A 1P3JA 3F8WA 3AKZA 1OR8A 4DT1B 1GPDG 5C8YB 4ZD6A 4RMGA 1HZZA 3UOAB 1E4OA 3PLAE 4GKVA 3H8JA 1HT1E 3K8ZA 2DECA 1Z34A 3COWA 2RGRA 1E2KA 4NZ9A 1WD5A 2BHRA 3RNOA 3WY9A 4DIOA 4TYWA 2VDWB 1RJ9A 1SCNE 2R3SA 4L5YA 1CETA 1QG4A 1K8RA 2FEKA 1I7QB 1CP3A 2C7BA 4BNDB 1RKXA 3JAKB 4GOOD 5ALYA 1GZ4A 2ZT8A 3DUFB 3KJQA 3LKVA 4EAQA 5JHHB 1KEKA 5REQB 4LNUA 5IN4A 1K92A 2QNRA 3CF2A 2XXBA 3DPSA 4HS4A 4B0OA 1JH9A 1MAAA 5AK3A 3GFVA 3IQXA 1W2GA 3ZYZA 1OD6A 2EGGA 5JADA 4DC0A 1HDXA 2DT5A 4Y0AA 1YT5A 4XW2A 3AX6A 3DTNA 4MUJA 5DK4A 4LTNA 3DDWA 1PJ4A 3TLAA 2GPTA 2YC4C 4KH0A 1ZW1A 4YGYA 5SYMA 1EFAA 1XI2A 2ZJOA 1J8MF 3H2GA 4LMPA 4NHEA 4TOIA 4DIUA 3IAAA 4DSTA 4K6OA 1V3VA 1L9KA 1XRJA 1KR5A 4P7KA 1E5VA 3H04A 1SVMA 2RHBA 3C85A 5FFNA 3CC8A 4G5SA 5FOTA 3MXOA 4XDYA 1PKEA 3VJRA 4FOPA 4NL4H 2VATA 4MH0R 4M7OA 2QW0X 3Q10A 2WINI 5EZSA 1LV7A 1O9BA 2PN1A 2JFUA 2ZYRA 4Z6KA 1HLPA 1CUYA 3UJ6A 1Y6ZA 2ABWA 2NZ2A 3TGWA 2C99A 1WDMA 1XDBA 2I4IA 5G4KB 4E4YA 1WTAA 2XTMA 3NTXA 3F46A 1QHYA 4XM2A 2O8CA 4YRJA 3PNVA 4ZVKA 2PRSA 3DWGA 2PLWA 4I66A 1KC1A 2R84A 4REOA 4AG6A 3TNFA 1VI6A 3ODPA 2IXFA 1KO4A 3TH5A 3QLJA 3DCNA 3I3OA 4RJIA 5AJUA 2OYCA 1RJWA 1UFKA 2VAVA 2A9KA 4QQKA 2GBPA 3UFXB 3RFFA 4MARA 1NOJA 3KLBA 4KYIB 3Q7EA 4RZSA 3UMSA 3VNBA 4B87A 4IMJB 3QHPA 1NP6A 3BMCB 2WG1A 4KQWA 4XYMA 3F9CA 5IAJA 3E5NA 2MCFA 2ZRLA 4LXTA 1O94A 3I83A 2QNIA 3BYZA 4MB2A 4ML3A 3PT9A 4OHRA 5DN6A 1UUFA 2NYUA 1SOWA 1C9KA 1SUCA 2DFKB 1SCUA 2YJ3A 1DT3A 3JD4A 4LRQA 5FTNA 3FDFA 2PZFA 3JARB 5JU6A 2CLDX 3HP4A 2O8EB 2VDUE 1N77A 2XLCA 2UUAB 3WHPA 3GDWA 1PL8A 3LHDA 4DHWA 1K6IA 2CFIA 3SQWA 2IPMA 1A5BB 2C9YA 2W43A 3QVKA 4JMPA 1FQWA 2WJZB 5JNRA 3D1JA 1M54A 1Y6JA 2ATXA 4A1FA 4EYGA 2KQUA 3OFKA 2D06A 4Q7KA 3NC0C 4RGYA 1Z2NX 5EKXA 3PFIA 4HAVA 4URFA 4GKKB 1MIOA 3K4HA 3E9DA 3UM9A 4MKZA 4A92A 4C6TB 4GPD1 1DWQA 4DJ5X 3H5VA 2OQVA 4ZGBA 4HAWA 4MMYB 3I1IA 3I62A 5IT5A 1T2CA 2BI7A 3N8DA 1DQRA 3JAWA 1Z5VA 1LS6A 3LYUA 3NORA 3EXG1 1W48A 2GFQA 4R05A 3SF0A 2Z95A 5ARDA 1KDYA 1I33A 4HWRA 1VMDA 4LYAA 3RT9A 2JAHA 4Q7JB 1S89A 4DLTA 3EGDA 1YJCA 5GZ6A 4UHFA 2XKKA 3SEAA 3P9YA 2DFNA 4YDQA 5HUJA 3IQEA 2VZ9A 3Q7SA 4HBGA 4E09A 2VF4X 5AXAA 2COKA 3D5QA 3U4HA 4F91B 2DERA 1OH8A 1C7FA 1Q2UA 4QRIA 4OH7A 1D09A 1MABB 2V45A 5E6SA 1PJ3A 3HO8A 4F3YA 1BRMA 1GXSB 1P9OA 3FD8A 1J9EA 1GCGA 3B1YA 4AN1A 2IOQA 3GEIA 1F6BA 1UK8A 2FDXA 2VLBA 5E4TA 4TVSA 1BDHA 2GHIA 2H06A 2XNSA 1JG7A 5DHSA 3ZE1B 2IBMA 2VPPA 3REFA 1PF7E 2IZZA 5B7GA 2IBSA 3DZDA 2HYIC 1KAHA 1IAVA 3FSGA 4KK3A 3MNFA 2ZPUA 4OUDA 3MWLA 2IXTA 1K3UB 4BVJA 2Z8XA 4L6CA 1GPLA 1V16B 1PZMA 4EMTA 3N8GA 2ERXA 3O74A 3S27A 3M70A 5KNCD 3C3AA 2VPYA 3GLFB 1Y1PA 3LU1A 1GDHA 4X63A 4I6GA 2PO5A 4BVFA 2IS6A 4FMBB 2FR0A 1SOUA 5J58A 3UMMA 4PYKA 5JANA 1F8XA 1FFGA 2PDAA 4LZAA 3VGJA 4R0MA 4MO2A 4PBRA 1P2TA 3PV0A 4UVEA 5FBKA 4HDNA 4AX8A 1F7UA 3A6FA 3ESBA 1T2FA 1EK5A 5A7HA 4V0RA 1GLGA 3NKFA 5JCJA 1OH5A 1OASA 1BE6A 3DMGA 1PNRA 1FSZA 4PQFA 3V2HA 2BJHA 1M8PA 1I4WA 2ASVA 3D6MA 4EZBA 2WABA 3HBLA 1U0SY 5K8LA 5DP2A 1SVSA 3O3OB 1HL7A 1P0MA 3TB6A 3C4JA 4AKEA 1ODTC 3PFNA 1QH9A 1T6BY 2HK9A 2PQ6A 3GQBB 2ZRKA 3IP9A 4QOHA 1ZMRA 4TWRA 1ODCA 4B6GA 1KEEB 3GA7A 1DIAA 3KEFA 4OXYA 1BZYA 3I73A 4W5HA 3HUUA 1JU3A 3DEHA 1QSGA 2AMYA 2E3JA 2JEYA 4O4LF 3EODA 5LZ5A 1KO7A 1PJTA 3TCNA 1S2IA 2BFEA 4MP6A 2PLAA 3UF0A 1NW8A 1JSCA 2YCBA 3KDPA 3H84A 4KIWA 3SZ3A 1XRSB 3FKJA 4GAEA 3QW2A 3H9JA 5CLLA 1HSOA 4D5EA 2XMQA 3VKHA 3CZMA 1ZGJA 3JQ8B 1DI0A 1OLSA 5IT9A 1P6UA 2Q2QA 2IUEA 1UMDA 2QUAA 3VBEA 1UCFA 3NIFB 3C5HA 1SXQA 1T0JB 3JD0A 2CLHB 1I2AA 4QUBA 3RUIA 1EM8B 3V00A 1N2ZA 4F1KA 1OBCA 2CLKB 3BJIC 4JXJA 4ZIRB 4ZYVA 3VR5A 1SVOA 5C4IA 4O4LB 2EW2A 4LJ5A 3T9FA 1X1DA 2B5OA 1R6VA 3SSOA 1L8OA 2FEAA 3FJ1A 5AUNB 4JP2A 2VPQA 5BN3A 2I99A 1AUVA 1XF9A 2E5FA 3E35A 3NWJA 4H1WA 2DFLA 1Z37A 4AG5A 1QU3A 4E0BA 1PTKA 2VDRB 1ZN7A 4FCWA 1BH6A 4Q3CA 3TW0A 5TQJA 3CEAA 3UWKA 3ZKWB 4DDVA 1GTJ1 4TGLA 2QTZA 4KXLA 1TJ5A 2FW0A 1DAMA 1EE2A 1N8KA 1RM5A 4GT1A 4WFKA 5E4JA 4NYIR 2ASEA 1D6JA 2D59A 4R7GA 1N9GB 2OBNA 2WIKA 3GEDA 3U60B 2I8CA 3WK4A 1E3TA 2C5HA 3LF2A 1UBMS 2QJTA 3IL2A 1T9KA 1ZHFA 3K1TA 4KPUA 4TTQA 4CM6A 3IUBA 3ZXYA 1DRJA 1G21B 1D2CA 1Q84A 3SCZA 4AJPA 4XEUA 3VPCA 1G8MA 1NXSA 2D1SA 3ZHUA 3BB1A 4RVCA 3CSUA 2XQFA 1JR2A 4O2AF 2G0NA 4X90A 3PT5A 2B8EA 2G9ZA 4PONA 4ZVOA 1JEYA 3L77A 3QTLA 3RG2A 5K45A 4R7ZA 1XTBA 2H4HA 2F43B 2H5JA 3DW3X 2QL5A 1I1OA 2QRVB 1FP6A 3W5SA 2GN0A 4BB0A 4BKPA 1SUIA 1TJ3A 2VQDA 4D97A 1OKKA 3OZDA 3W3AH 2HMTA 7ABPA 4YASA 2H7XA 4UCWA 3O1JC 3RTBA 1VMIA 1J8VA 2LBPA 3WLOA 1PX2A 2OVBA 1XTVA 4DSUA 1ZH6A 1NX9A 1ZOLA 3U3DA 5EP3A 5B2EA 1DGQA 4O2AB 4MZXA 1KR2A 3I2GA 4AWXA 3BXFA 4FMPA 4D41A 2PSJA 4RM3A 4GGPA 3IP5A 2A3RA 2OOSA 2WSMA 1Z68A 1N8SA 1J7JA 3LVFO 3O4IA 1XCOA 4JU9A 3S4YA 4AZ0B 1P9NA 1GNQA 5JJIA 3ILHA 4LZJA 3BJEA 4X6UA 3I76A 2AJLI 3QF4B 3QKSB 3QSGA 5FA8A 1KEUA 3MIIA 2PUBA 2WHQA 3ZHYA 4IGKA 1QS0A 2DSTA 2JJQA 3SPXA 4BQQA 5LDHA 4FYJA 4BY9E 1CQZA 3UMRA 2ZJFA 3WLFA 2CNOA 2GKGA 4ZANA 2EIXA 2AXQA 2NWQA 2Y92A 3G82C 4RVSA 1BX1A 5K7SA 2ACWA 1NDHA 4QGAA 4AJ1A 1ZAKA 4RWEA 1BE8A 4I1UA 4YTEA 2KLHA 3GEEA 2A0KA 2WWIA 3BAFA 4Z2YA 1C81A 4WKOA 2VP5A 2GVNA 3FRHA 3CH5A 3DOIA 4XDGA 5IULC 1WDWB 4H18A 1Q0PA 4IS3A 4G26A 4B32A 1JJAA 3EVNA 3R2JA 1P3DA 1C80A 4OG2A 2W2OA 2BDTA 2OV1A 1NKTA 3FIJA 4ENWA 2HLDD 3CQ9A 3WK6A 3DL2A 4PR0A 3BXGA 3R5TA 5AVUA 2H1VA 2X8BA 1V45E 1DAHA 2Q3LA 2YOHA 3OJFA 2FN7A 5A4DA 2B69A 1NW9B 4N4AA 1CUVA 2BH9A 2HJHA 3BIWA 5ALHA 3F6SA 1OBVA 3E03A 2VZEA 3WWOA 1G38A 2AIRA 4RSHA 3S5JA 3U3RA 4O4JA 5IXSA 3SP1A 1L7PA 1YQ9A 2CF5A 4D9NA 2E4YA 3M83A 4JCCA 2ZTHA 4C21A 4XM1A 3QOFA 4D9FA 2EWMA 1WKVA 4OSPA 3HKEA 1GTL1 1QVVA 1L4MA 3A6EA 5K3EA 3O91A 4DVGA 3ZLTA 3QOXA 4TMFA 3WGVA 3ZWOA 4CEIA 5B30A 1B74A 4MR7A 3WAKA 4Z4FA 2EKQA 1FDWA 3ZGLA 4BGVA 1FYDA 1LPPA 2EQAA 3FH0A 4GSKA 5KDOA 4MQLA 3EDRA 1F12A 1SIOA 1M34A 2BTQB 1T4BA 2VT3A 1Q7CA 4Q1AA 4U39A 4I5FA 4IH9A 9MHTA 5CCBA 4MWOA 5DTRA 1CUUA 1RSZA 3EVBA 2D7CA 1G6HA 3K9CA 4UTVA 1T1RA 1L4FA 2ZSBA 3IMCA 2A86A 5M2QA 3O4JA 3PFWO 1P7PA 4G67A 5IS2A 1H69A 2VPIA 3TQOA 2W0SA 1Y4SA 4OQFA 3CVWA 2AS0A 3Q3JB 1KI3A 1JFTA 1HLFA 3VPSA 4P34A 4AQDA 3HB9A 4O3FA 1YZUA 5M3BA 1KJ9A 3IEIA 3DE1X 3W1EA 3DBVO 2QL9A 4R1MA 1XCPA 2BN4A 3SYMA 2J41A 1P3Y1 3EC2A 3H05A 4PIMA 3SSNA 2GEJA 1N0WA 3HCEA 3VSAA 1IJEA 3AP3A 1M8FA 4YS6A 1GKIA 4L51A 4G97A 2BGKA 4TYYA 4OGWA 2P90A 4L72A 5EI5A 2GBLC 3REOA 4EH1A 2RDMA 1XZIA 1K6XA 2I4TA 3S5UA 2VQFB 3EJ6A 4TQGA 4LCEA 1IAQA 1T43A 2HD4A 3T5PA 2WTXA 3QM1A 3W05A 1GZ3A 3RJ9A 1W73A 3ZJYA 2PS1A 2ZAIA 4DDWA 4YP6A 1B76A 5IF3A 2PMDA 4PTYA 4HVCA 1H4TA 2O6HA 2VDVE 5A9SA 1LTKA 4R01A 4C03A 1PK9A 2BGTA 5JLAA 4P4NA 1Y37A 2HRZA 1QE3A 4B7AA 1GNSA 3BERA 2YWXA 5E3HA 5KS2A 5K8UA 4QBGB 1NYQA 4OM8A 4XWGA 2GKSA 3GJZA 4J7XA 4TYNA 3RBAA 3L07A 4NJMB 3VPAA 1P74A 2PRYA 3R23A 4X0EA 4X00A 4I5EA 2I9KA 3HYRA 3OQJA 1BOFA 3C6ZA 4PRYA 2ZR7A 5GAJA 4KXNA 4EVRA 4ABTA 4IDBA 1E59A 1I4TD 2PIDA 4KQHA 1KBZA 4D9GA 2XF2A 1EDDA 2P9HA 3W1WA 1T24A 4J3NA 1SU8A 1SU4A 4MIKA 4DQLA 3IEUA 4E08A 5ILQA 4YHBA 4JLBA 1JJBA 4B71A 4F5ZA 1FDUA 3S70A 1XL1A 1NDUA 4BJ5A 3FOZA 4ZAFA 3FYHA 3PC8C 5BSUA 1U0BB 5ALOA 4XIYA 4MMZB 1T2DA 1SKBA 3DWFA 1PLLA 3IESA 3MJSA 5AM2A 4MQUA 3GDGA 1XOIA 3TTSA 2QEQA 5MN5A 1YQQA 1G18A 1WXFA 2XGOA 4DDTA 2ZSHA 3R76A 1MO2A 1DRUA 4JJ6A 4G37A 4IO1A 3V1LA 3ENWA 2ZUFA 1ZGBA 3CKLA 3DTVA 3QLEA 3QZUA 4JB2A 5CX1B 2OXIA 2NYVA 1VYUA 2XSZA 4ZVSA 1RZUA 4OXKA 5K8VA 1U9YA 2W2KB 3WSVA 1G0NA 1M5UA 1Z36A 4YP5A 3Q8LA 1HE4A 1RVDA 1C0LA 1PQ4A 4J1QA 2WM9B 4B6FA 3SQDA 3QNMA 3LPAA 1XEWY 2O0HA 3TLEA 1I7SB 1OLUB 1O4WA 1AK9A 3G02A 3DZHA 3O4HA 5L3ZA 4XLLA 1WD7A 3FLAA 3VX3A 3HG7A 3QFSA 2D8MA 3R20A 1FL9A 4PPNA 1GADO 4TQ9A 2FWAA 4PG6A 10MHA 3ZE2B 4OA8A 4EX7A 2YIVX 2MSEB 1QBKC 3LBHA 1C1XB 3W7AA 4YRBA 4AJOA 1UKYA 2PX3A 2OUKA 2ZI9A 3AR3A 3WX0A 2FHSA 2PH7A 3CX4A 4KVAA 4QQFA 2HA7A 2R44A 2XTAA 1E7WA 2A7QA 2E18A 4DY6A 5F98A 2CXQA 2OGZA 1CRWG 5AKGA 1CY4A 4N12A 2HIGA 3SEZA 4DE5A 3R1IA 2VSNA 2EQBA 4TLDA 4EKGA 5LYJF 2NPFA 2DPYA 5C1PA 4WJZA 2A9VA 4PN3A 5JZMA 1SCKA 1XTRA 2NM0A 3D6UA 4GC9A 2VDLB 4DBLC 2ZXFA 4IYRA 4EVSA 1M2OA 3AYZB 5SZHB 1JSRA 3F6EX 2A30A 2VYCA 1NP3A 3EARA 4XDHA 2YBEA 5T4EA 1J24A 3EASA 5E9WA 4FOOA 2JANA 4P6VF 4YN3A 4BMNA 1W52X 1IXYA 2A9RA 1PQPA 2VYFA 2V4ZA 4ZAZA 4GBGA 1Z26A 5JFOA 5KZMB 3LYHA 1JLLB 1GQQA 5LM3A 1WMFA 2BGLA 3PHLA 4HAXA 4OL9A 5LYJB 2W2NA 1NUQA 4FXOA 2EYUA 4EHDA 3R7DA 4ZK2A 3D4OA 1OFHA 4DM4A 4GNRA 1J9GA 4UDXX 1UEJA 1CR1A 2EXXA 1UP6A 4G5QA 3LHIA 3S2FA 3A31A 2MR6A 3CBGA 2C04A 4PPQA 5A5DA 1WDKA 3OTWA 1TAHA 4YVFA 4D56A 5KTSA 2YMQA 3ZD8A 4RFSB 3F3MA 3IHLA 3BFXA 4EFKA 4GI2A 1RBQA 4WL0A 5JSZB 1FRVA 3H2KA 4RKYA 1DBRA 1XX6A 1BN6A 2OZEA 5CJJA 4Z7OB 2IEGA 5H9VA 4X60A 4L8WB 4OIFA 3BMQA 2R8BA 1JDZA 5K51A 3GUCA 1CCWA 2QWXA 3A3OA 3AEQA 3HZZA 4JSTA 1IN8A 4BFWA 1J6UA 2ODTX 2HK8A 3ICVA 4MPDA 1CUZA 3K9FC 4GLOA 5ADUS 4DZRA 1TCVA 1G7TA 3TTXA 5JEEA 3FPAA 5JAPA 2IS4A 3B1KA 3IPCA 3Q2OA 3AJ8A 3UMFA 4ZICA 1FIUA 1L7DA 4PZAA 1ZN2A 5F9MA 4RL6A 3CH7A 4WNIA 5CR9A 3SHFA 3RTDA 2EJCA 4AIRA 4P4SB 3FOFC 1AKTA 1RWPA 1NRXA 3PC3A 4PC1A 1FP7A 4EG6A 4IIDA 5F78A 3AQIA 3ZBPA 1V1JA 5HZHA 3MAAC 3HZHA 5J2TF 1NY6A 3UKJA 2X7HA 3M9WA 3H2JA 1HYBA 1YV9A 5AJZA 3M3DA 3JVDA 3CSSA 4QE3A 3VPXA 5JNSA 1V1RB 3M6LA 2YIDA 4ZRMA 5LD2C 4KZKA 1Q21A 2WU1A 3CTPA 2FPGB 4ZOEA 3A6JA 3NETA 2VHXA 3GD7A 3VYWA 3QELB 1R4NB 3KEMA 3QE9Y 2H17A 1KJNA 1NW4A 2NVBA 4KLAA 4EB6A 4R0VA 1QCCA 5EJIA 3C7AA 2XYRA 5MHTA 1Z28A 3UXYA 1KHHA 2PCLA 5J2TB 4ALNA 2J30A 2Q8QA 2YHAA 2YRWA 2JJ8A 3A11A 1BH2A 3B1VA 2VTDA 4JEHA 4LY6A 4FFRA 4CMJA 3ELBA 1GUDA 2HGZA 3IUSA 3PIDA 4HG2A 1WXIA 5G3ZA 5K3SA 3RUDA 4ZYWA 1LSUA 4M83A 4JB8A 4V0ME 3B70A 2OC4A 3IHWA 4M9RA 2R62A 4CCYA 1TPZA 4KP7A 1PGPA 2O2JA 5ALSA 4ZVUA 3O1HB 4RHXA 3EEBA 1SBNE 1AIPA 2O1XA 2ZROA 1CZNA 3A6KA 3MTBA 3OEHD 5F4ZA 3UBMA 1G16A 1N2BA 3G5MA 1U0JA 1XVAA 3FUUA 4OHUA 1OYWA 5EWJB 4Q6WA 5C7IO 3UICA 4XLZA 1G4UR 1V4BA 1RLIA 3FMPB 4HAIA 2EZ8A 1WDLA 3PZBA 1U7WA 1U0OC 4PICA 3SC6A 1W88A 3PA6A 3EDYA 5I4BA 1HV8A 2GAJA 3C98A 3O0TA 4HO1X 5H4GA 2WIJA 2O0JA 3C6QA 2YMPA 4NCKA 5J2UF 1H1DA 1FNSA 4PLVA 4TX1A 4CM3A 4CIAA 3A1CA 3LXMA 5DYNA 3SE0A 4M3NA 5IVDA 4FI3C 4O8ZA 4RHFA 5G0UA 4C7XA 3G7SA 4M9SA 3SKXA 2X9LA 1NBEA 3DAGA 4P5DA 1ZIYA 1RYDA 4BKRA 2X14A 1NXOA 3QPWA 4Y6RA 3HO6A 1J0EA 1BU8A 1P5ZB 4BNHA 2H6EA 1SVUA 3E9QA 4GICA 3SVLA 3ECAA 4KX5A 3LQYA 1SCJA 1I32A 4B81A 1N8TA 3T4EA 1UPCA 2PO7A 3NHUA 4XGQA 4DADA 3THWA 4RDIA 5JQGF 5J2UB 3G9TA 3MINA 5EJ2A 4AJ2A 4HRYA 4F8JA 5IXJA 4F9EA 5EVCA 2ZRGA 2CLCX 4W1QA 2ZTUA 3GARA 4WQMA 5KHLB 1QKIA 3TSAA 2HU8A 5ADWA 5FLKA 1BW9A 2YXLA 3KRTA 3IUMA 3BFJA 4CTJA 2B36A 2YNMA 5B1YA 3CLUD 1K6JA 4FNOA 1GILA 3A9VA 1Z7WA 1JJ7A 1E6MA 2C4UA 2SICE 1ORWA 5IBRA 2Q45A 4N0DA 2CMFA 4DTIA 1U6KA 3SICE 2YR0A 2OFFA 5JQGB 3ZVNA 1Y6RA 2FUG1 3KPYA 4IJWA 1JKXA 4Y67A 3AU8A 4CVNA 3CE9A 1BWPA 1ID8A 2DOKA 1DEKA 2EARA 1GTVA 1Q95A 4IDFA 2EGHA 2J32A 1JR3E 2FZGA 3T8YA 2WICA 3ZIAA 3RRZA 1AGNA 5IC4A 2RCNA 4C0XA 3DEFA 2XCSB 2B78A 3P94A 2XXJA 2QPAA 3RT7A 3PXCX 2Z6VA 3IGFA 2FAXA 4PSCA 4PSDA 5DVZA 3SDSA 5CA1A 4MYSA 3ZV4A 1KMQA 1UODA 2IYSA 1TUIA 3W6ZA 1JAZA 2JW5A 3DOJA 4D3DA 2A6PA 1NQTA 2AX3A 2QAGB 3UB2A 4C5CA 3KXIA 2ZR9A 1UZNA 3A26A 1ISPA 1IDOA 2V5UA 4BQPA 3ABZA 3L3BA 5A3SA 4DA7A 1J0CA 1H23A 1XZCA 3I2IA 5LWHA 1QOPB 2GKOA 1BNCA 1UKAA 1I2BA 3O4FA 5TS3A 1E5QA 4D6PA 1Z0KA 4EBFA 1M75A 5BWCA 3KT6A 3UC9A 1ZD8A 2QXTA 2E82A 2QJFA 5L7TA 1WEKA 3PCTA 1Z5GA 4ZTZB 4DLZA 1PYOA 3SHVA 1UZMA 4N7RA 2JGDB 3TD2A 1RI3A 1G3IA 2IY9A 3F7MA 4B4UA 4ND8A 4QC2A 1V11A 1HT2E 1N0IA 2IU3A 4HWPA 2B4KA 5IKMA 3U3MA 3VSEA 4WNCA 2NVUA 5ERGB 2YVLA 5JMTA 1RHKA 1LWNA 1NLYA 2GN6A 1NMYA 4TTPA 3RQSA 4EG3A 4ZTBA 1YJAA 3BFKA 5F7OA 1WW3A 3DE3X 4YQEA 4MGYR 1JTVA 2VHZA 2WY2D 3R8XA 3ZWXA 5CFOA 2BHTA 2VRCA 4CMBA 1JA0A 5C18A 3MFQA 2GZAA 2AYXA 2IK8A 1WPRA 3BTOA 3E2MA 3FMOB 4MIYA 2ZQZA 3QY0A 4NHOA 1UC5B 2XNJA 2G28A 3C3CA 4M46A 4Y2VA 3BTSA 1B8VA 2CLSA 3L8EA 1KAGA 3LO8A 3T7AA 4GBJA 5AHRA 3CKKA 1XVIA 4RPIA 4HT3B 4RJTA 2NP6A 3D0KA 1R9GA 3IVGA 2Q6LA 2WP0A 1C0EA 4J0EA 2ZYDA 3CR7A 3NHFA 4MVJA 3IP6A 4CQLA 3LWBA 2MSLA 4RHUA 2W90A 3DBOB 3TQHA 1G2IA 3UYLA 4D9JA 4JX8A 2A7XA 3N2KA 3RUFA 4OF4A 3C7CB 3N2GB 1L6IA 1QO7A 4E5UA 1WSAA 2FPLA 1K3TA 2EWWA 4R98A 3E5MA 3QK7A 1HZJA 2FRVA 4ND7A 5AVYA 2Q6IA 3VPHA 1JDPA 3L92A 3V32A 3EA0A 3DFUA 5SYAA 1XZ8A 4AI6A 4UQOA 2ATCA 3A6HA 4BPRA 3BHIA 1AV7A 2IGTA 2J87A 2WC1A 2RC5A 2G82A 1UK7A 2FPIA 1A50B 2IY7A 4JBNA 4KLCA 4ZRDA 2MTBA 5KAMA 4Q5IA 5LMCA 1IULA 5AW8A 3H2SA 2QE7D 4I8IA 5AQ1A 3ZDAA 4JWTA 2O8VA 4II3A 2WVAA 3D02A 4U7PB 4MV4A 2Q2OA 1UXOA 2R1TA 2WHPA 4DM3A 5JXJA 4DV5B 4O6VA 5TGZA 3UOGA 1O87A 4CXMA 2HWUA 1Y98A 5C5CA 3PWKA 4U7GA 1PJRA 3A6PC 1P91A 4TTRA 1YS9A 3NGXA 2PSFA 3DZBA 4DILA 3VTFA 1U7DA 1SZJG 4LF5B 2BFBB 4US0R 3UXMA 1A9XB 2BSQA 4KN8A 4OX9B 2Y1WA 2W71A 4D82A 3RRJA 1K1EA 1M3SA 4A26A 2JIQA 5U4XA 2VG8A 1ZOOA 4WASA 5JOQA 4ZODA 1H2XA 1QKKA 1YJXA 2P3LA 2GI4A 2YFHA 3MTGA 5TPZA 4AULA 4DQXA 1PEYA 4B6QA 4TMKA 2XLBA 4BNLA 4U7DA 1IHUA 1Z4QA 4WH0A 3KVRA 1BVUA 1XEXA 3HYNA 2IJGX 4J49A 1SD1A 2PV7A 2IIQA 1I6KA 3NM4A 4GKBA 4DV2B 2Q0HA 4DV6B 5DHFA 4OKNA 4N6OA 3H4MA 5EPUA 4QAQA 1JDUA 1KFJB 1U2QA 2FMIA 5JDIA 4NZYA 4V2UA 1YMUA 3K5IA 3KU4A 4E4TA 2ZTVA 3TTWA 1DFGA 1RIIA 1BIFA 3OQ6A 2R8OA 4HTFB 4NJEB 4XSGA 1J33A 1UT5A 1X8JA 2QRGA 4NBWA 4OQXA 3G6KA 1SUWA 4DV0B 3ZZNA 4RJ2A 5EPEA 4UHJA 3MM4A 1J20A 1AO0A 1IRIA 3AV3A 3HMQA 4IL5A 3QQ5A 3O4GA 2EX1A 1XD9A 2PRKA 3L41A 4QDXA 2D2EA 4DREA 3OEEA 4YCNA 1Z88A 3BCSA 5GV8A 1CNMA 4JOSA 3DONA 2F4NA 4ZT6A 3S28A 5GZ3A 1EUZA 2NV2B 1DSSG 1N3IA 1KFCB 2ZI6A 4FZ5A 4BV9A 3ERCA 4G5YA 2G3YA 4M49A 3DKRA 5BO5A 1YR1A 3ISTA 5I3ZA 1M0TA 1P0PA 3F3SA 4EFDA 4FZVA 3T15A 4AS2A 4WBSA 2QYOA 4UVIA 3TN7A 2ILVA 3J80A 3CZAA 1B8PA 3FYUA 3QLVA 2WHRA 4ZXFA 2FKNA 1IATA 3NAQA 4LC0A 4TS1A 4FEEA 2HJGA 3PHGA 3F1LA 3LUKA 4N6NA 2BMFA 2DPHA 1L3IA 3OFND 3RI3A 3ZCQA 1TM7E 2WTNA 2OBFA 2R86A 1J49A 4HPWA 1S8FA 1LNQA 1M2KA 4ENUA 1WKCA 2VPZA 2WF6A 2XKBA 4J43A 3ZDCA 1NBHA 3EHDA 4JA2A 4F2HA 1W4ZA 2AOVA 1EG2A 4AP9A 4PZ9A 2N1MA 4H7FA 1NBME 3WNVA 3SJAA 1Q15A 4IHJF 3K6RA 4BECA 1J0DA 3GCGA 4QIHA 4I1SA 3OCUA 1PG2A 2IHUA 4UBOA 1GPUA 3QFHA 1SVIA 3G1UA 3NPMA 4XD2A 3ICPA 4X6LA 5CIYA 2ORED 4FBMA 4AO8A 1PT8A 4B6PA 1IH8A 1ZBDA 3HEBA 3HB4X 3OPYA 2PUDA 1N2EA 3DZIA 5I9BA 1YR6A 4IDQA 3A4TA 4GZ5A 1UOEA 3OM0A 3G5TA 1ZI6A 2HMAA 1FQKA 2IUFA 2WFMA 4LBYA 3T52A 5G0TA 1X0XA 1JX6A 3NYWA 5CT6A 2NVWA 3OKFA 1KEZA 4IHJB 1K5GA 1UK6A 2PGNA 1WSBA 3HKDA 4DL9A 5ALLA 1S01A 3KSRA 4JI0B 1F2TB 2DAPA 1B8UA 1KVUA 1YZVA 2NOAA 2FQ1A 3NB0A 3UAYA 3AERA 1K6EA 3KKNA 4LHWA 5LZ7A 4LRYA 1OH6A 3H1GA 4BQOA 2KB0A 3MUEA 2ESRA 1W8IA 3EPLA 1FB5A 1FCJA 1AUXA 1Y8AA 1CDDA 1RHJA 3KSMA 3O8DA 5JXIA 4YCDA 4HJXA 5BW5A 3AIOA 1E32A 2XE6A 3MRVA 4O4IA 3LZDA 1R8XA 1VPDA 1C30A 1PS9A 2XBLA 1XZBA 1ZVJA 3AVTA 1NATA 4HNSA 5C8VA 1BD4A 4ONEA 1ZL2A 1ZN8A 3SU8A 1F2DA 1MBZA 2ZVPX 4IHAA 5J5AA 4K87A 2XAUA 1VYHA 3X1DA 1OAOC 1WMEA 3I04M 1JPNA 4KPFC 1T25A 3NDIA 3R9IA 5ITVA 1V6AA 5K0FA 3SF8B 3ZV7A 1UPTA 4DLAA 2UAGA 3DULA 3FWZA 3PQCA 3VR1A 3TG8A 4QQRA 1QAQA 3S8YA 1LCIA 4RV4A 1OHHA 3GB9A 4B6EA 2GYVA 4QUIA 4RSRA 3VC3A 4YUZA 1POWA 2GPWA 1ENZA 2VWQA 1DEHA 4NABA 5KX5A 4W5OA 3NNNA 2JKZA 2YL2A 4HTAA 4NU5A 1GFWA 2PBZA 4LQDA 2PUAA 4WJKB 1YACA 4R40A 2MSNA 3A27A 4MKXA 3CPSA 3KYIB 4EPXA 4QUJA 2XD4A 3FFXA 3H9CA 4OL0A 1ZIDA 1QC5B 1L7EA 3KKLA 4KIUA 4JT4A 1JSLA 4OI2A 4GRAA 3ZCSA 5FI0B 3EDOA 5C5DA 3HJGA 3LE8A 1BWRA 3ANSA 1DEXA 2V96A 4NV3A 1JP7A 4ILEA 4RABA 4YCJA 2GK7A 4BLQA 2J07A 3ZH2A 4YJGA 2WIAA 1F8YA 2OV8A 2W6MA 1C3LA 2WM3A 4KSCA 1NQXA 4DMFA 3TZEA 3ET5A 3R77A 1MHPA 4JY7A 2G06A 4GVXA 4QHSA 1CEEA 3RC9A 3ADOA 2ID8A 4OXIA 3AT1A 1C0KA 3MS4A 4GX2A 4JVLA 4D81A 1OIVA 1A69A 4F9FA 2C2MA 4KRYA 3SS9X 1GFZA 3BJMA 1I80A 3KEGA 5J40A 3C7TA 4AAYA 3FOBA 5AK5A 1MO6A 1B2RA 1T0UA 2YZ7A 4KBYA 121PA 1M2FA 2IP4A 2XE7A 5CYFA 3TQSA 3I01M 4LISA 4F4JA 4B6OA 4DVJA 1I6WA 3JQ7A 4LS3A 4NR0A 4P4LA 1FTYA 1KZ4A 1R6UA 4G41A 1LI7A 3EXFB 3FFWA 1FTQA 1NF9A 5BN4A 2D00A 2CXUA 1JE0A 1EK1A 4HEQA 2UDPA 2XCTB 3TQIA 1HDOA 1TKRA 1XDDA 4KZPA 3V4LA 5K99A 4RV9A 2XT0A 3F71A 4Z9AA 1CK4A 2VNKA 4U63A 3RAGA 4D6YA 5HF6A 1AXRA 4N65A 2CVFA 3ZZUA 4BX8A 2BRUC 5KNDD 4IKPA 4ZOLA 4MW9A 4ZI7A 3GJYA 4XOUA 4BHTA 3NDRA 2ZEJA 1ONOA 5HIIA 3SVTA 5TNXA 4J1SA 4L08A 4CDGA 2RGAA 3W6NA 3OUZA 4CG1A 4H17A 2AC7A 5CM9C 1N32B 3JPWA 1YDMA 3K72B 4M7RA 4MHTA 5CLIA 1OI7A 2V7GA 1DLIA 4B76A 4IS2A 3RK4A 1RHMA 4LYEA 4DIKA 4M6WA 1QOQB 2C9DA 2FUG6 3E3OA 3H8VA 2WE7A 3TJZA 2AQ8A 4Z1OA 1C9NA 2BM8A 1Y3FE 4IG4A 4J29A 2FG6C 3O31A 3DLAA 1YDHA 1QQAA 2ONJA 3UTDA 5KTYA 1COWA 4AZSA 3ZWWA 5CB4A 1M73E 1EFRD 2P9GA 1U2DC 2PXCA 3AHFA 1NURA 1MJ5A 4AMZA 4H15A 4M8LA 3VR4D 4OHMA 4UQLA 2ZS7A 5KVVA 1QK4A 1ZMBA 1ZH0A 3WL4A 3GRUA 4YAGA 3FNFA 2PGJA 4PYQA 4URHA 5HF8A 5IN5A 5A3QA 5IT0A 1DAIA 2IYFA 2O06A 1GUAA 4LRSB 1QNLA 1A4XA 1O7JA 2ID4A 3DBRA 3IDAA 2H1RA 1ZI8A 2YFYA 4U2KA 2P6MA 3PEVA 5DNUA 3MCAA 4F96A 2OV2A 2ZWPA 5KWIA 2HJSA 4RK7A 2C0QA 4M1OA 1XRNA 3C3WA 1C3XA 1W4LA 3SZOA 3KS9A 4F60A 4B9AA 1TVKA 5EFOA 4NE2A 2CVZA 3MT8A 4HFNA 4UNIA 2PYDA 4EG0A 1L2TA 1MDFA 3H13A 1HQYE 2EP5A 4BO0A 4Z4GA 4IIVA 4NEGA 2DVMA 1BXRB 4GXQA 1JDVA 3MC1A 3U61B 5KNBA 3RYCA 1W8DA 2EBUA 4O29A 4D5GA 4QBTA 4NMMA 4TM7A 1X80A 2OZPA 4K6HA 3WL3A 3OLCX 2B4AA 3S7ZA 1GSIA 4K9RA 3RSZA 1L1FA 1H8HA 2ZIAA 4BLVA 4DV4B 4JYAB 4JJKA 4L50A 3MAGA 1J42A 1M2WA 2BT4A 2PD6A 1NSTA 1UM9A 3EF3A 4LJSA 1WVMA 1XHEA 3U48A 1SBYA 2O48X 2V7EA 4CN9A 1JVSA 3PD1A 2IZ0A 4KTTE 2YZKA 6ADHA 1BA3A 1VL5A 4M0UA 1GT91 1TT7A 4LQCA 3RU7A 5MN4A 4JJ4A 4R1OA 3SIPA 3JQQA 1IUPA 4YJ3F 4JBIA 4LYDA 3RVKA 3MJFA 1P7ZA 3EZFA 3RV4A 4B4WA 2OHXA 3HVKA 5T5QA 2ZULA 3TIIA 2V7QA 4EHNA 4QGSA 1HDZA 3HL4A 1NHWA 1VHWA 1VJDA 2Z2JA 3IJEB 3JWGA 1EVQA 3MZ0A 4AF7A 2XMRA 3B2NA 3VR6H 4CV1A 1EGVB 1FX0A 2FRDC 4JMLA 5AKKA 1FPMA 1DAKA 4R1LA 4Y2GA 1BHQ1 4L3OA 3MOGA 1F5NA 1C29B 1TF5A 2YMLA 2BE9A 2JIZD 1Y33E 2JZNA 3D6JA 4UARA 5D2CA 5H70A 1PBTA 1V7ZA 2Q5FA 4FCCA 2J67A 3KVOA 4YJ3B 2K5UA 4NZMA 2K7ZA 4QATA 1VLVA 5BYJA 5GADl 2I4MA 3NM5A 1RQGA 2ZW9A 3L1UA 5E2IA 3LUPA 3LIIA 3V1UA 1QB8A 2CLOB 5LB4A 1JHYA 1JIQA