4GI5A

Crystal structure of a putative quinone reductase from klebsiella pneumoniae (target psi-013613)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
259
Chain Sequence
SMKVLLIYAHPEPRSLNGALKNFAIRHLQQAGHEVQVSDLYAMRWKAGYDADDSGAPPVGEFWRPTLDSKQAFAQGTQSADIVAEQEKLLWADTVIFQFPLWWFSMPAIMKGWIDRVYAWGFAYGVGEHSDRHWGDRYGEGTFVGKRAMLIVTAGGWAEHYSPRGINGPIDDILFPIQHGMLFYPGFEVLPPLVFYRTDKTDAGQFADQCAALAERLDTLWQTEPIPFRRQNHGDYLIPSLTLRPELAPGQSGLAVHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords quinone reductase
publication title Crystal structure of a quinone reductase from Klebsiella pneumoniae with bound FAD
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Oxidoreductase
total genus 79
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gi5A00
3EYWA 4LTNA 5FA6A 4U7HA 4YAOA 1J9EA 2HPVA 3OX3A 3OWXA 2QX4A 4FX2A 4GR9A 1XT6A 1AG9A 4H2DA 1ZWLA 1SG0A 1YCHA 1QRDA 2ARKA 1AKUA 3NHYA 4NULA 2Z98A 1DXQA 4PTYA 4ESEA 5A4KA 4LA4A 1AHNA 3NFRA 5F4BA 4QOGA 3LCMA 5LLDA 5F12A 1B1CA 1VMEA 3KLBA 3U7RA 3JSXA 3FVWA 2V5UA 4PU0A 1CZRA 3O73A 3L9WA 3NHJA 1FX1A 3KAPA 4CF6A 1QHEA 2WC1A 3B6KA 3HR4A 1XYYA 1AKVA 4BMOB 2QR2A 1FLVA 4D02A 2QX9A 4QOFA 2FAXA 4C0XA 1OBOA 2Q62A 1T5BA 3NHKA 1D04A 3F90A 5BUCA 1KBQA 2HNBA 3B6JA 3F6RA 1CZLA 3GFQA 3O2NA 1CZHA 1AMOA 1RLIA 3W78A 3TE7A 2OHJA 4DIKA 1JA1A 5TGZA 1CZKA 1AKWA 1H66A 2B3DA 3QFCA 2KLBA 3W77A 1J9ZA 4CETA 1FVXA 2QMYA 4Y7CA 4QOHA 3ES9A 1BU5A 1QBGA 3OVMA 1YKGA 2FLVA 1FLAA 4YAFA 3KEGA 4H6PA 3F6SA 1V4BA 1CZOA 3N3AC 2BMVA 2M6SA 4BMPB 3OJWA 1C7EA 4YAWA 3R6WA 2QWXA 2X2OA 1WSBA 4LTMA 3W7AA 2F1OA 4R81A 3FJOA 2OHHA 2V9CA 1DXOA 1YOBA 5F51A 3OX2A 4M0CA 4C76A 1FLDA 1TIKA 4YQEA 1E5DA 4QOJA 3GFSA 1J8QA 4J8PA 5LBUA 5LJLA 4ICIA 3TZBA 1QR2A 5B3KA 3P0RA 3NHPA 1J9GA 1YRHA 2MWMA 2BF4A 2BN4A 1RCFA 2Z9BA 4C14A 2W5UA 2OYSA 4FGKA 3UXHA 4LTDA 3B6MA 2KQUA 4NLLA 1AKQA 1D03A 2FDXA 1RLJA 3FX2A 2MOKA 4ZVLA 3QFRA 6NULA 2XODA 5B3LA 4ZVKA 3ESZA 3LT5A 2Q9UA 4U7FA 3OWHA 2Z9CA 3GFRA 4HEQA 3FW1A 1FTGA 1NNI1 1SQSA 1BVYF 4PTZA 3B6IA 4YAUA 2X2PA 4XDHA 5FUQA 2A5LA 2R96A 3U7IA 1FUEA 5NLLA 1AZLA 2AMJA 2QX6A 4GQIA 4Y9UA 1XI2A 2FCRA 2QX8A 2XOEA 3NHWA 2FZ5A 3TEMA 3L9XA 3GAMA 1OBVA 1YCFA 4QODA 1XYVA 3G5MA 3N39C 3OX1A 3HLYA 1ZWKA 4LAFA 3K1YA 1D4AA 5LMCA 1YDGA 3NHUA 1GG5A 5EMNA 1AKRA 2MTBA 4N65A 1CZUA 2MT9A 2FOXA 3HA2A 2RG1A 1RTTA 5LJIA 4Y9RA 1DX9A 5EAIA 4YALA 1WSWA 3QE2A 3NHRA 4N82A 4DY4A 2BZSA 1T0IA 4FGLA 2HNAA 2M6RA 5LBTA 1CZNA 1JA0A 3NHFA 2FVXA 1ZX1A 3RPEA 3NLLA 4GI5A 4C0WA 3ESYA 3UXEA 2ZKIA 1OFVA 4F8YA 2N1MA 2V5VA 3FNIA 3F2VA 2BPOA 2OHIA 3OJXA 2Z9DA 3NHLA 1KBOA 4QOEA 5FX2A 4HS4A 4XDGA 3KAQA 1I1OA 3NHSA 4DILA 1TLLA 4ZVNA 5LVAA 3SVLA 2FX2A 3N3BC 4OXXA 3W79A 2FZVA 1X77A 2D5IA 3S2YA 3EDOA 5JROA 4FGJA 1C7FA 3ZHOA 4N9QA 5ULLA 1FLNA 2GSWA 1YCGA 4ZVMA 4S24A 2R97A 5EA2A 2QMZA 4QOIA 4U7GA 3ESXA 3K20A 5NULA 1F4PA 1AKTA 1H69A 3D7NA
chains in the Genus database with same CATH superfamily
1JHVA 1T3LA 3X1XA 4F5ZA 4F91B 1BROA 1NMSA 1RWNA 4KE8A 4KYTA 3ZI7A 3NR2A 5A3RA 4HRAA 1DLIA 2C98A 2PZ8A 2QJTA 3AJAA 4UNSA 3S44A 3RU9A 2AF4C 1TT5B 3U80A 1HZJA 3VX4A 2FZGA 2CYAA 3CEHA 4RE6A 3DBIA 2VI5A 3QIAA 1T9DA 3L8DA 5IJAA 1XT6A 1ZIDA 1BDIA 1L5HA 2IS2A 5H3CA 4S1WA 1KQ3A 3QLEA 5AW5A 1Q20A 3NZEA 4RY8A 1FDIA 4NHEA 2GF2A 2C2XA 3UGKA 1QHHB 5EXDA 1WP4A 2ID7A 4Z0TA 1FS4A 4V03A 3UENA 1V11B 1ZSNA 5CFMA 3PGJA 4XWYA 4MWSA 3KS9A 2ZXFA 3QKSA 3PXBA 4HDRB 1ECFA 1TM1E 1VPTA 3D7KA 3FPAA 5KWIA 1SC3A 4LMPA 4R9UC 4W5HA 4YRTA 1E9EA 1Z28A 5E6SA 3SBDA 2EV9A 1ZXBA 2H57A 2Z98A 4EBBA 4DYDA 1QV6A 1F2TB 1UM9B 3OIVA 5B57C 4EL0A 1A5TA 4GC9A 1YR6A 4EPRA 1RQPA 3AIOA 4YI5A 3GCWA 1DWQA 2XQVA 3TLGA 3L82B 3RTEA 4KXXA 4E7PA 3B48A 3EE6A 5TDHA 1RM3A 1IPHA 1U2DA 3UGTA 16PKA 1HI9A 3OIYA 5T3UA 3B70A 3CF0A 4CETA 3ZV4A 5IUJC 3ANSA 4MEBA 3DR3A 4RK5A 1PNQA 3KLBA 3QFSA 1V5EA 5HQ3A 5BN5B 3K8YA 2AL7A 4E2YA 2KSQA 1PQUA 2D13A 4UC0A 621PA 1Z82A 2YZGA 3GCDA 3H7AA 3T34A 4BVBA 1Z9BA 4B6SA 1YOVB 2Q29A 4K88A 1U8YA 4DUZB 2DFTA 2H2DA 3B8HA 3L0PA 4WXHA 2WUEA 5LYJA 4IF6A 1EHIA 4D4GA 2PT7A 3CLKA 4Y2JA 4DV5B 1FX1A 1IN5A 4IVNA 5EE3A 5KSYA 5KNCA 5KPDA 3K09A 1DU4A 1AXEA 3OECA 4CHGA 4DWVA 4TVSA 1JKXA 3Q9NA 1WB5A 3QK7A 3MJVA 5EKUA 4XWOA 1ULZA 4Z4HA 1TJ3A 2WTXA 4YT8A 5T41A 4PRYA 4N41A 3K73O 3K9LA 4IKPA 4YP9A 3JR3A 2H2WA 1KYTA 3HJTA 1CD5A 1A8QA 4K7JA 2PX4A 4M7RA 4QELA 3O4IA 4BJ6A 3RHFA 1K3UB 2JIPA 1GYRA 5CT5A 3FDZA 5IJ9A 2OZLB 2PRSA 1QYVA 1SCUB 4UXIA 4BNDA 4FSDA 3WGUA 2PFKA 2Q62A 4AAYA 2TS1A 2JGEA 3RI3A 1U4NA 4JLNA 3ZI4A 4RNCA 3SX4A 2QY9A 3IEUA 3BQ9A 1MIOA 1SVNA 4ZT3A 5HKLA 2GXAA 2LE0A 3ZY6A 1H23A 4B4VA 4B73A 1DVRA 2BKLA 3G8AA 4N7JA 1EFHA 2OGWA 4QGBA 3X2SA 1AMOA 4L8GA 1V9SA 2GPAA 4H4CA 3ADCA 4FJ2A 3ICEA 3P97A 1SVSA 4MUMA 4DPLA 5I7EA 1IE3A 1IY1A 5EJ7A 1YACA 4KTTE 1I0IA 3VPGA 4P32A 5LYJF 1IHUA 4GM1A 3WAGA 1MKYA 2RIPA 4I6JA 1Y7TA 4PR0A 5I9MA 5KX5A 1YT5A 4CDGA 1FYWA 5CGQB 3LGAA 3FZYA 1XU7A 2VHJA 4M88A 3OTQA 4JXJA 4KQWA 2TMKA 4P7BA 4P5PA 1JTFA 3VJLA 3WWYA 2IS1A 1T9GS 4BBPA 4CV1A 1TM3E 1FFWA 1Z0JA 3GLGB 4ZJYA 1X42A 2WPDD 1XJWA 1S7CA 2FZCA 2IELA 3A9CA 2RK3A 3CF2A 5CFRA 1XWIA 5IBQA 2RH9B 4RW0A 3I30X 3QRWA 5I4KA 1XCPA 3D64A 1ZBQA 3LX6A 3SS9X 2FW9A 4KCGA 2NNLD 4KQIA 4ON9A 4MRRA 4H6PA 3U7JA 3FPBA 3EXIA 3LL4A 5CH5A 1HZZA 1ECGA 2MYUA 2PVSA 4CM4A 3BSWA 4LWZA 1PQWA 1TJPB 2NSDA 2O8DB 1X1BA 3RADC 2VOJA 2EBUA 1GNTA 2NUPA 4XWTA 3EA5A 5EERA 2H1OA 3DVSX 1A9YA 5ITSA 2NPOA 3C85A 3MTQA 4B6OA 1F4VA 2O8NA 3MWGA 4XSHA 5BN4A 1N4DA 3G13A 2CGEA 3U2QA 1WV1A 4V02A 1VG0B 3PUJA 3NBYC 1KXJA 2WLTA 1TK3A 4H1TA 1Y7PA 4PPFA 1MP0A 1H2RS 2X7XA 2W48A 2IXGA 4UOEA 3O94A 2WSIA 2PAFA 4JYCA 2RHGB 3JAMA 3GCGA 2VDLB 4LZAA 3QBDA 2E21A 4WOKA 4AJPA 1E4EB 3P20A 4JJZA 4RMIA 5LL6P 2ZB2A 1I4OA 4PC7A 4YQEA 2JI6A 1N1DA 2EQAA 2YV4A 3HJCA 3L6RA 1AN9A 1VXOA 3H2BA 1S4MA 1UWCA 3Q88A 4GLFA 5TGTA 3QI2A 5GIOE 1O9BA 4UTNA 1EBFA 2J9FB 4CQMA 3OA0A 3WGKA 5AI9A 5JQGB 1VGVA 4EB0A 5IRCD 2UYHA 1WVMA 1T0UA 2ASEA 1YS1X 4FDVA 4MDYA 2Q1WA 2VK1A 4TMKA 2BHTA 4FFRA 3FRIA 5BYKA 2JFWA 4KX5A 3CJQA 1P77A 3NHPA 2AMLA 1RPTA 4KXLA 4PO3X 4ZALA 3VTZA 2VDJA 4YREA 5IVKA 1ID8A 4TTIA 3TJMA 4GU5A 2GEUA 5EIBC 3SZRA 1YD7A 3UUWA 4DLSA 1ENZA 1UIMA 5HIJA 2H1IA 4ROTA 4C4YA 3RAGA 2QRKA 3CW2A 4BE7B 4RTQA 1BMQA 3O9MA 1CUYA 1W5SA 1UQTA 1ZNWA 1L7NA 3MLEA 1E9CA 1OLUB 2HCBA 3ILVA 4W8HA 3QM1A 4JUAA 3VHRA 1E2PA 4AURA 2IU3A 3M6UA 1QHGA 3ZDRA 3GYBA 5KZMB 4KTVE 3HCOA 1P5ZB 5EWMB 4DZTA 2QD2A 4IDFA 3KQHA 1YZGA 1UMBA 4LXTA 1J39A 4E6PA 1H8EA 3MS2A 5D3KA 4UOQA 2VDRB 5TF4A 5B53A 5JADA 1EK0A 2EX4A 2ICAA 4KVZA 4A2PA 4JB2A 1YHYA 1OPXA 5G4KA 3A14A 4KREA 2WU3A 1MO6A 2YYSA 4D4IA 3H84A 4WXPA 3KKKA 1UPTA 2ACVA 2KB0A 3F6EX 3GQVA 4JUFA 5DPMA 2XODA 3HKDB 2JBHA 3CO0S 1IZ0A 4NENB 2Y1KA 4R3WA 5E7QA 4UM9D 1NUAA 3C1UA 3K4PA 2BGWA 1J5XA 2HMUA 4P4TA 4CNBA 1X1SA 5PNTA 4KO1S 1YWGO 2CLOB 2H1VA 3LC2O 5DI3B 5ILOA 2REOA 3N53A 2VZ0A 3F2IA 3UMGA 3QXCA 4LISA 2OORA 5DNCA 2YDYA 1D2AA 4R5MA 3QWIA 4JUBA 1C4WA 1BX3A 2GI4A 1QU3A 3G0DA 1X39A 1XMIA 1NP3A 2AOTB 2W6CX 5KNDH 1ZGAA 2CNKA 4RWEA 4AK9A 4PM4A 2BYTA 4K0KB 3ZGLA 4P7FA 4ZICA 2VHCA 2VBFA 2W6MA 3MD0A 2RHTA 4YAUA 4OFBA 4RA9A 2Y1FA 1EFPA 2ATEA 4IIUA 3NASA 1SZJG 3Q7PA 3OQPA 1DAFA 3BK7A 1PD0A 4M9ZA 1ORVA 3DMNA 3MB8A 4A4DA 2AR0A 2O0KA 4AECA 4BO8A 1TM7E 1UPAA 2C88A 4UQLA 1GPJA 3AEYA 2EG5A 3CONA 2VHUA 1U8UA 5NLLA 2XCTB 3PA6A 4JI8B 4RD6A 4RMJA 3KV3O 4XD2A 2AMJA 4OKNA 3F8WA 5D1NA 5I9IA 4L4UA 1VL2A 1VCMA 3BL6A 3GAAA 1KSHA 1U90A 3H2KA 1ETUA 2DUNA 1QH9A 3EGDA 3QE4A 1Z13A 2AX4A 2PBZA 3DZ8A 4YCJA 3ZCTA 3QEMB 2FHSA 2CUTA 1L5KA 3CKKA 3M6XA 4TTPA 1DOAA 3LXMA 4FFSA 1DX4A 1BFDA 1O7JA 3L4KA 2C8LA 2G36A 3LVRE 1T2VA 5ERGB 3THRA 1RI5A 2QW1A 4IKOA 1YO6A 3HU3A 5K3OA 4CTNA 3A2LA 3QX7A 2FEAA 3AV3A 5KOHB 1MF7A 2A7QA 4MUKA 3TZ6A 4HAIA 3EJWA 3ZVLA 3K6SA 3CR8A 1GGVA 4BV2A 4YX9A 2CLSA 2VTVA 1IDN1 4FILA 4W9NC 4A8TA 2GHTA 4WZBA 1GGNA 3GJTA 4G2NA 4PXYA 4YTEA 4C6TA 3V34A 4E3ZA 1CX9B 4WLEA 2GCPA 3ZE7A 4Z2AA 1T5TA 5D85A 1SVIA 4URVR 5CA0B 1E2EA 3N2YA 1F2VA 4XD7A 5JJCA 2BGMA 1V2HE 4YV0A 1KKUA 4G89A 3IUYA 4BNMA 4FYVA 5ALOA 3S5JA 5CYGA 2F67A 1Y6JA 5CX4A 5DTMA 3IDOA 1KDVA 5EMNA 3EZNA 1CJMA 2JI8A 3PHIA 4DHEA 2INGX 1X80A 4COOA 1SUFA 3QITA 3G2IA 3SYKA 1X1DA 1T2FA 3GLHB 4OHOA 2R8YA 5C0OE 2WT9A 4FJ1A 3COYA 5DYNA 3ANLA 4UZEA 3U4DA 4IYRA 4B33A 6AT1A 4DR7B 1NASA 3RUIA 3W9YA 1TU4A 3T06B 4CL2A 1M66A 4IIGA 4NZYA 3T7SA 4FWBA 1KNQA 4HOYA 1ODFA 4YJFB 8GPBA 1K3TA 3RSCA 3N07A 2VXOA 1NQ5A 3JALB 4EYSA 4QFDA 4P4UA 4X92A 3V48A 2OB2A 4Z9XA 2DWQA 1US8A 2OK7A 3RRBA 3VTFA 1D2MA 1WB4A 4JKYA 3DF9A 3EHEA 4GQBA 2WT8A 4C4SA 5B7GA 1EVZA 3D5EA 1RRCA 3JATB 1AUXA 3EASA 3N0VA 5JZSA 5KJ1A 4CKEB 5A6VA 1KZ9A 3QH4A 3FOZA 1DC8A 3PXDA 3O8OA 5JSUA 2Z2YA 3SQOA 5IG2A 2BMDA 3FUTA 3NTRA 3WYFA 1CZNA 2CZGA 3LO8A 4CPDA 4N48A 4LXHA 3EJ6A 3I09A 4QFCA 1MCZA 2K7ZA 3BH6A 1D4ZA 3KLOA 4RGYA 1TLTA 1GA4A 2FPGA 3R41A 5IHPA 1WZEA 4CMBA 3OZXA 4FHDA 4UPEA 5CFNA 1TGYA 2Z83A 3ESYA 2O05A 4X6LA 5EHIA 2Y2UA 4C0WA 1ZHFA 3VPAA 2LIVA 5FFNA 4P3OA 4D45A 1JLLB 5DXJA 1HKHA 4DC0A 3O7WA 5JZBA 3LUFA 3DZGA 4YRQA 3KXIA 2I3BA 2CEKA 1P18A 4Q7EA 3VDMA 2J0SA 2JNWA 2BR4A 4PLPA 1PLKA 3RAFC 1GPMA 1M33A 1TKCA 1SK9A 3MUFA 3GT0A 1DO2A 4YDHB 2RHBA 5BO5A 2GTIA 4FZ3A 3HZRA 2C59A 2J9YB 2Y6UA 1CY0A 2C5LA 1BQEA 3L07A 3MFYA 1FQJA 1O94A 1ULBA 4G84A 5KTRA 1FJHA 1U5CA 4PHGA 5ITZB 2VIIA 5HKOA 4RFVA 2VBIA 3ZE8A 2VJCA 3Q1LA 3UCFA 2Y9PB 5G0UA 2CVPA 5BN1A 2JLZA 1WHTA 2WTEA 4RIHA 2J4CA 4EP1A 1GQSA 3OQOA 3LOPA 4UMVA 2ZQZA 5F64A 4YRKA 4NZPA 1DFGA 1JHZA 3WGLA 1WLSA 3E9MA 1QS0A 2FSVA 2GS9A 3TRKA 4BQFA 2VAPA 2QTBA 2GYVA 4QAJA 1TMOA 1ZMBA 3WYBA 2CMFA 3B8EA 3KT6A 1UJBA 3TB6A 1X70A 1UC4B 4UU7A 4CQJA 1PSDA 2O52A 1U7WA 2YMMA 3PKJA 1YVPA 3ZBQA 4BXOA 3ZI0A 1STOA 5DB4A 5ALIA 2OD7A 1E0JA 1EWKA 1JIVA 3JX9A 5THKA 3E3OA 4HGQA 3MWFA 4KMSA 5AK0A 5CAEA 1J06A 3W79A 1LI7A 1FS5A 3JVVA 5DK4A 1PR3A 4E5VA 4QAQA 3EPHA 4UMEA 4MAAA 3NVAA 3IUPA 4JKOA 3SZUA 1TQ6A 1I7LA 4ZVOA 1DKNA 3ZJ5A 2AIRA 4JYMA 2A5JA 2CNOA 4PWYA 3G23A 4P6VF 4RVNA 3ZGYA 1F8GA 4UM5A 4R3UC 1I30A 1PJQA 3BSYA 4FIDA 2MYTA 4A10A 2GFIA 3GA5A 2VTDA 3GRUA 2EU8A 1FLNA 3ZUGA 1E5VA 4J0KA 1CUIA 4G6ZA 1PW7A 4S24A 4JLBA 1H6BA 4OQFA 3WRXA 4CG0A 4J1TC 4BATA 4CMEC 3CH6A 1TM4E 1DC6A 5JZ9A 2HAEA 4UHEA 4XJXA 4JB0A 2IY8A 2V7UA 5EA2A 4DMMA 3WNQA 1PDOA 5H4HA 3MZ0A 5H80A 5HIIA 1CP3A 5GPBA 1AO0A 3RK0A 4U7GA 4NK5A 2EKPA 2HU7A 3PDIB 4BNVA 1EG7A 2D5CA 4Y9TA 2HJRA 2H5EA 5AI4A 5HTKA 4JVNA 4EPXA 2P1RA 3R76A 4KKVA 4KAJA 5AOBA 4MA5A 3WGYA 3D43A 3OZFA 1G3IA 1KVQA 2GBFA 2HTFA 1N0HA 2XMSA 1HDRA 1VPEA 4URHA 1OD6A 1X7YB 3AWDA 3EODA 4MJ7A 1NHGA 4MI6A 4OA8A 5AK3A 1ICIA 4BZZA 1KWGA 2GYYA 3SC3A 4KU4A 3GMSA 4J0JA 3CUVA 3A8TA 5FBWB 4NV3A 4UJ5A 1JSZA 5CK4A 2AMYA 2B7LA 2L19A 3AVVA 4Y2YA 3AHEA 3WDMA 3IV6A 1CEXA 1PNVA 3TKLA 4KODA 3OX3A 4DMUB 2ETXA 5CXUA 3O3NB 5LZ5A 3SHTA 4E1VA 1G41A 4XM1A 3MFQA 2P4SA 1T6ZA 3ADPA 2VRCA 1HYEA 5M7EA 3DXYA 3HBJA 3ZXSA 4BC1A 3LD9A 4C4PA 3GLFE 1UKAA 2WSLA 5K4GA 2JVKA 2PQ2A 1YA4A 3UWSA 1ZD9A 1A0OA 4FD2A 4FGUA 3P2KA 3X0DA 1PJ3A 4JSYA 5AUQA 1N36B 4HNAB 5TIIA 5FO1A 5TMDA 4LOKA 4BVFA 5EWLB 4V3CA 4QDUA 3CUUA 2AUMA 4RACA 5HK8A 1F60A 4BECA 1JB1A 3A9WA 3OAAA 3NYIA 4AUMA 1XZDA 3SZ3A 3C4JA 3I64A 3OLXA 4ZXFA 3L2OB 4CLXA 3ER6A 5BOSA 5LD2C 4HLDA 2NUTA 1JRLA 3EGCA 3U9LA 4NBVA 5JLJA 1G8KA 4C43A 5C80A 2E4XA 4Q1FA 5ICSA 5K0ZA 2VWHA 3K6RA 3IUSA 3EA0A 1QORA 3ZK9A 1J5PA 3C4QA 2HB6A 3M3PA 2HQ1A 3NJ8A 5FADA 1HT3A 3AI3A 3FD8A 4OAQA 5JPIA 2HYDA 2ZW9A 3UCXA 1URPA 4WESA 3KHKA 1H2AS 1KZ4A 2KHZA 1ISJA 1M0WA 1UK8A 3L0ZA 1DGQA 4EO9A 1VHWA 4Q21A 1QYDA 5F12A 2QP9X 3N9IA 1ZICA 2Q9AA 3EVBA 4HPXB 1M74A 4QHYA 1MQAA 1MZVA 1MC5A 2JARA 4PR3A 3ABIA 5AUOB 3E3LA 2V1UA 2WDPA 3W5BA 5BVHB 1J8MF 1A71A 1QGUA 3DE7X 3GIWA 1GIAA 4EABA 1HNWB 5FLKA 4CE6A 1RWVA 1S7GA 3T9DA 4IV8A 2AQHA 4K81B 4WNCA 4QJ3A 4GEGA 1A98A 4DCSA 4WXMA 2DHDA 2H0RA 1K88A 3MD9A 3CLUC 3DVAA 4BZXA 3O1IC 4HLUA 4JL8A 4NMWA 3V7WA 1E0DA 1E2QA 3VNBA 1OZFA 1ZL0A 2ZM5A 5DBIA 3U44A 1ZIYA 2OGSA 3IUEA 3SR3A 2EZUA 3PKZA 4XA8A 2JZCA 3VKGA 3NBMA 1BGVA 1NYQA 2C9OA 2O8FB 1G8PA 1G7TA 1PI3A 2FN8A 4M4SA 4AKEA 5LQNA 4IUCS 3ELBA 1IVSA 2NYAA 3A6KA 4CM5A 4KXQA 4RTOA 3Q1KA 4M55A 4UM8B 1HPLA 3BKWA 3KR1A 4A6EA 1OXMA 1SBNE 3FNFA 5EJAA 4UBIA 1F2UA 1XMXA 2ZRDA 4L85A 3IS3A 4G3XA 1YONA 3AI2A 2WABA 4PSCA 5GY7A 4D9CA 5I9LA 2BFDA 4YJHA 4RMGA 4Y1GA 4O4HA 1XJ5A 3HLKA 4XX0B 3U61B 3G2KA 4HTFA 2Q2NA 2QAGA 3AX6A 2YZNA 5BUCA 3AM5A 5JNSA 4BVJA 1K5PA 4NCKA 2G5TA 1SBTA 4LRSB 1RTKA 4ZJUA 1YR1A 2OCDA 1PGPA 5HOQA 5GIPE 4PZCA 5P21A 2VL7A 2L17A 3A4MA 1JQ3A 4FZRA 4F5DA 1T3HA 1U5AA 1QB8A 3DV0A 4PZYA 4QJ4A 4UXHA 4K6FA 3TEJA 1GCUA 2CXTA 1N75A 4V0RA 3E1KA 4F93B 4ZT7A 3G0BA 4D43A 2ZB4A 1XDDA 2FPIA 3AY0A 2ECFA 3ECSA 1GZSA 1U0NA 3FYUB 1ZESA 2X3YA 2ZTLA 1PZGA 3IQZA 2NVBA 2J9ZB 1RABA 3P71T 4GGMX 1RE1A 1SG9A 2CZCA 3BORA 1R0XA 2B92A 2DZDA 3KUXA 3CZRA 4Y3UA 5LWQA 4GYKA 5ERYA 1A95A 4AD8A 1HDYA 3A06A 3P9IA 2B5OA 1Z6PA 4JR1A 1GFWA 2DSTA 2JGMA 3VV2A 5AW1A 3JD2A 3MOSA 4CQMD 1FXSA 2W2KB 2V0CA 1M5TA 3FAKA 4K8OA 3UKOA 4CLOA 1RZRA 2TYSB 2NYVA 4P58A 3V9PA 3H9UA 4U2CA 1UBLS 2QQEA 2X2EA 3O84A 4AX8A 3E9DA 1JG1A 2BI8A 2ZPTX 3GEPA 2RGDA 2ZCVA 3EXEA 3ITEA 3EGEA 4IHJB 3ZW7A 1R4ZA 4NEQA 3U0VA 4Q3EA 1JDUA 2G9VA 2NG1A 2JFZA 3AJ8A 2V74B 4HYEA 3R44A 4LQLA 4QUEA 5CBPB 2HMAA 4DMGA 2FG5A 2ZDHA 1B0UA 3U4IA 1G4AE 2A86A 1A9ZA 3VZCA 4JJ4A 4EL5A 3TYXA 1NI5A 1YB1A 4AP9A 1QTRA 1E18A 2A9QA 2XF2A 3FTDA 1XTUA 2F1OA 2XUGA 3B53X 4IJWA 4B40A 4BMDA 3C7DB 3HN6A 4L5YA 2UYCA 1N77A 3KCNA 2PTGA 2ZAOA 3HEBA 1KYIA 1E1MA 1KHTA 1X9HA 3PU6A 4NH4A 5ALXA 2VHVA 4IXDA 1WOMA 5IFLA 1CJKC 4DR2B 2DSNA 1DG9A 2P2LA 1MB9A 3QZUA 4MQ6A 3TAUA 4I1PA 2A0KA 1VYUA 2DC1A 2QN9A 3GFFA 4MIOA 4QQRA 5ENVA 1QANA 4PANA 3VZRA 4FFPA 1CG6A 3IE1A 5LKRA 4MR8A 1Q19A 1S0UA 4IGFA 3WP1B 5JCJA 2O3JA 4B2LA 4P1ZA 3IILA 1FP1D 1RWWA 3ITKA 3AR7A 4G4IA 2BGKA 4KFTA 4ZARA 4Y0AA 1FYFA 1K98A 4FK8A 5CXSA 3RIXA 1GRRA 1M0TA 3PC8C 1SCIA 4UTXA 1V8OA 2POQX 3ZXUB 5B3KA 5D6OA 5T5QA 1BEUB 1T0PA 1N2OA 1X7WB 2JVIA 3CY6A 1TEVA 1W34A 1X8KA 2OOKA 3OCZA 4QBTA 4XEHA 4XASA 2R7LA 1UDWA 3MHTA 2ZJ2A 3PEUA 2BFEA 3PI7A 4CIBA 4DR6B 4KV9A 5J3JA 4YJGB 1EQ2A 3LI2A 2HJVA 3BXZA 2EFCB 2JLCA 3QUSA 4IWXA 4P4GA 4G1MB 1RAFA 2BISA 3U19A 2JK0A 3RF6A 2I9KA 4KC0A 3LF1A 3UXHA 1PR5A 1XWFA 2ZDGA 2YIMA 2PWPA 4LTDA 2RHWA 1ZRSA 4PTLA 4AC9A 1M2KA 2CSXA 3VU8A 2JIZA 4MW9A 1ZU5A 1NFRA 3AP2A 3D6MA 1JR3A 3HKBA 3RT9A 2XGMA 1JQJC 1KORA 1N9GA 2VWQA 4PYQA 2I87A 4PSAA 1CR6A 2ON6A 4R1TA 2VQFB 5DOZA 3DMGA 1BE6A 4PLCA 3TLBA 1YQTA 4RDCA 5CLGA 1EVEA 5G02A 3RVMA 1N0IA 1Y42X 3K0CC 3QVGB 4OSEA 3FGZA 3Q3CA 2KBFA 2Z4TA 2J7PA 1KMHA 3FWHA 2WHXA 3KT0A 5I4IA 1RXVA 5I48A 4U3JA 2Z57A 2D0DA 4G9GA 4IXTA 3HPQA 1K2WA 1SKMA 1Z73A 1KL7A 1KDPA 2Z9CA 3F3KA 2B2XA 1Y6RA 3RS8A 1ISGA 3DZKA 4UARA 1IPEA 3E5HA 2YWEA 4TV9B 4RTRA 4RCVA 1NZDA 3SF0A 1M6WA 2JBAB 4I50A 4OBBA 5LA6A 4AMVA 2DH6A 3ZIAA 5AVSA 1LC3A 4X84A 2VNIA 2ZFUA 1RC0A 1X7DA 4XD7D 1A50B 1RP1A 2Q0XA 4UBLA 4QRHA 5HE8A 2DHCA 2AW3A 2IP4A 3AM3A 2UZAA 3FI0A 4PGGA 1M5UA 1R0SA 2FLWA 1A9TA 1OWNA 3DQZA 4CIDA 4EELA 2PZJA 1UL1X 1TUGA 4G0QA 4Y2GA 2ZYIA 4XYLA 1SFRA 1BA2A 1RIFA 3I1FA 3IOBA 5JG7A 4YA6A 5C8YA 4XOIA 2RE8A 3RRNA 4FFDA 4URYR 2WQZA 1VJ1A 1XF1A 4FEAA 2YQ5A 1IN6A 6ABPA 1OWLA 1V9CA 1UDXA 1J24A 1XTBA 1MVNA 1JJBA 1IDOA 2WOOA 2XX3A 3K8OE 1T9KA 4OXNA 4MO9A 2IYXA 5HP4A 4Z9FA 2WZCA 2NT4A 4KDFA 1EGQA 5LOVB 1CS0B 1FOEB 5UKDA 3TM5A 4Q4HA 3VV3A 1HC7A 3D3NA 3GZNA 3LUGA 5A4AA 1PYGA 2CE7A 1VBMA 1ZXLA 3ABRB 1OYWA 2FFJA 3L06A 4P0PB 3DVRX 5LA6F 5BR4A 1QTNA 3N39C 3PGKA 3QOYA 2JL1A 2Z43A 1OIVA 2ZTHA 1S01A 4RQUA 4LX8A 3OPYB 3HLYA 1F14A 2VATA 2ZRNA 3N58A 1IZ9A 4LUCA 4BQNA 3DKKA 1TZBA 3E3MA 2WD9A 2VTKA 2CN1A 4J0GA 2H7CA 4S0XA 2XKBA 4URZR 4YI3A 1V6SA 2B25A 3JQPA 3U4AA 1U9IC 4CT4B 1ZW1A 4IDDA 4X20B 3FPGA 2DP4E 1GNQA 5HF8A 3SSAA 5C8YF 4TLMB 3P9XA 1JTVA 1DLJA 4LHSA 3TOZA 2X0JA 3K1YA 3G7SA 5LMCA 1U11A 2DMRA 2X86A 3MYRA 4ZOEA 3H42B 1NJ5A 1SULA 5LWHA 3C6KA 2G8NA 1XCJA 4N65A 4JENA 4KHZA 1Y1SA 2A1TR 2I34A 2WTBA 3EBLA 2ZSFA 1QWOA 3WGOA 4AJKA 4CZ2A 3K5IA 2YZ2A 4JCCA 3AR2A 4X1YB 2NX2A 2BZ1A 4X8MA 1NXTA 3ZCRA 2J0EA 1SHLA 5HBGA 3PQ5A 4DWOA 1JJIA 1EP9A 4OBWA 1WPQA 4R51A 1O94D 2PXAA 4HNHA 4WN9A 1OV4A 1U81A 2RBGA 3PC2A 3VPSA 5I3CA 1WBBA 4HAUA 2WF8A 3L6OO 1PU2A 3SM9A 1B23P 2PUDA 1TB4A 2A0FA 3DAYA 1B8NA 1GZVA 2GNOA 3MUNA 4DS3A 3H1AA 4MKZA 1T3ZA 5L95A 2PMWB 2RARA 3DGEC 1UJNA 2V97A 4FYWA 1F5SA 3KLPX 2HDNB 5DM2A 2QTTA 5IJXA 2QAIA 4DMRA 1WW8A 2Q3LA 3B1VA 4P2GA 3WIDA 5B1DA 4ER3A 2A0YA 2VRWA 3OOJA 5E38A 4CKCA 1Y48E 4PIMA 2DUUA 3QTLA 4QICA 3LHDA 1PLJA 3NHFA 3WDSA 3B1KA 3W34A 1O58A 4MPDA 1JAYA 5TV2A 1K1EA 1KZ1A 3GZ4A 3PFBA 3DG9A 4BCDA 4WE3A 2DR3A 1XVVA 1RE0A 4IAOA 2VDWB 5FHQA 1PR9A 3ED1A 5HDBB 3ICQB 1THMA 1CVRA 4LHXA 5JATA 3V8EA 1OH8A 3LQQA 2WTAA 1GL3A 1U7UA 3CVYA 1I3LA 2WW8A 1V5GA 3H0EA 2OCGA 4HATA 5EGNA 4MCAA 1KY5A 1SUWA 2G04A 2V5VA 4PWZA 4RVUA 2B35A 1KP2A 2VQ3A 3JQFC 1JYFA 7ABPA 1KI9A 2R1VB 3OJXA 1MJGA 2J5KA 2FI1A 1TIBA 4FYJA 1MB0A 1JMYA 1DPFA 1R6XA 2PGLA 2Q5IA 1G6Q1 3D6JA 1G16A 4CGYA 1PF7E 1JKIA 3L7DA 1L5ZA 2AJCA 1TPZA 4O4JB 4ZC1A 4YYEA 5C2JB 3HGMA 1ACJA 5HDQA 2O8VA 3IP9A 4ACBA 4GAEA 1L7OA 1OLXA 3WL7A 3RS9A 1IZ8A 4MDEA 2EF0A 2XF8A 2H63A 1Q6YA 2QZ4A 4JLOA 1X9GA 1LLFA 1LZKA 2R60A 1A7KA 1KAEA 1UBJS 3KQPA 3AKDA 1DRVA 1X1TA 4QASA 4AUKA 3EOZA 2VWGA 5JZOA 1NULA 1PFGA 3KZ1E 2PEZA 4HDSB 2WU8A 1XMSA 1MJNA 4H1WA 4WK6A 3Q7TA 3C3AA 5LNK6 4BWFB 5HIKA 2FSSA 2WRZA 1CVIA 3WL8A 2BMAA 1S8FA 4KAXA 1RW4A 4WBSA 3JQGB 3MJDA 2O1SA 4LDPA 2X9VA 3QKTA 1ISHA 4KIGA 5EPEA 2AYYA 4A5OA 1RPJA 3H6GA 2HNKA 4WKPA 5J59A 4B80A 2VRCD 2RFLA 4WK0B 4E5KA 2VJMB 1OWOA 4DHWA 1NI4B 4H59A 5DJ5A 2FXIA 5KYXB 4EFMA 1JTEA 4GOOD 5CDUA 2V1XA 1NW9B 3D1VA 2J6CA 2MR6A 4IEFB 4N9QA 5SZJA 3ND7A 4RQAA 3DPIA 3IUJA 3Q7EA 3M6WA 1P44A 2P41A 2AQIA 1K8XB 1AD2A 3LT1A 1G5TA 3I2FA 5KYYB 1E2GA 3HDGA 1NUPA 1NG1A 2PTHA 1CUGA 3OAAD 4YRMA 1D0SA 4Z3OA 3W9BA 3Q5EA 3ZZ0A 4FOTA 1U5BA 2A35A 3UMSA 2GVDC 2PEYA 4GMFA 3OOHA 1LDBA 1Y3CE 2NYUA 4RV4A 1WJGA 3W4IA 3V8VA 4IH1A 2CBZA 2HGSA 3NALA 4UEOA 3USZA 2R8OA 5DE3A 4E11A 3G0HA 5I4BA 4W1SA 3K2EA 5K6RA 2EC5A 3WIEA 4YMVA 4EWLA 5CA1A 2ODBA 3ASZA 5DHAA 4ZOAA 2XVZA 2WZQA 4W82A 4RE5A 2PXCA 3EQZA 1WMBA 1ZOPA 4OGWA 3OFNA 4M0PA 4LJKA 3KKQA 4I8DA 2A5FA 1C1XB 2H9IA 4Z86A 4YRDA 2Y0BA 3C15C 4N5LA 3NYQA 1FUIA 3NMUF 3AV0B 2E1RA 1O5OA 2E5WA 4G5GA 4R69A 2LP4Y 4ZQGA 3HY4A 4AMBA 3F46A 2YXEA 1O6CA 5IXJA 3SJZA 4TVKA 3WWEA 1CETA 3LFHA 2JKZA 1X14A 1XK7A 3PUVA 4YAJA 5LMUB 4KFSA 2VF8A 1YHNA 3KUCA 3M1YA 4U0KA 3SHVA 5JAQA 5ER6A 3GEBA 1OH7A 5ICMA 1JEYA 1K63A 4HQ6A 4GZLA 1O87A 2F8MA 4M1MA 3K0KA 2Y67A 4J16A 1KC1A 4IX1A 3SQDA 3G0IA 2YRFA 4MULA 3S1AA 2XPCA 3CYFA 5ILGA 3TNJA 1U99A 4W1PA 4CN8A 2WOJA 4ILKA 1SOVA 4HB0A 1ZRHA 1BXGB 1N2ZA 3EDRA 1VPDA 1VQ1A 2FJUA 1HH4A 4GI3A 4BO0A 4YRZA 2ZATA 3VR5A 2ZSJA 4PX9A 1EKXA 1MJHA 3L8YA 4O2BB 4DLPA 5AUPB 2VTBB 5HS6A 1A2QA 4YS6A 3LCMA 1DKPA 1YRAA 5D3QA 1AN0A 2WJWA 2P11A 4WXRA 7GPBA 3UV6A 2VQEB 1L1FA 1SUDA 3UGJA 2BGLA 4HK4A 5AVTA 1PGNA 3EMDA 1JFFA 1B1CA 2P30A 4FEGA 4F2PA 4ZGGA 3TECE 1PKEA 3LXUX 3NVMB 2Q21A 1GM5A 1AU9A 2M6LA 3FVWA 3LC1O 1N0VC 1FNDA 2FW0A 2X9NA 3EF0A 3T3HA 2V5UA 2XA9A 3EH1A 4ME6A 2G1UA 1YJCA 2J9RA 3FFWA 4YUAA 3GLFB 1QHSA 1YASA 4P2BA 4QBIA 2JH3A 2IIBA 3WLAA 4FT4A 3O90A 5AW7A 3H5NA 1UBTS 4F97A 3F96A 1F8XA 1GAJA 4MV1A 4QDTA 1U3FA 4CF6A 4BLTA 2FN7A 2WBLC 2I7VA 2V7GA 3I8XA 2Q4TA 1T2UA 4EUHA 4YAGA 4WPGA 2QHXA 2X14A 4PPYA 4C4OA 2L0XA 5CDHA 5KU7A 3T4PA 1EFDN 1QOZA 2ZUEA 1HE1C 1FNSA 2H11A 3AUKA 4JFAA 4HGRA 4JOCA 4MQEA 3SBEA 1RZRD 1IPFA 3JS5A 1UBFA 1CY6A 2HWWA 4I6EA 4MW0A 1D2RA 2Q6KA 3DT6A 3JXEA 5G0VA 3WWZA 1AKEA 5LP6A 2AN5A 2FAXA 2IV7A 4PCUA 4PN7A 5BT8A 3LSTA 3LWBA 4CCYA 4RETA 4D9BA 5AK5A 4HZUB 2Y1CA 2PUJA 1YH3A 3KFVA 5IAKA 2Z3WA 5CB6A 2PK3A 4MVCA 1M72A 2MSLA 4ZAZA 1CNEA 2B8NA 5K4HA 2IY9A 1M34E 2GKOA 4REMA 3F9IA 3QKWA 1YQDA 2HA0A 3PG5A 1OHHD 3SC2A 2BCEA 4OX9B 2RGWA 3OQIB 1FNNA 3KKOA 4YP6A 4YMWA 2FV8A 3W0LB 1E92A 4J75A 3AL0C 4O4LB 3OM1A 3C98A 1P75A 1V39A 1H3NA 1PVOA 3DYVA 1C4KA 5HS4A 2OGUA 4OHVA 2AC2A 4URWR 1EU1A 4B4KA 1EDBA 1NVGA 3QLUA 3GUZA 2OT3B 5E9QA 3A7EA 4MGIR 3CIFA 4PLWA 4Y7CA 3RBXA 4HX9A 4JI2B 1YA6A 2ZWAA 4HAYA 2VYFA 2FZLA 4J0DA 3CRQA 1LSUA 3PRYA 4OATA 4IEIA 3WYEA 2HX1A 1G4HA 5JCJD 3VVLA 1HDOA 2C2HA 2RC5A 3OLZA 4E2ZA 4GFDA 3TBFA 2FSGA 4RTMA 1OOEA 2AN9A 5BN3A 2CMGA 2Q2VA 2XT0A 4Z7NB 1L9KA 3QMPA 1ZCFA 4UTVA 3ZVRA 5JDCA 1Z3IX 2XE4A 3IMKA 4REQA 5EVJA 1OGIA 3H5RA 4AW9A 4D9FA 5AFSA 3D4IA 3MC1A 4L02A 4PY2A 1K92A 4RZIA 3S27A 4EB6A 3VR6A 3RUPA 1MEEA 4KMMA 2XB2A 3Q41A 3GQBA 5KYUB 1W8IA 3ZHBA 3OQ1A 2CFIA 3DVLA 1I2AA 1PJZA 4U7TB 1SCQA 2FHPA 3K1AA 3SYLA 4FDAA 3SN6A 1FDOA 2G4CA 3T6KA 1PJTA 4AICA 5HYVA 2JGIA 3GN2A 1Z5NA 4RA6A 1V71A 1JR3D 4BPRA 5JNVA 5LD2B 4WZAA 2A0WA 5GMOA 3TCNA 5CLQA 4B2IA 2Z6UA 3E2IA 1OVMA 1DXOA 4HGNA 1FTNA 3GLIA 4F3TA 4LOHA 4MKRA 1XSEA 3V4RA 3IP8A 3RRFA 1L3BA 5AW0A 3LLUA 1EA5A 5E3IA 3K0FA 5K8UA 3V8NA 1ZO8A 4M86A 2DETA 3QVTA 3PNLA 5HMMA 2J7PD 3BFVA 5I7SA 1I2DA 2BBWA 2O2XA 1R5BA 2PSSA 2Q5HA 4KK4A 3VMMA 1LLUA 4PX2A 3WJ7A 3PHHA 4QSHA 2A84A 2YXDA 3P9RA 3Q87B 1B76A 1JALA 1XTVA 3LAWA 4J2OA 4QHTA 5T4BA 1B0ZA 1R66A 1EBUA 2IPOA 4JWTA 4MLZA 5IASA 1KVUA 1UMDA 5IUNC 3ZIAD 5ANRB 3P0RA 1G66A 1ZSVA 2EQBA 5F5XA 3S55A 4ZHQB 1AMUA 5ALRA 4CEHA 3ERCA 4XFJA 1THTA 3UC5A 2ZZMA 3GFPA 3W8NA 4Z7QB 1P6QA 4C89A 4CKXA 2R8PA 1XQ6A 2VZ8A 3OSZA 5L6LB 1GGKA 2CV2A 1EPUA 4JI6B 2W93A 3PT9A 3F6CA 3L8MA 4AJLA 2R9VA 3F6PA 3E8SA 3JQ6A 3RNLA 3COPA 3GO4A 4KO4S 1OXUA 5KI6A 1T1JA 2QVBA 1BYIA 2A6PA 2CLIB 2NTJA 5ALWA 4B31A 2GZSA 4IDPA 1XHLA 2ADFA 2FU5C 3UJHA 3WAKA 4CQLA 4JT9A 1CFJA 4BEJA 1JBEA 2D7CA 2RI6A 2ZJAA 3AUAA 3NGMA 4LPSA 1OAOC 1UKYA 3H2IA 4RJKA 5EL0A 4U6QA 3NHMA 1GAXA 5DMHA 1UZUA 4OD0A 2JIOA 2DQYA 3JYOA 4Z9YA 1F6BA 3QFRA 4HLCA 2HIMA 3BWBA 2OAEA 1Z2OX 2B21A 3D6VA 3EZ2A 3L4SO 4G0XA 4C0AC 4DLTA 3UHJA 2GJAA 1JHDA 1WPRA 3N86A 3H65A 3PSAA 1WXHA 5FKJA 2AH5A 2HRQA 5JXWA 4BEWA 3V42A 4MI1A 2B8WA 4HDMA 1TVKB 3JW8A 1NUHA 4GOMD 3Q3GE 4PZPA 1KS9A 3WDLA 3ZV7A 2I9PA 3RV3A 1LPBB 1LSJA 4PG5A 3OPQA 2R2AA 5E1DA 4D46A 1E4YA 4OFZA 2QBYB 3GRYA 1KE1A 2WFZA 2AN3A 2XUJA 3G8BA 3I2YX 3AEQA 2AR7A 1KKLA 1R8QA 3ABQB 2FUEA 3HWX1 4IS2A 3UK1A 4XM2A 3FZGA 3ELWA 1YVRA 3O83A 3PWTA 1X0VA 5K3FA 1PX0A 3BREA 1G17A 1ZGCA 3IT2A 1BQ3A 3NBXX 3RVPA 4MDHA 1EB9A 1BSVA 3GZJA 5H9WA 4I9HA 2NSLA 3K15A 1HLFA 4UE2A 3AFIA 2AQKA 5KOJA 4DT1A 5LIRA 4YB8A 1IOWA 2Z8XA 4Q05A 3KUUA 2ZIXA 5G2OA 3A04A 1RHUA 1TTPB 4TMTA 1LPAB 1Y1PA 2IP2A 2W70A 2UXDB 1JU4A 2G5PA 4TVBA 4AZ0A 5KNCH 1EFTA 3FHJA 1LDNA 4GQIA 4L0MA 4KQ9A 1P1RA 2MHCA 3IQIX 4NJOA 4F1WA 5JECA 5M2QA 5IFKA 4JLSA 1GOTA 2CL6X 1XMPA 3QJYA 3D1LA 1IZYA 1XJQA 2HBRA 2X1VA 4JOSA 3KSBC 1SVOA 4PBTA 1P4AA 1KAGA 4K1XA 1X7GA 1RWPA 2D5BA 4II2A 1EJ2A 1G8YA 5BXYA 3NQ41 5KB3A 5GV7A 1RP7A 1ODSA 5LNK1 1JQKA 1F06A 2HQRA 3B7WA 3P0EA 4J90A 1HRKA 5D51S 2C5SA 1GR0A 3JSAA 5FPYA 4IMRA 4MKHA 5CLIA 5T3YA 2DECA 1EI9A 721PA 5ADVA 4DJTA 4EIWA 1S2DA 5DWVA 5U9CA 1BCSA 1FF9A 4UHJA 5AXAA 3T0FA 1GAWA 1YQQA 1WR8A 5A5GA 3ZQUA 4E4TA 4WL0A 5K8LA 2ZPUA 5K0JA 1HWYA 4Y1RA 3BWDD 1CW2B 4E31A 2B20A 1SZCA 2ZYVX 4M1SA 5C7YA 3DM9B 2LKDA 2Q3BA 1VI5A 1XA3A 1OXXK 3M4YA 2G7ZA 2NGRA 4XUDA 4MLCA 5EC8A 2JA1A 2OZKA 5JBIA 3UAWA 1O2DA 4ZAYA 3E9RA 3IDFA 4HDAA 4TKMA 3ZCQA 5BSKA 1QK3A 1EEHA 3FVQA 4RTNA 1BHJA 3EVNA 4G0WA 1JLSA 4II7A 4P84A 2IPLA 3HUTA 3C3KA 5ALNA 1XKTA 3SYTA 2DXIA 2IXBA 2A1TS 1COWA 5HBRA 1A2OA 1I4DD 2MT9A 1TUBB 1ZVQA 2RHLA 3TQFA 4WNAA 3EFEA 4FLEA 4BO1A 4D42A 4RZQA 1QH1B 5D00A 4ZCLA 2H18A 2FZEA 4DNXA 4BFLA 4CEJA 2JFVA 1ZITA 3FLMA 5EINA 4Q6BA 6LDHA 1BDMA 1EEXB 5KMGB 1NYTA 1A9XB 3K0SA 5GJWC 3QE2A 4X45A 4P3KA 1E9FA 1QHIA 2P9CA 1FW8A 1OAKA 1KOJA 2R8XA 3C0KA 2GUWA 4JASB 5U4XA 3E7WA 5L3VA 4B3CA 3W2IA 2ZJZA 1SA0B 4MO2A 4LNUB 4UBKA 1H4QA 1U2GA 5E8RA 1K5GA 2CL5A 3KUKA 5E6UB 4BIIA 3QVMA 3ETEA 4X85A 1JDNA 1Q1EA 4ZQEA 3VSDA 5GZ1A 4HVLA 5A03A 4WUTA 3IUNA 3S2UA 2Y2VA 2RKWA 1ZBDA 3DFIA 4KOAA 2CF5A 4N8DA 1N2EA 1ZUNA 1NQAO 5CX1B 1FDRA 4KQJA 3U1VA 2BEJA 3H8SA 4QT0A 1JA0A 2C7VA 5FOSA 1UFKA 1U2TA 1JIQA 2PLRA 1TK9A 1YB7A 2FVXA 3TZEA 2WVHA 4BY9E 1M6EX 4O2RA 3LH5A 2B4KA 2PGDA 5DN9A 3N0RA 3USCS 1M6VA 1GTMA 121PA 4OBXA 1PGJA 1TQ4A 1WZCA 3ST7A 3SF8A 2ZITA 4MRSA 2YJGA 1WULS 3BGSA 1Q50A 1DBQA 5TT0A 1FNBA 1YE5A 2ZJ8A 4YYZA 2HDOA 2DBQA 2BPOA 1LPPA 1T34A 5A9RA 1HLDA 3E48A 3S81A 2EJTA 3JD4A 3NHLA 2DGDA 5JNWA 2XTNA 4IV0A 5FDFA 1ULSA 2WP8J 2J6BA 3A6FA 2IU6A 4LOIA 3GYGA 3MW8A 4HS4A 4XDGA 1W0CA 2AN4A 3A1TA 1E3WB 5D6NA 4YPFA 4B5KA 2IDMA 1T5SA 4BFWA 1MJGM 4YN3A 2OCIA 4AZVA 1S9DA 2AG6A 1IM2A 3IUMA 1F38A 4W99A 5G1OA 3ICVA 2RGNC 1TLLA 4MMXB 1W9MA 1B8PA 1HF3A 1MVLA 3GRCA 2N47A 4WT7A 3RYHB 2XQJA 4BFVA 2QTVB 3RSSA 2WA2A 4QM6A 4KEAA 3VGPA 4WLVA 3G0CA 1KR5A 2AUTA 5KSOA 3WMEA 3OFND 2FX2A 4YRPA 1YDMA 2GRJA 4CM1A 3BE5A 2PJDA 4WD3A 1E3JA 1OFTA 3PIRA 3V3TA 1BDJA 1XL0A 3QLTA 5K0CA 1Z4KA 1NSFA 2BCJQ 4TS1A 4WX2B 2UUOA 4U7WA 4Q16A 1W5FA 1RD4A 4WDQA 4RESA 4YWHA 3TR5A 4DSNA 3UB4A 2O3SA 3H1TA 2I7CA 3OCWA 2EZTA 2XUZA 4RSRA 4ZVMA 2IYOA 3ASUA 2EW8A 4KLZA 4LGYA 3VR3A 3USES 5JI3E 2Y1WA 4D1YA 2OL4A 3EA4A 4MZDA 2QG9A 2W71A 1Q15A 3IP7A 1IONA 1ZI8A 4U0JA 4IQFA 1HFEL 1QVAA 1DTWB 4A5SA 2H29A 3ZWNA 4AJOA 1U98A 1MC1A 4OQPA 4IV5A 4HQNA 4KITB 1GADO 2OV4A 4DSOA 3FCYA 1W2GA 3VR5D 2A9OA 2CJFA 1RXSA 3CB4A 4EW2A 3K16A 3DULA 5LR6A 1MOPA 3CLRD 3NO4A 3TQOA 4L16A 2PO5A 4QBFA 1MRSA 1RIIA 1W47A 2VEDA 2F43A 2O2JA 2C4MA 3QENA 4DM3A 3RREA 1EUZA 3LX5A 1RS0A 1ZMRA 1KJ9A 2HI0A 3LZDA 3EYWA 3PFWO 4ODIA 4D44A 2WVJA 1C1DB 5THXA 4C06A 3H97A 2R84A 2IXTA 3JARA 4RDXA 3QA9A 1W6UA 3IHKA 4HPWA 1GZ3A 4KQKA 4XH9B 1WL8A 3CHYA 3LBYA 1RHMA 1WQ4A 4HGYA 1WMAA 2Q5OA 4YJ2B 5I5GA 5FH9A 1N5RA 2NP7A 1WDKA 3FOAA 1KP9A 5T8KA 4D9KA 2F55A 3DO5A 5DN6A 3BD9A 5EZ6B 5F1YA 3IOMA 2VZEA 4MTCA 2OA0A 2R44A 3WNCA 2BFCB 1XE3A 2SKDA 5CT6A 4EO4A 1PT7A 3IVXA 4XWWA 1TKRA 2Q5QA 3QQPA 4Q02A 4B9AA 1RRPA 3BE6A 4CMJA 3ESCA 4HN4B 1TADA 2CB9A 4H17A 4C07A 4ZT4A 3TSWA 4EQZA 3UJNA 4ZANA 2O50A 1SOUA 4JR2A 4IDAA 1UP6A 3V1YA 2JHFA 1USVA 3BH7A 3U09A 2BIFA 2HWUA 5JISA 4PSDA 4ZHSA 2Q3CA 4ER7A 4OF4A 4WINA 1MIOB 4HH4A 4RF2A 3IKMB 1DIHA 1RJDA 2C61A 3NETA 3AOEA 4J6EA 5HX7A 1UAAA 1LSSA 4L6AA 4FGZA 1K7YA 3E9EA 4LA4A 5AYVA 2R2GA 3VPBA 2HZBA 2ATVA 5FBQB 4B4UA 3PQDA 1HTTA 4R8RA 3AHIA 4XSGA 1TRKA 2OR3A 2FMHA 3GA0A 5FWYB 1T36B 4EKEA 3I3SR 4WCFA 3RTDA 1LJUA 2BHLA 2GPYA 2HF8A 1A97A 1W30A 2PMKA 3NH9A 3UAZA 2VT6A 4C21A 5KX5B 4WJZA 2WV7A 2I8AA 1JQEA 1RWQA 2F48A 1W36D 3IHLA 1IJEA 1J0DA 2NV2B 5JYDA 1E4VA 3CJTA 1IZZA 2VF7A 4G1EB 4DTIA 3ZOKA 1E7WA 4MVYA 4YUXA 5HCIA 2NSYA 2Y05A 2CVHA 5E4YA 3PNPA 1QKIA 4G25A 3PX2A 4GOLD 1FMJA 4HX2A 4KWHA 1S8OA 1FQOA 2H5LA 2QENA 1PVVA 4G8JA 4W7SA 4LF9B 4BMNA 1A5SB 4D8UA 2C7RA 2CXSA 3KZCA 3QYPA 3ZHSA 2XXJA 2WMDA 2HJSA 1CNFA 2O9JA 3C8ZA 4YUWA 3R9XB 3DEYX 2REQB 1H0KA 3EXIB 4ZTBA 4HGPA 2IGBA 2PBRA 5AUNB 3T1HB 1PS0A 3BUSA 5I5EA 4TQAA 2FMFA 2C92A 3G8DA 3NPMA 3QPCA 4EW6A 4EVIA 1NYLA 5BR7A 2V4UA 2J3DA 1QH0A 4DJ5X 3I5XA 2G9UA 3VO2A 3MGKA 1FS6A 3M2PA 2JI7A 3GBVA 1C3LA 2QRMA 1YGPA 3D3WB 4G5FA 2GZAA 1LV7A 3H2YA 3VR6D 5IMSA 1DCTA 1T8SA 3URKA 2NW6A 4JITA 5F3WB 4BVEA 1B6GA 1DJMA 3PFFA 1Y6GA 2DUWA 3F6RA 5ADHA 4MGZR 1ODLA 1P7WA 3S99A 3UJ8A 4XJSA 1P4JA 3DWFA 1XCGB 3DE2X 4K86A 4QGFA 3TQHA 1G9SA 4D2IA 1L7AA 3BXXA 4C3VA 2PJUA 2C5BA 2FWNA 1X7XB 1ETHA 4MQLA 5DCYA 2QK4A 1CFZA 4A6PA 2ES4A 4DLXA 3GG9A 5U4QA 3UFBA 1OKKA 1P2GA 3LPMA 1XQWA 1KFEB 3KYDB 3MAGA 4PIPA 3KJGA 4Y6GB 2O0HA 2YVLA 1YS7A 2XYGA 1KZYC 3KXLA 1TLFA 4E5PA 3DQPA 1U7XA 4GZ3A 4D57A 3ZWXA 2PKCA 1NBHA 4JODA 1LB1B 3H5WA 4QYIB 4WEOA 3PRHA 2XTMA 4XPIB 2ZB8A 1S2OA 4JLJA 4ZYZA 2PLNA 3C3JA 4BOYA 2ILTA 1JHUA 4B32A 2HSJA 3ESAA 1BC5A 3HVHA 1RQ7A 1ULUA 1D7AA 3KKEA 5CM8B 1N0UA 5FTKA 4YXWA 2IHBA 4OHPA 2GD1O 4G5OA 5EEGA 2DCMA 2B94A 1EDZA 3IOEA 4XYBA 1PL7A 3INGA 1IOVA 4TKZA 4A1OA 3EVZA 5FBVB 1F6WA 1Q0PA 1RDFA 1Q0SA 1Y89A 2P2DA 3C7KA 1L8AA 4B48A 3JQ9C 2JGKA 4DIMA 4ACAA 4MV3A 4HUJA 4EY5A 1OZAA 3V1MA 4BU1A 4ERXA 3X1MA 3EGXA 1USGA 1T9HA 3G1TA 4EW1A 2FWAA 4N5NA 3ZD8A 4GLLA 2R1TB 1MGPA 2PKWA 1M34B 4R1MA 3U3KA 1GLVA 3EK2A 3I2KA 4KVGA 4R7ZA 4L0DA 1NW6A 2C3UA 2I2DA 1QIJA 4XYEA 2QTNA 2F3UA 2QWXA 4CF7A 4MCIA 3M70A 3JQ7A 4IY1A 1KY3A 2P9HA 4EG6A 3THOA 4GE0A 2Z3ZA 1G6KA 3C97A 5L3ZA 4LY6A 3MIIA 1R8SA 3Q98A 3ZU4A 5J5CA 1NNLA 4R3NA 1CB0A 4BZPA 1H0HA 1QYWA 2HUNA 4FGWA 4BN0A 1E7MA 4JHLA 4C3UA 2DF8A 3TO5A 4Z54A 3CZPA 1A72A 4U02A 4AUEA 3R7NA 1P2SA 4OHKA 1HYQA 4JAVC 1JWLA 5D5PA 3LA8A 4DG5A 4DY6A 1NXQA 3FYHA 3RQIA 2FMIA 5JCOA 4GR5A 3S70A 4H16A 4I1IA 5IEBA 4E5SA 4EGJA 1GYPA 3R3XA 1SD5A 5AKGA 1KOFA 1DARA 2VJQA 3M34A 2WU4A 1MN6A 3B5EA 1TA4A 3EFOB 3LDHA 3SJBA 5A7HA 1H05A 2NOAA 2FFHA 3DMPA 3CF4A 1HL3A 3NONA 1YNOA 4B7AA 4RMNA 4YQYA 4DLKA 3HCWA 3WVNA 1XKXA 4Z6KA 5IZ4A 5A9SA 4NF2A 4KRFA 2BMJA 3PWZA 5H8WA 2JLXA 1JLMA 3LYAA 1QQ5A 3ENWA 2XMZA 3I9FA 1N9KA 3IURA 3L7KA 4ML3A 1BXRA 2D59A 2YMLA 5FWXB 1GKIA 1NJFA 4DLVA 5FJJA 3C6QA 1CUZA 2QMEA 3FB4A 3K8ZA 4OYHA 1F3LA 3NUQA 4QLOA 2E4VA 1FFHA 2AJ8A 3DEIA 1FDVA 2ODTX 1RYDA 5FPHA 3RC1A 4F6RA 4LJLA 3ZE1B 1AOXA 2BM9A 3P19A 1AKQA 4PQYA 4GKBA 1Z15A 4IUYA 2AJDA 2QLBA 3GEDA 4EZBA 2F3QA 3O92A 2MOKA 3CO5A 2NU8B 4M1KA 3TG2A 1CULC 3WRYC 1OIWA 4L2IA 2I62A 4F04A 2H4WA 3DL4A 3FUCA 1PWHA 3SHQA 4JLAA 1Z0AA 3L1VA 1I3OA 4HHEA 2ZVDA 5FTNA 4F3NA 4X41A 2X1MA 1VPWA 1XPRA 1XF9A 2PJZA 4U00A 4LHWA 1F2DA 1U04A 4Q4JA 2IHYA 2NUAB 3E3NA 2RGAA 1S8NA 1Z5UA 2GTHA 3FW1A 4PO9A 3MK31 3KZVA 1NNI1 4BNJA 5A1JA 3GBSA 1AK2A 2C20A 2Y4NA 2YASA 4BX2A 4F9EA 5A5EA 3QFTA 2P35A 5AHOA 5BSHA 4MRNA 3U3RA 5JAOA 4PTZA 1W5EA 1XMJA 3NANA 2BGJA 3IEKA 4IDEA 1DJLA 4RGQA 5CFOA 1Q22A 3F8SA 5B1EA 4EA6A 3JYLA 4FFOA 5FUQA 3PQ7A 4B87A 1ISIA 4BJHB 3LQFA 3LYUA 2H51A 2R96A 5D5QA 1ZM4A 4K9RA 1WWKA 2P69A 1AIPA 2Q6VA 3GLQA 1S02A 2E7ZA 3CNEA 2Q45A 4F60A 4N5MA 2BRUC 5JNRA 4BZWA 4W5WA 2YN2A 3IJRA 1COWD 2YYAA 4ZD6A 5IYZB 2EHDA 2V7TA 4Y9UA 3G5AA 1CR4A 3NWPA 1A96A 4FUTA 4YRLA 4Q39A 1UK9A 1BJKA 1O6BA 3DMYA 7MDHA 2PWAA 2Q2QA 3EW7A 3PUIA 4Z8YA 3OT1A 4QTYA 3GJYA 1RXYA 3QYAA 4UPVA 1DBSA 3KE9A 5IKXA 1QCZA 4QXMA 4GPTA 2J3HA 4Y2SA 4XOUA 2HJ9A 4BAGA 4A15A 3GLGE 3IMEA 2VG8A 1HOTA 4KR7A 4CV3A 2W98A 4UASA 1DKRA 5AHXA 5AJUA 4ATNA 4W5OA 2G80A 3HO6A 4HDOB 1AK1A 2X40A 4LN1A 5KU1A 1K7SN 4H4EA 4LDZA 2C4UA 4PAWA 2BEUA 3EG9B 5CJJA 3RNOA 4F45A 1NVXQ 3EN0A 4IRMA 6REQB 1C50A 5ALLA 3KTOA 4J4BA 3D8BA 3GUYA 5C7IO 1K75A 1QIGA 3AF2A 1IAVA 5A1TA 4OQYA 2X0EA 2XXAB 3V7NA 1TQDA 1MW9X 3MTBA 1NPDA 2AHOA 5ALMA 1JJ7A 1CQIA 1KFCB 1T35A 4A3SA 3AYZB 2ZETA 1E4OA 4HUQB 4I4TB 4JK3A 3WK7A 4EHDA 4YH1A 4GKKB 3BCHA 3QE3A 3R74A 4RHTA 5GZ6A 3ZXXA 3HCBA 3LY5A 4BVGA 5LIPA 2F4VB 1G7CA 1LC0A 5G1NA 5C4MA 3SMVA 1E79A 1NRJB 2VSYA 3R20A 4ZU6X 4DLRA 4NQZA 1X19A 2B5WA 3QTTA 3DF7A 4UCWA 2GCNA 1VRWA 3WBJA 3ZY4A 3COZA 1YZLA 4F5YA 5HCUA 4FFBB 3K05A 1XNRB 4CMCA 1ISPA 1XLTC 5FO0A 1QIEA 2SECE 4MVXA 3FWZA 3UWMA 2PGAA 2ORYA 3DDNA 3FOBA 4GNRA 4OJYA 1JPNA 1IY9A 1BMTA 1CJTC 4M6WA 4MYTA 4UHBA 1RTTA 2CJWB 2GPSA 2Y3IA 3LTEA 5EYPB 3SKXA 5JLAA 3STUA 3K70D 1JF8A 1ZGBA 1QHFA 2ATXA 3HVRA 2XCIA 3E58A 4WOCA 2LDXA 3EBPA 3OG9A 2HRZA 4NK4A 3H4TA 2YBEA 1T6YA 1P17A 4PINA 2X6TA 5BWLA 3FPEA 1ATZA 1KI6B 5JASA 4BX8A 3N70A 4PC2A 4JQOA 3W6ZA 3P9QA 1XTSA 4RL6A 3DT8A 1U9JA 2B7CA 3REQA 1WXQA 2JFNA 2OECA 2PANA 3NATA 1PP4A 3ZWCA 2IUFA 3T38A 4PEVA 1SEVA 2BMFA 4ZEVA 2QDKA 2XDQA 3KJQA 2YJTD 3PFGA 1EFRA 2COEA 4LBYA 1GA1A 1LLCA 3ELYA 2RSLA 4PBSA 4QYSA 4V2UA 4XUCA 3O8BA 1UOQA 1T2CA 4XE5A 1YZYA 3BK1A 4DANA 1GUAA 3H0CA 4B3JA 1FRVA 3BIXA 2OBBA 2REBA 2FPPB 4KR9A 1JGTA 3T7IA 1L1QA 4C7XA 1YMQA 1NVAA 4A0SA 4H7DA 1XXHE 1ODTC 3WGIA 1SR8A 4E70A 1RQGA 2Z2JA 4Y0NA 1KQFA 4AZSA 1YFKA 3HMKA 2EJCA 2H1FA 4HWOA 3TX2A 2H06A 4AWXA 4EY8A 5EJEA 1XTRA 2JLBA 4HWKA 1L7QA 2OHIA 3PD7A 2IU4A 5LDHA 3S68A 4XRGA 4HAVA 2AE2A 2R8EA 4MV7A 2HRCA 1IQUA 1N7IA 1J5EB 2MSDB 2ZROA 4INJA 4YDRA 3WSTA 4RNDB 1HDZA 2QMUA 3DBLB 2ZYWX 5E1MA 3ZHXA 4FYPA 1TKBA 3EZ9A 4G63A 1LBIA 4EVRA 1D7OA 1OE0A 1TT5A 2QYSA 1YZVA 4NABA 4OY3A 5LQRA 1S6YA 3LHFA 1FPQA 2GZDA 4Y30A 1FVOA 3QX3A 2IOYA 2W37A 3F0TA 5AOAA 821PA 2C42A 1QIIA 3TM4A 2EEZA 3O74A 1WSDA 3RIHA 4IYJA 1FUKA 4U9HS 3VH3A 3ZXYA 3GIDA 1CUDA 1WE2A 4MICA 4R5HA 4D9HA 3BEOA 4N9WA 3WXBA 3UTCA 3KOXA 2GN6A 4MQ4A 4GWLA 1EUDB 1KY4A 4QE3A 1AA6A 1V1RB 1VHTA 2H8GA 1QHHA 4MWTA 1JT2A 1V11A 1T1RA 5AW9A 3Q3IA 2Z6QA 5B2EA 1F8UA 2O1EA 4HDRA 2N3ZA 5FNVF 1SIWA 2GN0A 3PNMA 4GSLA 4ZDIA 3SVLA 3GLUA 5ETJA 3D02A 3T7CA 4YGYA 1F2TA 1N2BA 1UM9A 3Q9UA 4K6CA 5G53C 3TPCA 1KRWA 3GRRA 2ONYA 4FNOA 4MVJA 4S12A 3VGJA 2FR8A 3AY6A 4QYMA 5J43A 2DHQA 3BSFA 3GVPA 1FTQA 2YCLA 4LDAA 5DN6D 1ONOA 3B3QA 2MSNA 3EIHA 3EX7C 1TCAA 1BJRE 4XSVA 3ZHOA 4I1UA 5IVPA 1MNQA 3EUWA 4BO9A 3N8KA 2N75A 4NCJA 1UPBA 1JE0A 4IIYA 1YL5A 4OUDB 5FUVA 1JEQB 2RHJA 5EP1A 4LJSA 5D84A 1R27A 2BGRA 2R6JA 1YR7A 1N7HA 3QY0A 5BN5A 2ZUTA 4N7BA 1MO2A 2YN0A 2DE0X 2C5HA 2HC9A 4KACA 1DAGA 1CF2O 2P2GA 1NVKA 4A0FA 4V0KA 5AW3A 4B3MB 1RQ2A 1GU7A 1YOVA 2DWPA 3MJ4A 4E46A 4DNFA 4XWKA 1SIBE 1I6LA 3EGIA 3V00A 3TSZA 2I6FA 1WB9A 4OQDA 2W7TA 3IV7A 3ZXIA 1KETA 3H83A 3UBTA 2H52A 3E9ZA 2EGUA 1ZY2A 2GPNA 2AS0A 221PA 2OZEA 1EJ6A 4Q66C 1AQLA 1RJ9B 1AKTA 5CT8A 4PGAA 4YUVA 3KD3A 4B79A 4BEVA 2GT1A 5JS1A 2R4UA 1YAHA 2V9ZA 1T3GA 2ZAIA 3O4HA 4OOFA 3ZNNA 3BGOS 3HRKA 2MJLA 1TYDE 3E2PA 4ISCA 4LZOA 4MVJF 3VR4A 4R1QA 4G8BA 3SE7A 4MWOA 1J9EA 1HTWA 5FTJA 4DPKA 4ZMBA 2OZLA 2GVZC 3QYJA 3BMCB 3IDAA 1SCUA 1Z37A 4CUJA 5EHXA 3L8EA 2VDOB 2HXYA 3PLRA 5E2BA 1C0EA 5H02A 5J63A 3VZDA 3WQQA 1JAXA 3O47A 4KQHA 5E9JA 2DULA 4DNPA 1WG8A 1NNUA 2WF9A 1G6OA 3DE3X 4H2DA 5FBRB 3THYB 2X4IA 3CX3A 4I14A 1DJNA 2NTVA 3DA8A 5L9AA 3LFUA 3CCBA 1O1YA 1TCCA 2LVBA 3HB1A 4TQUS 1JXQA 2K87A 2YNMC 3DOFA 3C8DA 2J0VA 2XNJA 3CX7A 4G0YA 4K6MA 1NSYA 2OAGA 4O4HB 4D80A 4Q3LA 4DCUA 3TF5A 2CHEA 2ZRMA 3FNQA 3HYNA 3K0AB 2J4FA 3EY9A 3CX6A 1UK7A 3IC5A 1SELA 1P74A 4MWDA 3WB0A 3RODA 1LTHR 3DAOA 1XFAA 3DR5A 1Y7HA 2FGJA 1JDTA 2P4QA 2H9AA 2Z95A 4LY9A 2OPHA 2GN1A 3MBOA 2YMPA 2ZVPX 3HZZA 5CYPA 5BV0A 4M22A 1ZL2A 1OI3A 2YUIA 5KVSA 4ZEOA 1YQUA 4Y6OA 1NATA 1OYOA 3AW8A 3CVOA 1SNYA 3KKNA 4IOLA 4DSUA 5LLDA 3BMQB 3LUJA 3NCTA 4H77A 2G3YA 1TK2A 5A0FA 1UXIA 2X8WA 3AXSA 4X60A 2ZJFA 3Q12A 3ZWQA 4D3DA 2D00A 3UPUA 3RBAA 2D7JA 3EIOA 2J5BA 1Z8DA 2VYNA 3ODGA 4FDMA 4QFMA 3ROZA 1PBTA 4HD8A 4CKWB 4ZOCA 3PXGA 3OSUA 2PZBA 3E61A 1ORIA 2ACKA 1OKKD 5G0WA 5IDYA 1F3OA 3NAMA 3OQMA 4FYYA 1EM6A 3L0OA 4ANFA 2XDWA 5JSHA 1KRXA 1W49A 3AHJA 1BOOA 2O8DA 3FVRA 3VUFA 4KG7A 1ISMA 3MWEB 3A1UA 1MH1A 1U63A 2WJ4A 3JWJA 1WW3A 1B15A 1KR2A 5EJ5A 4MI3A 1BHO1 5A3SA 3SICE 4AXBA 3NIWA 3TLCA 4D8XA 3SY8A 1G5HA 2YHIB 5SYAA 3VPXA 1J4AA 2I3GA 5IK2A 1VI2A 2WJ6A 3FNBA 3FMPB 3TLZA 4BO7A 4AIIA 1VOTA 1TU0A 2WNHA 3SIWA 4CHTA 4FLFA 4ITRC 3SG0A 5CG1A 4IGKA 4NECA 4R01A 3ZQKA 2LPMA 1T5LA 1GA6A 2QX9A 3VYTB 4B3IA 5GTDA 5TMEA 4I5IA 1E4EA 2HUPA 5BYBA 2NAPA 1SK8A 3BH0A 4GLBA 2ZIEA 2V59A 4MJXA 4OLJA 4DAOA 4ZJZA 4ZGBA 2P8SA 2OO5A 4HDKB 4ZKEA 2HLHA 3WK8A 2BJHA 5ALYA 2XHZA 5SZIA 4XX1A 2JH8A 3O4GA 2X9QA 2JCVA 3M1AA 1SXIA 2J45A 3DLCA 4MIKA 4MSUA 4JIMA 1G3QA 3DTNA 2VKTA 3W5CA 1E99A 2C8JA 3BTUA 2J9FA 1CZHA 2DPYA 3WI7A 3HB7A 2RB5A 1EFCA 2IYNA 3TE7A 1QE3A 1PZNA 1XVIA 3AJRA 4R8SA 1G60A 2O2ZA 1V7ZA 1DUIA 1RQLA 2FR1A 4QEZA 3U26A 1CUCA 1P4RA 3FSEA 4LVUA 1HR0B 2VF5X 4QXRA 2HRBA 4C2TA 5CLHA 3L93A 4E1BA 2GO1A 4EF6A 3KOZA 4H08A 1N2CE 2IFTA 3INYA 1M2OA 3KWMA 3TIFA 2P27A 3B1ZA 1AT1A 2QMHA 2ZCUA 2H5IA 4NWIA 3JAWB 1DFHA 3BEDA 1DCKA 1E98A 4M38A 4ZVPA 1L4YA 3TD2A 1EX6A 1PGQA 1OLUA 1G2OA 3ES9A 3KEQA 4IMIB 3S1LA 5KEIA 5ER9A 2IXAA 5EWMA 3D6UA 2F1RA 1FFCA 3KIPA 1DE0A 3MWKA 5C4GB 1C30B 4KBFA 2NZYA 3AONB 2IYAA 3RDPA 3FHOA 1HK7A 1FZQA 1N32B 4GYYA 4IICA 3BTVA 2X76A 3FSGA 3AQ4A 5HILA 9LDTA 3H9BA 4IL5A 1JQLB 4QGAA 4F6LA 3SOPA 3IKTA 1SC9A 2QROA 5EUMA 3X1YA 3HKDA 4M83A 4MWGA 1SVUA 1AE1A 1UCFA 4NENA 4R83A 1D4OA 4IG9A 4YT2A 4IX9A 5JQGF 3HBMA 4A91A 3P9CA 5DI3A 3NKFA 2HYIC 3UO8B 1JR4A 3UJDA 3SE0A 2O8EB 1PQ4A 2VH1A 3I5AA 4FGSA 2GEVA 4RYDA 3TIGA 1L7EA 4S1VA 3C45A 2AOTA 2FWBA 3RHZA 5IXYA 2NO0A 4BLSA 3K5PA 2QRQA 1M8FA 2ZI4A 2I65A 2QRJA 5CLFA 5C8DA 4XTCS 2BHSA 3Q2IA 4GO1A 4MV5A 4C1BA 1VA4A 5M04A 3ZR4B 1TPYA 1IULA 2BJVA 3WKEA 1X87A 2LCFA 3NGXA 2QD5A 4Q3AA 4MPJA 5AHWA 4P34A 2EP8A 1ZQ1A 1JT9A 1Q1AA 1V1JA 1ZRNA 5B3AA 3G2OA 3OMWA 4CL8A 1BKSB 4BMCA 1U3VA 4PZAA 4AP5A 2W6QA 3STVA 4DSTA 4UHDA 1CQWA 4Y2QA 3F4LA 2GNAA 3R7BA 1YQXA 3C1TA 4Z4CA 1Y1KE 1ECLA 2H6EA 2JHGA 4MVWA 4ZAGA 1IK6A 1VLJA 3KXDA 1ULHA 2C2OA 1RAHA 3QEMA 3RJ5A 3HSKA 3WG9A 3BJIC 1XFDA 2Q1XA 3D6AA 1GEGA 3DS8A 1DQYA 1ZH8A 1Z0UA 3ANTA 4L3WA 2C5EA 3L7NA 3VSEA 3AF4A 2OV3A 1EP3B 2A4KA 3ESBA 2I33A 3WB1A 5KOHA 2X3UA 5LMZA 4R1SA 3RW9A 1OZHA 4YACA 2YHAA 2C4WA 1G42A 2I78A 4P82A 1ZZGA 4NPAA 2OYSA 1ZVJA 5KOIA 5ALPA 3IEXA 4W5NA 2J31A 1BRTA 2H2GA 3NIBA 5JO9A 4TTJA 4WNYA 5TS3A 4KOEC 1NWCA 2IV3A 2KQUA 5GAJA 1DIBA 1PK9A 3F3SA 3HGQA 1HLGA 3ZUPA 4CMAA 4ZYWA 5CA0A 3D1JA 3TD9A 3GJRA 1J07A 1L7VC 1HM5A 4R2HA 3ZW8A 1LW6E 4Q00A 2XMCA 1TL7C 4BGVA 1SZDA 4M8SA 1KGSA 1RLJA 1T3SA 3BE4A 4D81A 3NUGA 2HBYA 4DN6A 2PWBA 2MINB 4UE3S 4GPD1 4EKYA 5F35A 2FE4A 1S2LA 3RWOA 2CLLB 2Q8QA 4UNRA 5KJEA 2ZUUA 2WG0A 4R7GA 3W1VA 3H16A 4IJVA 4OQLA 2ROQA 4AY6A 3EEIA 2EIHA 2OBMA 3D8HA 4ZO7A 4B6JA 4U7FA 3GLHA 1YFZA 1JZQA 3VR5H 5HMLA 4UD6A 4HEQA 3LLCA 1V47A 1UPFA 3FE2A 3AM1A 2WVGA 4QSMA 3TKYA 4YP1A 2BGIA 5MN5A 3CINA 5ECGC 4AN0A 2E18A 2H2FA 3Q11A 3R0IA 1R0LA 3OEHA 1L5QA 4YJFA 3ZLJA 2DH5A 2VDUE 3JALA 1N8KA 5T4HA 4B6FA 3NP9A 3FY4A 4GXQA 4O0LA 4J91A 3ZHVA 3ZCVA 5ICFA 1PAUA 1FRQA 4RMHA 5B1SA 3VXKA 3LNCA 1TTHA 3DCJA 3H19A 4ZA2A 1ZG3A 3U7IA 1E79D 3OOSA 3TXYA 5L3QB 2YW9A 2P7IA 5CA0F 3JATA 5C32A 1QZ3A 3I34X 1FP6A 3F9RA 1IWBB 1VC2A 5FF9A 2AMVA 4GDMA 5T57A 5FLEX 3WLHA 2NU6B 3JRWA 2VLBA 4KYIB 3WK9A 4ALIA 2FCRA 2C2KA 4MUBA 3B9BA 3HWWA 5DTRA 3E7DA 4HYYA 3HUFA 1RYYA 2FH5B 2XYVA 1ZJJA 3NCHA 2FZ4A 4FJ0A 3I28A 4QVGA 2HRRA 5KVAA 1FP2A 2VP5A 3HJGA 4RH1A 4V0QA 4DDKA 3PK0A 1R9GA 3FN4A 4J07A 5FHRA 2V7VA 2Q1TA 1JLLA 2JAQA 8OHMA 1GN8A 4U2GA 4X64B 4P08A 3ZWMA 1FMLA 1XYVA 4FEYA 1CJSA 4MVJI 1NVUQ 1UAGA 2G72A 3I1IA 3OHSX 4EA7A 1Q0TA 1KPGA 5E4JA 1P0MA 3WC4A 3QE9Y 1SHTX 1YL7A 2C8VA 2FN9A 3AI7A 2GERA 4F2GA 2IT1A 3CURA 4YMTA 2ET6A 3AW9A 5EZYA 1TJ4A 4LYEA 1ZAKA 1XRNA 2WIKA 5BSRA 1Z34A 3COWA 5ITZA 1FMTA 3HSSA 1J00A 1QX3A 1QP8A 2DKFA 2HU2A 2OHOA 3R9IA 3SCZA 3JZFA 5JFOA 2O8BB 3PRKE 1L5GB 3VM6A 3LLVA 1DEOA 1H2FA 1NURA 2EW2A 4PIVA 2PT5A 3HJUA 3WOHA 1I8TA 3DHWC 2F2TA 3M6IA 1D4AA 5H70A 3OJLA 1NYRA 5IKPA 1RYHA 3IMCA 1LPNA 5ILQA 4P92A 4F7WA 4CMHA 5TXGA 2SKCA 4D7AA 3I01A 4GF5A 1H2YA 1LU9A 3TGLA 1CDZA 3R5SA 1ECBA 3OJ0A 4PLTA 4MRMB 1VIDA 2C0CA 3VAYA 4OQXA 1KPHA 1ATIA 4WAUA 1H0SA 4MTLA 4AVYA 4EOGA 1HSZA 4FQ7A 4GMXA 3IYLW 1X8LA 3DZIA 1ECCA 4FTWA 1IATA 2VK4A 1NU8A 5F7ZA 1Y9DA 1ITZA 1RI2A 1U3DA 2IEBA 1U7OA 2CKMA 2XNSA 3KDAA 3L7BA 2I55A 3O4RA 2FE1A 3ZD9A 3EWIA 3LK7A 4IH4A 1QDUA 2SICE 3H18A 3T7AA 1L4LA 4TMXA 2R3SA 3FCCA 2V7QA 3O31A 3DE5X 3OCVA 4DQDA 5B4VA 3L1IA 4C6HA 3SDSA 5FOUA 3KSAC 1OYYA 5FPTA 5FOXA 3EULA 1IBMB 3TSCA 3NHRA 3D6TB 3OE7A 4BGUA 5CT9A 2I4OA 5BWMA 1IU9A 4KPEC 3FUWA 5EZYF 4NU0A 1JI3A 3O7MA 2Y93A 4YECA 3GF4A 3ZHQA 3VR6H 2DKOA 3VA7A 5F2KA 1DKUA 2F3PA 4QZVA 1OA1A 1R6BX 2ZR8A 3EGWA 4CW7A 1JN0A 3T3DA 4YC7A 4C6RA 2NV0A 4PYIA 1GPUA 1SU4A 4K9QA 3ONEA 2I6TA 3LCRA 3ME5A 4W4TA 4FYXA 2BSAA 3P1JA 4ZOQI 3MMSA 3WLJA 1PTJA 3WIVA 4PPQA 4HQFA 2PT6A 2FUNB 1L7RA 1E3SA 1LK7A 3P2OA 5A05A 3RPEA 4ZVTA 5JXGA 3PDIA 5CIYA 2QYOA 4KDCA 2MYNA 3MLAA 4MVJD 4QBGB 4RTKA 1JQDA 1T4BA 4KQ2A 1Q7GA 4OH7A 4X0EA 4RPCA 2N9UA 2X22A 2JFOA 2YOGA 5G4LA 1OFHA 4KQEA 2XEDA 4FOOA 4O5AA 4RLSA 1Z7EA 1QFMA 1UJCA 1X7YA 2WG2A 1G1MA 1TO1E 3OX4A 4FP9A 1B2RA 4R8LA 4CIAA 4ZZ2A 4EI9A 1QTQA 3E15A 3H3JA 1E9DA 3GXBA 3I9JA 1F48A 4BNZA 5B55A 3KPUA 2VCEA 3QEOA 1XD2B 3WK4A 2P4EA 3V8QA 1M7BA 4AJ4A 3A27A 1NVTA 4LI3X 1NONA 2YXLA 3G17A 2WV9A 3ZDBA 2JD2A 4ZEWA 2IP1A 1OXTA 2QTHA 1TC1A 4Q1DA 2PH5A 1MQ8B 2MCFA 2QRPA 4PZ9A 3GG2A 3PNKA 4F1KA 4C2AA 3T3MB 2CLFB 4JI3B 1IUKA 1BAPA 1NJ8A 1V6CA 2OLKA 3KZOA 5MFZA 1GTRA 4BO2A 2ZBQA 4HNAA 4RVHA 4KFCA 4DA0A 1RCUA 2HA2A 3DE4X 3EPKA 2B1RA 5EWLA 3F3YA 1NF2A 1YDHA 4EA9A 2JAOA 4OAPA 4QULA 1X38A 1U02A 3VR4D 4ZVNA 3EUEA 1B7GO 1DDGA 1L5RA 1C9KA 2QRZA 1R5OA 4IJUA 3NIDB 4WFQA 1G7SA 2P5UA 5HE9A 1KOGA 1U0JA 3RSGA 3QVUA 3KR2A 1L4KA 1XXHB 3GHHA 3T41A 3EVAA 1WTCA 3GNTA 1KJZA 2OCAA 1YV9A 4UVGA 1U1CA 4C9BA 5JROA 4QG7A 4J7AA 1W5AA 2FF7A 4DDVA 1H6DA 2R1UA 4OXRA 3QHQA 4RZ2A 1T2EA 2AC4A 2V0NA 2Q9BA 5GQSA 4CT5A 1MA3A 4H7EA 4YPVA 1EIWA 2P77A 4LDNA 1VJGA 2DR0A 3GFVA 4MVJM 5CVUA 3WMRA 1QWSA 2Y0DA 3SP1A 4ZZ1A 2V96A 5JYBA 5K0BA 1YZUA 5J2TB 1X7HA 1OFIA 3JZIA 5BVHA 4C4AA 1FQWA 2E4AA 3E7PA 4EJ6A 3PP8A 2ZUSA 5J1TB 4BNIA 2YL2A 1R4NB 2IYWA 1NVFA 4NBTA 5BSWA 4L72A 3WYDA 4C0SA 4NPCA 3PD1A 2E0IA 3ONFA 3BGIA 1EDDA 4FMPA 4IOJA 4RC9A 1JS1X 1M6YA 4DDMA 3VDXA 4EX6A 4LDJA 1GQ2A 5ECDA 1UANA 1YK0A 4F8EA 3I5UA 4LHYA 3FKJA 5DM1A 3O8RA 5LXTB 2FFAA 2RK4A 3R40A 1SM4A 1NX9A 3IA2A 3SXUB 2O8FA 5HZKA 2QTLA 3WGMA 1W4RA 2WJGA 3GRZA 4K8RB 2NZ8A 1UBNA 4YO7A 3UF0A 1XPOA 3I32A 1PHPA 2HWKA 4DDUA 5BUZA 2DQ4A 2VYND 3WO1A 4C3OB 1TEZA 1JXOA 4XWAA 2ZULA 1LDEA 1I6MA 1GTG1 3WL6A 2C95A 1R18A 2RGEA 2ZZNA 1D9ZA 4B6EA 1JYSA 1KYYA 1VYTA