4GI5A

Crystal structure of a putative quinone reductase from klebsiella pneumoniae (target psi-013613)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
259
structure length
259
Chain Sequence
SMKVLLIYAHPEPRSLNGALKNFAIRHLQQAGHEVQVSDLYAMRWKAGYDADDSGAPPVGEFWRPTLDSKQAFAQGTQSADIVAEQEKLLWADTVIFQFPLWWFSMPAIMKGWIDRVYAWGFAYGVGEHSDRHWGDRYGEGTFVGKRAMLIVTAGGWAEHYSPRGINGPIDDILFPIQHGMLFYPGFEVLPPLVFYRTDKTDAGQFADQCAALAERLDTLWQTEPIPFRRQNHGDYLIPSLTLRPELAPGQSGLAVHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords quinone reductase
publication title Crystal structure of a quinone reductase from Klebsiella pneumoniae with bound FAD
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 79
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gi5A00
3RPEA 3TEMA 4QOJA 4QOHA 2WC1A 4QOFA 3F2VA 1ZWLA 1TLLA 3OJWA 2MOKA 4H6PA 2Z9DA 4DIKA 1B1CA 2ZKIA 3KLBA 1FUEA 3NHPA 4NULA 1J9EA 5NULA 4CF6A 1CZUA 3HR4A 1CZKA 3N39C 3NLLA 4U7FA 4U7GA 2BN4A 5B3LA 3O73A 3NHWA 4ZVMA 2HPVA 4GI5A 1SQSA 1BVYF 3EDOA 3OX2A 2QX9A 4ESEA 4GR9A 4XDHA 4N82A 1YDGA 2N1MA 1ZX1A 1QR2A 4N65A 3N3AC 1GG5A 5ULLA 4ZVNA 2QX6A 3FJOA 3K20A 2F1OA 2M6SA 2D5IA 2FCRA 4LTNA 3GFQA 2MWMA 2KLBA 4HS4A 3ZHOA 4FGLA 3QFRA 5LLDA 1YRHA 4QOEA 5LMCA 1OFVA 5F12A 2BPOA 2Z98A 1FLDA 4DY4A 4NLLA 3FW1A 3NHLA 3QE2A 3LCMA 2FZ5A 2OYSA 1DXQA 3KAPA 2V5UA 3OX1A 1BU5A 1XI2A 4R81A 3OWHA 3OX3A 1F4PA 5TGZA 1E5DA 3NHSA 2Q62A 5F51A 4PTZA 3F90A 1H66A 3KEGA 2QMYA 2MTBA 1OBOA 1RCFA 1NNI1 1TIKA 4XDGA 1JA0A 1AKTA 1CZNA 4QOIA 4YALA 4Y9UA 5LBTA 4YQEA 3FX2A 1C7FA 2W5UA 1I1OA 2R96A 3LT5A 3U7RA 3KAQA 2GSWA 3U7IA 1AKVA 3ESYA 6NULA 3L9WA 4FGKA 2HNBA 3FNIA 5LBUA 4FGJA 1X77A 1YKGA 1QHEA 1YOBA 3NHKA 3TE7A 5JROA 3HLYA 3B6KA 4Y7CA 1D03A 4BMPB 4C0XA 2QX4A 1YCHA 1QBGA 3TZBA 2RG1A 4LTMA 3GFRA 2BF4A 3GAMA 3L9XA 1AG9A 1T0IA 1XT6A 3HA2A 4CETA 3W77A 2Z9CA 2FDXA 5NLLA 2FZVA 1AKWA 5LJIA 4FX2A 5LJLA 1RLIA 2QWXA 1CZLA 3ES9A 4J8PA 3NHJA 2ARKA 4YAUA 4C76A 2KQUA 1C7EA 1OBVA 3NHRA 1XYVA 1FLAA 3UXEA 4GQIA 1V4BA 4DILA 1DX9A 2A5LA 4PTYA 2QMZA 2FOXA 1AKQA 4U7HA 4QODA 4M0CA 3FVWA 5FA6A 4C14A 1FX1A 3G5MA 1CZOA 1KBQA 4S24A 1H69A 1D04A 4LAFA 1D4AA 3N3BC 2R97A 3F6RA 2QX8A 3W79A 4C0WA 3OJXA 2FLVA 1AMOA 5A4KA 3D7NA 2FVXA 4F8YA 2M6RA 1AZLA 1RLJA 1JA1A 1YCGA 4YAFA 3B6MA 4ICIA 3EYWA 1DXOA 4Y9RA 1CZHA 1FLVA 4H2DA 4BMOB 4OXXA 3F6SA 4N9QA 2XODA 5EMNA 5LVAA 4ZVKA 5FX2A 2OHHA 2Q9UA 3UXHA 1J8QA 2BZSA 3B6JA 4QOGA 1T5BA 2V9CA 3NHYA 1WSWA 3GFSA 3S2YA 2V5VA 4LA4A 2OHIA 1VMEA 3NHFA 3R6WA 1AHNA 1AKRA 4PU0A 3ESZA 3P0RA 1FLNA 2FX2A 2HNAA 4YAOA 4YAWA 3SVLA 2Z9BA 1WSBA 1SG0A 3O2NA 5EAIA 2MT9A 3QFCA 4D02A 2XOEA 1AKUA 1QRDA 1FVXA 5F4BA 1RTTA 3NFRA 4ZVLA 5FUQA 2BMVA 1KBOA 1J9GA 2X2OA 3NHUA 1XYYA 2X2PA 4HEQA 3W7AA 3B6IA 3JSXA 1J9ZA 2OHJA 2B3DA 2QR2A 4LTDA 3W78A 2AMJA 1YCFA 2FAXA 1ZWKA 3OWXA 3OVMA 5BUCA 1FTGA 5B3KA 3K1YA 5EA2A 3ESXA 1CZRA
chains in the Genus database with same CATH superfamily
1WD5A 1QVVA 5TF4A 4DCNA 3AKZA 3N8DA 4CF5A 2PN1A 3RPEA 2R7KA 2ZPAA 4LDJA 2G9VA 1F4LA 3VC3A 4CTOA 2QLNA 5ALIA 1E79D 3JXEA 2GLTA 5IDVA 5HIKA 3T1YB 2VWGA 1TYCA 4J0QA 4ZC8A 4A6XA 2IVZA 3PCRB 4M1YA 4Y1RA 4W4TA 3FIJA 3UG7A 1XNHA 1WF6A 4NZYA 4BU1A 2B4TO 2QBYB 1VJTA 3BH6A 1M34A 1UFQA 5A3RA 3MJ4A 1QGUB 4JDUA 3QLUA 5BXQC 1DRUA 1M7BA 2VT7A 3IP3A 5C8YA 3JW8A 4RZIA 3ZG6A 4G0OA 3KSUA 1H8ED 3T52A 3RC1A 3U3MA 1TT5A 3GLVA 3ABQB 4NENB 2PWZA 4IEIA 1J9EA 3KSDO 4UMVA 3TQCA 4EHLA 4QKQA 5KKCA 4OIFA 3WNCA 1QG2A 2UXCB 3P27A 4M9QA 1N0WA 2SKEA 4RVSA 4MKXA 5G3YA 1DFHA 2BEVB 3ND7A 3KETA 4MKHA 3LQKA 5HW0A 4DNFA 3N39C 3KV3O 4XARA 2QXUA 5ALSA 5GONB 2IZ0A 4BX9A 3OQVA 1EM8A 3KM0A 4FR5A 1Y33E 3LK6A 1NV8A 5BSMA 3GT7A 1Z73A 1JXMA 5C1BA 5KUTA 3MERA 5AW0A 1WMFA 4XM0A 1VRVA 2YWGA 5CVEA 4MVJD 4KU4A 1DB3A 2P4HX 2XUKA 4KEAA 1CETA 2HREA 5IPFA 4AIIA 3AL0C 4Y7DA 3W6OA 4OGWA 5CFRA 2QP4A 4CU5A 3QWAA 1CIJA 3GP8A 1P4JA 2F43A 2VAWA 3HQ4O 5C0OE 4C7BA 3FTNA 3TH5A 1C5KA 4I3FA 1QMPA 5L3ZA 5LD2B 2REOA 3W1EA 2ZYGA 3CVOA 3E7FA 4PAQA 1QIEA 3VR1A 1J09A 1USKA 3EGXB 1ONPA 1D6NA 2FQ1A 3BMCA 3MINA 1PL7A 4OQLA 5FOUA 4EGJA 1VPEA 3WRWA 5LP1A 3C1AA 2VTBB 1EXDA 2Y66A 3AEZA 1UDRA 2OCAA 4UHDA 3S5UA 1GT91 2C8KA 5ER6A 1X7YB 1G7CA 2Z4RA 3VFDA 4QFMA 1G2OA 1E94E 1ZGBA 1KZGB 1YR7A 2M6SA 1DT5A 3BK2A 3JAKB 3ZE2B 3IJEB 5J1SB 2UZ3A 3T7CA 1SBQA 4ZJZA 5J4KA 3IT1A 4NXNB 2Q3MA 1RP1A 1DAGA 4XIGS 5CCBA 1CJVC 2B6NA 2HK9A 3HKCB 2JAOA 3NONA 4ZI3A 4N0QA 2Z2ZA 1ZJ4A 5M29A 4R1QA 1EFHA 1XCPA 2MWMA 2YJ5A 1B8VA 1CJCA 1COZA 1XDGA 2WJVA 1EFKA 3KJEA 4KYVA 5AW5A 2B21A 2XT6A 4OUKX 4UPVA 1CJMA 5M2QA 2R65A 3H5VA 3QELA 4UW9A 1Y81A 3HB4X 4IKPA 1P74A 4EY3A 3U7FB 4JSYA 3AB3A 2CLEB 2CFTA 2PJDA 3B7WA 3RS8A 2XUHA 1MLDA 5J9FA 1QNFA 4ITUA 2Q3CA 1V39A 1ISRA 3E5MA 1FQWA 3CZ5A 3AFNA 3LQ1A 3O8LA 3OTHA 4NMWA 1V3TA 4RLSA 4UULA 2AKYA 1KI6A 2P5UA 2BRUC 3D6JA 2YZMA 1E4EA 1PL8A 4MMXB 4XGNA 2R6R1 5ALEA 1QLHA 1T0HB 2J30A 2BHSA 4GYYA 4V3BA 5J43A 4RFVA 5EWJA 5ALRA 1M2JA 4BC0A 4E30A 2QS9A 3O74A 3E53A 1E3LA 2R2GA 1VJ0A 3G9ZA 4TS3A 2H65A 2QUAA 3H1PA 3DV0B 2F3RA 1PYGA 2WF9A 2XHEA 1YGPA 1OFIA 3E5NA 3UV7A 1YIOA 1QKIA 3FGNA 4B3CA 1E1QD 1JT9A 2JGNA 5FT9A 3T5MA 2PX8A 1E3JA 2O23A 5G0SA 4L5YA 3BMNA 2VJBA 1CR4A 3QQ5A 1GYPA 1N2XA 1ZG3A 1P1FA 2XGSA 1YUBA 1TEHA 1YBHA 3IEIA 4BFUA 2EZ8A 3FCEA 4HNHA 2GPWA 3K4PA 4NEQA 3REQA 5C18A 1UBGA 5G0VA 2JGDA 5KSOA 1EFAA 2EFJA 1BE6A 2RGGA 1J97A 4O3FA 1CUWA 1Q16A 3A4MA 4HHEA 3LDHA 4YCCA 4WFJA 2ISQA 4KL8S 1KAEA 2OXIA 3NBMA 4ON9A 3JWEA 2OXEA 3ESQA 1VKZA 3KUUA 4PZEA 1P45A 1P4RA 1FU7A 1Y8QB 1DEOA 1TMYA 4D8XA 3FJ1A 4JMPA 4BJ1A 4FYVA 3EXFA 4XDGA 3AUJB 2I99A 1MPTA 4N7MA 2NT3A 1QBKC 2X8JB 3E7XA 3LK7A 4GIBA 4RQTA 5CVJA 2B82A 2DZDA 2VO1A 1QOQB 4ZI7A 3CE9A 1CZNA 3NIBA 4KWHA 4I55F 4PIMA 4RGYA 4YXFA 1U0BB 1EUCA 3PKIA 4H1WA 4E07A 5KYYA 1Z5NA 2R5WA 3PFHA 2QT1A 3OICA 4EHDA 3R5HA 4NQRA 4YTEA 3ZLBA 2DR3A 1MORA 2JFUA 4XH9B 3RK0A 3WLSA 3PVZA 4XCVA 2W2OA 4LDQA 2ENUA 4WKNA 2PD3A 4MRMA 1K89A 3KHTA 1P17A 1QXSA 1ZDMA 4W1PA 1MKYA 1XTJA 1HDEA 2NSYA 1H4TA 1M2HA 2AXNA 1Q0PA 3PF9A 4EPYA 2OM2A 4K8OA 5IVIA 1X9IA 1ZA2A 4JI6B 3IUMA 4DLRA 3ANYB 3BRQA 4IJMA 1F4VA 1OWPA 1V11B 3IH5A 1PLLA 1LSSA 2IYVA 3ESYA 4OH1A 2EG9A 2J8ZA 4CT4B 2RGWA 5KNCH 4JGGA 5C5DA 3EH2A 1G42A 3GOQA 3JZIA 4KI7A 4RIEA 4ALNA 2WIKA 3UA4A 1GPYA 1LPPA 2JLQA 4FMDF 1DELA 1Y1KE 2VHYA 3QTBA 1CJBA 2FR0A 2BKUA 2QV0A 1GZHB 3QEBZ 3DD1A 1J56A 4MVCA 3RTGA 5JCJD 1GTSA 2FW1A 2ZJ4A 4FR0A 1TKCA 3O2JA 3A28A 5MFPA 1MQSA 4IHQA 3LH5A 1U0FA 1VA5A 2BKAA 1UBKS 1ZCAA 3O1LA 5IC4A 4ESVA 3CEMA 1PX0A 4F06A 5BW8A 1V9LA 5BUSA 2QMUA 2FWIA 3HB0A 1RLUA 1ZJJA 2VR1A 4N0PA 5ENVA 4JYAB 1CEEA 1PFKA 5JEEA 1FNDA 5ERGB 5U9CA 4B3DA 4OK3A 2WILA 1RKBA 1WXQA 5DI9A 1F14A 2VAVA 2ZSAA 1VGVA 4ATNA 5CB0A 2XWJI 3I4CA 2QTFA 4DMLA 4XR4A 4O1IA 1QHHA 4QXPA 4JBHA 1TRKA 2ZRLA 1VJDA 1MF7A 3IILA 3KAKA 4NOJA 2OKGA 4TS1A 2E89A 2G3YA 4N3AA 3QEJA 2UUAB 3NBXX 4Q1BA 5HRAA 4DJEC 2EWVA 2XQFA 1V9CA 2GF0A 3KSMA 1V48A 1OFUX 1XTPA 1JFSA 4NG4A 2QTCA 1XRMA 3PX2A 5G4LA 2YASA 4ZEOA 3PEWA 3AHHA 4DEVA 3MTEA 4NPCA 1P6QA 1BQEA 3KZXA 2REQA 1ECFA 3C7KA 4L8LA 3U17A 3WO0A 4LFAB 2QLJA 4YASA 1ANKA 2NZUG 4BY9E 4YROA 4G24A 3P9XA 4HEA1 3BULA 4R69A 1FMTA 1U8EA 2HH9A 4BP8A 1NZJA 4UM7A 3BRSA 1JR6A 5KC9A 1YGYA 2OCYC 4MMZB 2NADA 5BN4B 2JFVA 3AIOA 16PKA 4Q19A 4KR3A 4MKGA 4A6DA 1RKUA 3S1LA 3BS4A 4TL9A 3IT2A 4B7CA 3IP7A 5LN1A 4TTTS 1G8HA 3HKBA 2C94A 1T10A 2IYXA 4J1NA 2B61A 4DQ0A 4GX1A 1YQXA 4EW3A 4OD0A 4YWHA 5AM0A 1DKMA 3KCQA 3NR2A 1A9YA 1E59A 2YWJA 1XQXA 2FF5A 2O8FB 3UCFA 1B0AA 3BMQB 2FFJA 5EXXA 3LDFA 3ZK9A 4PTYA 2BY4A 4D4GA 3JY6A 2P4SA 1MR3F 5A7HA 5TB5A 3T8YA 3NXSA 1TQDA 2BFCB 3GD7A 2AT1A 3EQ6A 4G97A 4RKWA 1OYWA 3UHJA 5KVAA 2HHHB 1Y6ZA 5B6PA 3Q12A 3LD9A 1GPAA 3DHWC 3UANA 3DONA 1L2TA 4E5PA 1SNYA 1E2UA 1ZM4A 5DHQA 1L5OA 4FHFA 5J3JA 1L9XA 3SOPA 5HRCA 2QOEA 1FQKA 4E5DA 4X84A 5FRDA 2BGRA 5A9RA 2PFSA 5IH7A 3U61B 2IIPA 1KBQA 2SCUA 4C78A 3DMRA 1ZRMA 2X8BA 2DTDA 3PQ6A 3VJKA 4Q3AA 1UBMS 4S24A 1XD2A 1A5AB 4J16A 1D04A 1EHYA 1N2GA 3LW7A 4GVLA 3MWDA 4NBUA 3RAGA 3ROXA 3ZGXA 5B36A 2HIHA 1NMEA 3COWA 5EUMA 4A8JB 4KRGA 5ICGA 5LMNB 2R97A 1XN4A 2B0CA 2ZBVA 4NBVA 4X8LA 1MB3A 4XCQA 1V7PC 1UBEA 3EMDA 3BSWA 4E12A 4FSHA 4EO9A 4L2IB 5J4VA 1NPYA 4RQUA 4MRSA 3GLIB 2ERXA 1VCOA 4C0AC 4XVCA 3OH8A 3ZYZA 2JCGA 2CLIB 3LX4A 1FUYB 4V02A 3PRYA 4HY3A 4KQHA 4JJ8A 2ZZKA 2P0AA 2QEQA 2YR0A 1V45E 2JAUA 2FWPA 4L08A 2YV3A 1RWWA 2OFXA 3OF5A 2O6LA 3FBWA 5H4HA 4BXOB 2L42A 1EVEA 3DE4X 3ILVA 2DETA 3T0GA 1HETA 4LY9A 4YAFA 5JANA 3H6HA 1VPVA 3PFWO 3UH1A 1RZUA 2O8CB 3PJEA 1DKPA 1YQEA 1Y5NA 4W5JA 3SSMA 1HC7A 3KQKA 3QBJA 3SC3A 4UU1A 5A02A 4UDYX 5LXTA 3V2GA 4WJZA 1IRXA 2HLDD 3CLSC 4H2DA 4IDBA 1A2KC 2HQOA 1L7AA 4DABA 3L04A 2B8JA 2FWAA 2DHCA 2ZT6A 2V5AA 4LZLA 4RMGA 3K9BA 2G40A 4TROA 1L1RA 1G20E 3OJLA 2CHEA 2JAWA 2H5IA 4IXDA 3BEDA 3MGGA 1LPOA 4XQEA 4Q1FA 4UNNA 3CE6A 3WB1A 2DQSA 5CVTA 4XYBA 4EG0A 4NHOA 1OKKA 2X7HA 4FU0A 3S2IA 4P3YA 3QFHA 5AXBA 3RQSA 1EHCA 2I8AA 5GJWC 3FMVA 1CT9A 1RWPA 3BK1A 3E22B 1VL2A 4KO3S 4UCFA 2EZ9A 5ALPA 2FZCA 5EJ6A 5IFLA 1Z68A 2BRUA 2UZ1A 3TRHA 4DGQA 1OH5A 1KAOA 4B74A 4W5RA 1WUJS 5GZ6A 1QWOA 1N5MA 3ITKA 5HMMA 3R7LA 2GEFA 1PRYA 5CT5A 2JVIA 2LR0A 5K8TA 1R16A 2GRAA 1YR1A 3E5RA 4H3VA 2VHEA 3UK7A 4WFQA 2IOYA 2WSIA 4F2PA 3ED1A 3LG2A 3H5TA 4FZJA 4L8FA 5P8WA 1LLCA 2R3SA 2VZ9A 4L0QA 4B4DA 3BDVA 4MJXA 3TBKA 4Q9HA 3D7RA 4JUBA 2BGIA 2AQHA 3BKWA 5IT0A 2JAPA 4LRSB 5CB8A 1M6HA 3ITEA 2OGUA 1EX9A 5FO1A 1AUVA 4BNLA 4XQ9A 5EZ5A 3JTEA 3EBPA 1MG5A 3M81A 3FTEA 3EZ7A 3ZGZA 5IKEA 2CUKA 3QFFA 3QI2A 3RFUA 4YXWD 2O5RA 3GEDA 4Y6LA 2GM5A 2PV7A 4L4SA 5BSGA 4H1UA 4AKTA 3C4JA 1N2CB 1O9HA 2JGRA 5I3CA 4MS1B 5JPDA 1A5ZA 2HD4A 2FQYA 3CVJA 3NPMA 5DTRA 5CM9C 1B42A 1M3SA 1U02A 2H9AA 2KW5A 2O50A 3IPAA 3MRVA 3P9SA 4NL4H 1EHIA 2C4TA 2JBAA 2VDLB 5B58T 4XRGA 3IIMA 2MT9A 2FX3A 2BFPA 1QUFA 1ICIA 2GFQA 4HVLA 5B58C 3QP9A 2XNJA 2KI5A 1RTTA 3OZXA 5FI1B 4JA0A 3K9FC 3HU5A 4JI4B 1Q1NA 1W4RA 4M38A 3SKVA 2VSNA 1EE9A 2ZRBA 3L7AA 2IPOA 4HQ6A 4ZVLA 3IT3A 4MUBA 2AEFA 4EVSA 1GNRA 1IHOA 4HWTA 3C1UA 1XK6A 4I55B 3UJAA 1NUSA 5FTMA 2DERA 3HBLA 4JLWA 3K2QA 4E4RA 3LRPA 1Q7RA 3DXYA 3OTGA 1K86A 2CXPA 4DLWA 2QX7A 3HR8A 3AKCA 2OZPA 2NGRA 3KRTA 2HIMA 3NNSA 3RSQA 2XTZA 5BW6B 1R0YA 2PVPA 4R31A 4WLVA 1A7KA 1S0UA 1SEVA 5IANA 1ORWA 1IVNA 2RMKA 3GVCA 3W7AA 3D6TB 4E2XA 1E9EA 1N5KA 3RKUA 1JHZA 1D6MA 3PR2B 4HEA6 1S2NA 2Z1NA 4RF2A 2WUFA 5ADWA 1VA4A 1UBOS 3JYOA 2RJOA 2XTAA 4UVDA 4B46A 3CFYA 3SM3A 3IUQA 1K27A 3WK4A 3AGQA 4QUEA 4BV2A 3RS4A 4BQSA 2X86A 4IINA 1IN8A 5F1OA 4EFDA 4LSZA 4F2WA 1EBFA 2BBSA 4GLOA 3AR9A 4M7RA 3KVRA 1T8WA 3LOPA 4MICA 4UM8B 1KWKA 1JJFA 2QKYA 2XSZA 4IIUA 4RETA 1QGYA 1V9SA 1M2EA 1WY5A 2OAGA 4U7DA 2P6RA 4UNPA 1U0RA 2X9NA 4DXAA 2OCLA 4YHHB 3D0OA 1VCMA 3WGMA 1JKMA 1HFKA 4UBNA 5U4QA 2VRNA 2ZBQA 1JBEA 3FYSA 3L40A 5DHPA 5KU7A 5G0WA 2I67A 1W4BA 1WY7A 2E5WA 2NPOA 4KE7A 4NCJA 4R6XA 4EYGA 1K8YB 3FDZA 4P4UA 3OA0A 1NFRA 3QF4A 4CEHA 5BV1A 2WABA 1SU6A 2WD8A 3OIYA 4TQUS 2IXTA 2Z5FA 2XZOA 4F1JA 1ZA1A 3BCRA 1BC5A 4IVRA 1ZWLA 1Z4IA 3QVUA 4CG2A 1EK2A 1BXKA 1CEQA 2IZOA 2Z2IA 3ET5A 2CY0A 4OXNA 4NEGA 3WNQA 3V1UA 1T3HA 3PVCA 1V1MB 4HMOA 4LJYA 4Z0TA 1B1CA 1RU3A 1JUDA 2I03A 2WJWA 3STVA 1FP7A 1DC7A 5GJBA 3EPLA 2ZZNA 2ZJ2A 2VXYA 3VR6A 2GPTA 3C6XA 1RCTE 1TK3A 4KVGA 1T9AA 2H92A 4KQFA 4MKRA 3IPCA 4OL9A 3TNDA 1QP4A 3KSBC 4C6SA 3WAJA 4F5ZA 4HWSA 2R6HA 2A14A 2FPUA 3GCXA 3IEPA 3KJFA 4Z9BA 3MWLA 3R7NA 3SNKA 3PYXA 4M87A 2YFYA 3CX7A 4UE6A 2HSGA 5F7JA 1HG0A 1V16B 1GOTA 5TARA 4UOEA 1EDEA 1O6CA 1W49A 1UEXC 3A4VA 1BMTA 1U2ZA 4L4UA 1T24A 3DOEA 4OLHA 1FRFS 2BGTA 4NYIQ 3LGAA 2QORA 4X7RA 4IO1A 5J4LA 1K8ZB 1TVKA 1E9DA 1G21A 3PXGA 1G0NA 1P3Y1 2O2XA 1N6LA 1POXA 5GJCA 3ZGYA 2AMFA 1IY0A 3ICVA 1J24A 1J99A 1R0XA 4PNZA 4R8KA 4PRYA 4L72A 2P6NA 2FVYA 3M2PA 3GRVA 1K68A 1LZLA 3ND6A 5CDTA 2MINB 1OTYA 3JQEA 4C7XA 4XWTA 1CS4C 3IOBA 4RPHA 4KR9A 2Y1GA 1YR8A 3NDBB 1MHPA 5KYXB 2JDID 5EGNA 3P0EA 3VPHA 4AP6A 3ZDBA 3KT0A 3NEYA 2IDJA 2C61A 5BN1A 3TPCA 4KVFA 1A9RA 3EZ6A 5H1YA 5FWDA 3MT8A 1U0EA 3K20A 5KOJB 2V0NA 1V1RB 3H3JA 1GTVA 1RNLA 4W5WA 4B4WA 5MDHA 2P67A 3TIVA 1U98A 2XMZA 2GILA 4PXYA 2WT8A 2P9ZA 5EP2A 4XRRA 4MB0A 1F51E 2E9SA 3EOAI 4NC9A 1JMVA 1YHZA 3EHDA 1Y8RA 4H35A 1UJ2A 2H1CA 3EEIA 1IJKA 1DWOA 2QVLA 4JKIA 4LDPA 4LTNA 3CRNA 4CVNA 2W6JA 5TJHA 2FDCA 2KLBA 1T4CB 4AJPA 4ZOAA 3GLFA 4CF3A 3IAEA 2X0JA 3HB7A 3W6UA 3H2KA 1P9WA 2GN8A 2BM9A 2AX3A 2RK6A 1L5SA 2QJOA 3H9EO 4JP1A 1IVYA 4Q9KA 3AFGA 5IZCA 1ZH6A 3LV8A 1QRUA 2PL5A 4ZYYA 1VP3A 3E3OA 3RR2A 3Q2KA 2BLLA 4QM6A 1PJ8A 2P0EA 3B36A 3QVOA 2O8BA 1SU4A 4JROA 4CKCB 2FXVA 2Y4OA 1F8GA 2OFFA 3HYSA 5KOIA 2H08A 2VCEA 3QIVA 4M0LA 2WP0A 5HTKA 1OSNA 1SUPA 3Q0IA 4LHSA 4DOMA 4OHVA 1MVOA 3BF7A 3DB1A 3DFFA 4M53A 1GNTA 3L8CA 5JJBA 5KTYA 1SOAA 1QE3A 5K0EA 1HOXA 2W6ZA 2QVYX 2I2BA 2EFCB 2Q4EA 2QL9A 2RHRA 3MT7A 4CYMA 1JDBC 2OL4A 4C0LA 5HBRA 2ZRDA 1XI2A 1KO4A 2QQGA 1LQ2A 2NG1A 4YDHB 1LTKA 1Q7EA 3WBJA 4F9TA 1XDUA 3Q40A 1U1GA 4BO8A 4ZU3A 3TFOA 3QSYA 4X1KA 2DUMA 5F52A 4CI9A 3K05A 4J0KA 3KUCA 1NF3A 2XLBA 1KJYA 1Q7GA 1C1HA 5BYJA 3RJ9A 221PA 4OP1A 4PTZA 5KTMA 1M7GA 1ZOLA 2P2ZA 4LVCA 1IN5A 3GWZA 4IDQA 4Q4DA 2I8CA 4B75A 4PFJA 3FPAA 4W99A 1RZRD 1OBOA 3ISJA 1LWNA 3OM9A 3QJYA 2AWOA 4KLZA 4M37A 1V3VA 1A7AA 5DYGA 4ANFA 3A1SA 4M7PA 3L0SA 3V3KA 2C54A 2DVMA 1S7GA 2PD4A 3UK1A 4ZP1A 3FVQA 3GZNB 1U5AA 2WI8A 2ZIAA 1QZZA 3C15C 4FNGA 2LRHA 1C4XA 4Y9UA 1SVKA 3UN1A 5JDCC 2BZGA 3ZHQA 1O94D 3RRXA 4K9DA 1SKYB 1RT9A 1M10A 1UEIA 5EZSA 3CMCO 4AU1A 1W88B 2O6HA 1MABA 2WIDA 5JR3A 4P5EA 1UOEA 4RIGA 3EUFA 1FZTA 1YTUA 1WXIA 1SXJE 4DRXB 3PBKA 4MULA 2XD9A 2K2WA 1U94A 4N8SA 3DHNA 3H4MA 1HBJA 3LT5A 3RVJA 1Z88A 1UK9A 5FDFA 5LDDC 1R6VA 3X3HA 1LDNA 4TMYA 4XOUA 3UJDA 1ZITA 1IHUA 2F7SA 5F78A 4YJGB 3R7AA 2IL1A 1Z47A 2OHOA 3ZH2A 1FJHA 2GD0A 3ERCA 1WUKS 1GUDA 2D2EA 3G7UA 1B8PA 1JBQA 4IHJF 4KR0A 4WVLA 1ODKA 4L4RA 5EJ2A 5FL7A 4BEBA 3WZ2A 3Q3VA 2ZRGA 1OASA 5FTKA 3WGQA 5LU9A 2DWPA 3I45A 4WINA 1SRRA 1B3RA 5DI3B 4I1RA 1JRLA 2ECFA 2R8RA 4B6GA 3UV3A 1OGIA 2B8NA 3H04A 2Q4DA 4EJSB 2BE9A 2QZZA 2ZR7A 4Z0NA 5LSAA 5COQA 1RI1A 3BC1A 3GJ6A 1P2UA 1X8XA 2IXBA 3DBRA 3HDJA 2TYSB 1SCNE 4G9BA 4X6YA 3E3NA 1Q6ZA 2J48A 1LK0A 2BCJQ 3MT0A 3QYAA 1MIHA 5DSXA 3FPLA 2ODBA 3L7NA 5FA5A 3IBYA 3RCBA 5DOVA 3HLYA 1OZHA 3HVJA 1PVOA 3O8BA 5D3MA 1RMTA 4XDYA 1WHTB 3EPPA 3TLBA 1KYIA 3RV3A 2VLBA 1NWCA 4ZZ2A 4P5PA 2C9CA 3RH0A 3IQIX 3LHSA 1XIVA 1M6VB 4PE5B 3UTCA 2UVPB 2Q6VA 1I3NA 3LGXA 4NV1A 2O1EA 4B84A 1Q0RA 4J76A 5TQ2A 4CM9D 4DUGA 2F6RA 1JEEA 2YVAA 2ZK7A 5ICCA 2GEDA 3O6VA 5JWOA 3B48A 4WCVA 3NXKA 4G65A 4KLRA 5CT8A 1WUYA 1NC1A 2IV7A 5DT2A 4A0GA 4I4CA 1NVFA 1D1TA 4CMHA 1YB7A 5AM2A 3GEBA 5J2UF 1CVLA 4ZAGA 5GY7A 1DOZA 2O3SA 4AN4A 3RFCA 1OAAA 2FG6C 4EA6A 1HMPA 3ANNA 4WL0A 3LUPA 4RJKA 1KOGA 3W77A 1P1RA 3TWOA 4N40A 3M5WA 2HQSA 4J7UA 4QL3A 1HTWA 1WBBA 1NN1A 4XASA 3FD8A 2MSDB 3T95A 3TPZA 2UYYA 3GJXC 4DNPA 4POOA 5LJIA 3D1JA 2EHJA 2Z2XA 4RDHA 4EUFA 5EHNA 2FUNB 5CCDA 5AK4A 1XMOB 1E79A 2WDZA 1QRSA 3UO8B 3I12A 4INZA 4EPVA 2OFWA 1SHTX 4BLQA 1FP4B 1SBIA 1WOYA 4P4GA 1XRPA 3ES9A 5AVWA 3NHJA 1IFXA 1FDIA 1NX6A 3HRHA 3I09A 4XX0A 4YAUA 3FRJA 3UGKA 3J81A 1FFBA 1JAYA 1ZL2A 5IKMA 3VJMA 3H83A 3B1JA 1FP1D 1ZI9A 4D9IA 2WYWA 1Z33A 1A7JA 2CK3D 1TTQB 4AWAA 5T4HA 3NTUA 4ESHA 2LUOA 1PEKE 1Q20A 2ESRA 1SIBE 3SDZA 1OLSB 1Q0ZA 2R44A 4N3GA 3GNQA 1FTYA 1GARA 1WW3A 2I71A 5H3CA 1GDHA 3EVGA 1SVIA 4LBYA 4C0HA 5BWCA 1WSDA 1JFLA 4X7BA 5A4JA 1SUBA 4W8HA 1DPFA 5JDIC 4JASB 4ZV9A 1IDN1 2EJBA 3ZY5A 2GTPA 4FI3C 3DL7A 1LSJA 4WERA 3AR8A 2AF4C 3IC5A 3C4VA 2HA2A 2QZSA 2RBKA 3MA0A 1C9JA 2R8ZA 3RJ5A 2IS1A 1T6ZA 3DYBA 3W5HA 5JH7F 1RQ2A 1EX7A 1DNPA 1XKTA 1VCIA 2YWBA 4MVJA 3CLKA 2YVUA 3TJZA 5ARBA 4Q7JB 1XCMA 2O20A 3UMBA 2JVKA 3B1FA 3VYTB 2WZBA 3EUWA 3L4BC 2JFZA 4ZARA 3NTXA 4US0R 4XTRA 2ZAYA 3CZQA 3G9TA 4GO1A 4KVAA 4R3WA 1O87A 2VZLA 2YWCA 2P9JA 3EEBA 4LXHA 4NYJQ 1C1YA 4KMRA 4MWTA 5DXAA 3ZS8A 3REFA 2EKQA 3BTVA 5HTOA 3ZD7A 3AFIA 1OJ7A 3K0HA 2HF9A 2J33A 2ZTHA 3F6RA 3SQDA 3VZQA 1XCJA 4LXXA 1NVXQ 1MO4A 2J5XA 2H7CA 3QK7A 2QU8A 1SHLA 1AGXA 2J4CA 2OTCA 2V9PA 3EAQA 4QU5A 2J0QA 1PUXA 1RBMA 4G0NA 5FNVA 1UBHS 1U8CB 3D8HA 2W6QA 5JPIA 5K3FB 2K4MA 3S28A 3LCCA 5M5BA 1X7ZB 2BM0A 4RFSA 3U39A 4RF5A 5HCUA 2WV7A 2V3VA 2V0GA 3PKZA 4ZZIA 2PQ2A 1KI3A 3FWZA 3IBTA 1AU9A 4II3A 4HSGA 3N7UA 3B6MA 1EJ2A 4P4SB 3SF8A 3SSNA 1KSJA 4QVKA 2DHEA 2GWHA 4X3CA 1KO8A 4K28A 2OUIA 3MQFA 3ZW9A 2NVUB 4YH1A 4DSAA 3HJFA 3EIEA 4ZI2A 4DR4B 5FUVA 3QEAZ 4OXXA 1P0FA 2ABWA 1Z5GA 3F6SA 2IIVA 2JHPA 2YQ5A 3GEGA 4LNUB 3TLAA 3R9WA 3PQDA 3DZFA 1QP0A 3EFOB 1PZGA 2ZUUA 4KPGA 3KU1A 1WNFA 2PG3A 4HEHA 2G28A 4Y2TA 1E7SA 3TG8A 1JNXX 3M3PA 5CGZA 2ATVA 4H4DA 4FZ3A 2C5FA 1QTRA 2I22A 3DHYA 4QLOA 3AW9A 5AW3A 3WHLA 3DXFA 3DEAA 3IMEA 2WM9B 3DBHA 3JATB 3NNDA 4OFWA 2QD3A 3DTNA 4ZCQA 2O1WA 1JQEA 5I47A 2X0DA 1IIBA 1ECJA 4K6FA 4J3JA 3TQIA 3OZRA 1LPAB 1NJ6A 4IIYA 1YTLA 2QXYA 2Q2VA 2WJZB 5CT6A 4DM4A 1B23P 1SZJG 1T5BA 4OYYA 1K7XB 1GP2A 1DIOB 2BTOA 4H7KA 5EE3A 1TADA 3PC2A 3ZHVA 3QWBA 4KAXA 4BKQA 4DLSA 2XB2A 4CEJA 3D7KA 1JFVA 4NATA 4ZANA 1E1QA 1OVGA 1Y34E 3LCVB 9LDTA 1ILEA 3RVQA 1ORRA 1TK9A 2GTIA 5IXJA 1I2DA 1II9A 1VG1A 3AVPA 3NC0C 4G37A 4WIAA 2M6LA 5IEBA 5AOCA 2OPHA 3UWOA 2AOUB 5HZKA 3SQWA 2VC2B 3LNTA 5KMGA 2A4MA 5EPEA 2C4VA 2VPQA 4O6VA 1BWSA 3EIFA 4U0JA 5AKHA 4KJZA 2PK3A 2HC9A 3W5JA 3JYLA 2P8JA 2DUWA 5KB3A 1OH8A 5K3SA 1G5QA 2AG1A 2PA0A 4Z2AA 3V9AA 4YAOA 3Q41A 4RK4A 1VL6A 1P39A 3RLFA 4RSHA 1AS0A 4Y1EA 4FW8A 2VPIA 3G7NA 4FC6A 1WIWA 1SKUA 2AXPA 3CRZA 1XLWA 3ONFA 3BGVA 3WK8A 5JRJA 3HLKA 2G83A 4YLEA 5HGJA 4II7A 1E7MA 4HT3B 1GSHA 4EG6A 4CKZA 1GPLA 1KMHA 3IR6A 4S2EA 4BO3A 5CLQA 3LXMA 3MJHA 4GVPA 4AJ4A 4DYDA 1WPGA 4NBRA 4EABA 2GETA 3O9MA 4LHYA 2QR5A 1KEPA 1RZ3A 1CJKC 3WGKA 3PEVA 1NSTA 5IM4F 2XMRA 3AU9A 2BOVA 2XUFA 2X2OA 3WLOA 4YUAA 2IF2A 3FPFA 3IBFA 2XXAB 2YZNA 3A2NA 4ZI5A 1HG1A 2HMSA 3CJRA 3FSRA 2JFBA 4HV4A 1XTRA 4DR3B 2FHSA 1E1YA 1M8FA 2G80A 4X44A 4WZAA 4HEQA 3GZ4A 4F21A 4TXLA 2FMFA 1KS2A 4H59A 3OT1B 4L5IA 1Z8DA 3W2FA 2GLXA 3Q85A 1JPVA 2OB1A 1E0KA 2R66A 4IHJB 3T3HA 3DC7A 3N7TA 4GPEA 5CA0A 4DIEA 4PLGA 4U2GA 3B1YA 4YRLA 1PWXA 2HU8A 1F5NA 3LDAA 1I9GA 2G1PA 2WPDD 4TN5A 1E9BA 1DPGA 3BHJA 3ESCA 2JCSA 1ZWKA 3FB4A 3B8HA 3IIEA 2VNSA 3OZVA 3MAJA 2PCLA 4L3OA 3QNWA 4PC1A 1CRLA 3G17A 4G4GA 2FZEA 1KP2A 1WKVA 3NAMA 4KO4S 1GM5A 4CCAA 3HL0A 1NQWA 3QUQA 4QYTA 3OESA 5HIJA 5KNDH 2QRGA 4BJ5A 2C82A 2ONCA 5FFFA 3A6HA 1W5TA 2BLNA 3SKXA 1EWRA 5GTDA 1Z6XA 3PIRA 4NCBA 4MLCA 2M1ZA 1ZUIA 1LTHR 3FPCA 3ML1A 5ECWA 2ZCVA 1VHDA 4JLPA 2IZ1A 4KSYA 1NUHA 1CZRA 3ESXA 4ZAZA 5LA6F 1LY1A 1RKQA 3HWRA 1A77A 2DG2A 2ZRJA 3LKBA 5LYJF 1SG6A 4LQCA 2WMNB 4MTCA 2IXEA 5FB3A 1IZ0A 1CQWA 4OFXA 3U7QA 2OCBA 3L0CA 2JK1A 1C8VB 4MQUA 4C2AA 5ITZA 4DB2A 4ZOQI 3CZCA 5AW9A 3WGZA 4QOJA 5DRTA 4ZKEA 5FBVB 2H1LA 1O0SA 4WBXC 5IDWA 4UCWA 4CKWA 1TQHA 3I6QA 2X8WA 2A35A 7ABPA 2A9QA 2B2CA 1A4IA 1SA0B 5CLLA 5J2UB 4F86A 1JGTA 5K3BA 1JKJB 1G5PA 4B2PA 4F3RA 1OH7A 1ESMA 2CCKA 4NFYA 4D9MA 2UZIR 5JI2E 3FN4A 4J0DA 2C9MA 4B81A 4G4SP 2W90A 4OHRA 3SCZA 1DUIA 3TM5A 3UYKA 3RIXA 4MB6A 2Q3JA 4BKPA 1RYYA 2ZJAA 2RAPA 2VXCA 5MN4A 3KJNA 1X1RA 1XMXA 2ANBA 3C5WP 4Q21A 3TRKA 1YS1X 3MPUA 1RXCA 1F2TB 1V7ZA 5DGCA 4PYOA 2NUTB 3D2AA 1KAMA 4F91B 2RD2A 2FA9A 2HA6A 2PGNA 3DTYA 3MJFA 1Z22A 4K86A 1GL7A 3SM9A 8LDHA 1QE5A 5I51A 3UZUA 1L7DA 2Q1XA 3C6YA 4NZMA 4R8SA 4FM9A 2E6UX 5LBIA 1MB9A 3LCRA 4LHZA 1UMCB 4FFPA 4ZVMA 1YWGO 1J4AA 3NB0A 2Z08A 1ZC4A 2CB0A 4ZICA 4IWYA 2ZVDA 5EXDA 1XGKA 2J6BA 2J5QA 3EUEA 4BEJA 4C0BA 4I6JA 2PLFA 1XEWX 1ZC3A 2AW5A 3PFBA 4D82A 4RSRA 2DRIA 4XEHA 1OXMA 1KSFX 5DV9A 4F56A 1E3SA 1ZX1A 1CUFA 4RTRA 5K45A 1KIFA 1P2TA 2F3UA 4BE9A 3T94A 2W11A 2EF1A 1LBHA 2QRZA 3DMDA 4HR7A 5B57C 2BKXA 3LWNA 3O90A 3ZQKA 5BWBA 1PJ2A 3QSGA 1FP6A 3MZ0A 2VLIA 3DWGA 1NYTA 4M0PA 1TLFA 4BU0A 4UEJA 2K7FA 1AY0A 1C8LA 1CDDA 1U1FA 4D8WA 4GI7A 4Y2HA 5JH7B 4BGIA 4RU1A 4HLDA 1OV4A 3S2GA 4UM5A 4F2DA 3D5TA 3ZVMA 1ULHA 3L4BA 3MEQA 4XWKA 5CXQA 1G7TA 1WTCA 5IABA 3KDPA 4RZUA 3DYVA 2ACVA 1OHHA 2XB8A 5L7WA 3AUKA 1JLMA 4QUBA 4DZRA 2PJUA 2VG8A 4EYKA 2DSNA 2XWSA 5CT9A 3CUSA 1BMFD 5KU1A 421PA 2IH5A 4RTQA 1NMSA 2PTGA 4M0UA 4QDZA 1L7MA 4GDFA 4L8VA 1C0EA 1DRJA 1VFPA 4JCCA 4YPVA 3B85A 4MWBA 4QAQA 4M4SA 5JO0A 2FEPA 1DARA 3ABOB 3GMDA 4MI6A 1XVLA 3G85A 3V4RA 4GDMA 2BJHA 9LDBA 3KT6A 1KJ9A 2W2KB 4Q4CA 3WYDA 1OFVA 5F73A 3GXOA 2IKQA 3UOWA 2GZ1A 1J1IA 1Y4UA 5KYWA 4J91A 4IILA 4PINA 1IVSA 1C9KA 1BQ4A 1Z2OX 2CHQA 3HLTA 4JSTA 4BLPA 1N6OA 4XB6B 4MJLA 1TW2A 2FE1A 2JLXA 2CEAA 4Y2GA 3LCMA 3PDWA 1CY0A 4YP1A 2AFHE 1XF9A 2FZ5A 5C34B 2AZ4A 3TLJA 4EKEA 4K81B 2J3LA 4DA7A 3E35A 4HK4A 1J8DA 3DEZA 3JAWA 2W6OA 3Q8WA 2O5EA 3A6DA 3NWPA 3QVGA 1JDPA 3UF0A 4BEWA 4YJ2B 1ODSA 3AGPA 3P9QA 1PK9A 1XJQA 2CLCX 3HJBA 2H4YA 4UHBA 2P9QA 5L7YA 1MJNA 4JJIA 3R7WA 4DAOA 3KD3A 3N8KA 3DR5A 2HV8A 3M6FA 1J0DA 3ND8A 1PT5A 3KALA 4EIWA 4OY3A 3K8ZA 2IQ5A 2P3OA 4K2AA 2PUGA 1KR5A 4B79A 2XYVA 2ODNA 2XJ9A 4CM7A 2Q62A 1CUHA 3BKXA 2DC1A 3IRUA 3ZK8A 4RV4A 2PS0A 3QY0A 1DDGA 1T9GR 2DF8A 3NTQA 3EEOA 5LYJB 3BXGA 4JQOA 3A0UA 3C8MA 4TM7A 2X8AA 3I9MA 4Y98A 5K3OA 4Q4HA 1KMCA 5E4FA 5T7BA 4DLVA 3FWKA 4N8EA 2VYVD 3IQDB 4M98A 1E3QA 3D31A 5LP6C 2PUDA 1O96B 2ZB4A 1GG9A 2D8AA 4BJ3A 2JJ2A 3TAHA 4CDGA 1G3QA 1C4OA 4HTAA 1A2OA 3KT8A 4YXWA 3H9UA 3MRXA 4PNPA 4JLOA 1H22A 4A03A 2UKDA 1I5OA 3QLJA 3VSAA 3CUEF 4L5CA 4YQEA 1ZH4A 3PUIA 1WLYA 2YWHA 3ZCUA 3H9JA 1SVSA 3HACA 2VP4A 4M89A 3A36A 3THRA 1F2DA 1QTNA 1JAHA 3GVPA 1JR3D 4GRAA 1XU9A 3RYHB 3GRZA 1H5UA 4YRRA 4RY2A 1YV9A 4H7DA 3ODPA 1TJ4A 1GY8A 3RT7A 5AHOA 5KDOA 3TZ6A 1B2LA 1Z0SA 5KQPA 4M8NE 1M0TA 4ER5A 1TD1A 4LRUA 4E08A 5FWYB 5GGYA 2AVDA 4LF6B 3TZLA 2O06A 2O19A 3MD9A 4LI0A 4Y67A 1L5YA 1YMVA 2GEBA 4NR0A 1NXTA 1P1IA 2CL0X 2RHJA 3R3HA 4FJ2A 4P5DA 1ZQ9A 4WX2B 4XLZA 4ZU1X 4D2IA 3DBVO 2YRXA 4P32A 1KARA 2FW6A 4BZXA 2FLKA 1E58A 1KH3A 1Y5IA 3HXPA 2QN8A 1DINA 4FGJA 2N46A 4ZV7A 3F9RA 4MDYA 2QRPA 3JD4A 2VPZA 2TSYB 4W5NA 4YMSA 5ALZA 2C0PA 4JBNA 4LF9B 1GUYA 1UAYA 2FPOA 3FTPA 4XUEA 5DBFA 4DR7B 3SS7X 1XLUA 3I01A 4E03A 5JBNA 4P58A 4PIPA 1LI4A 3IHTA 3IHWA 3OHPA 3V55A 3MMZA 1XXHB 3EEQA 4XX1A 2V3WA 3AYXB 4XA8A 1LC0A 1TFRA 3AJAA 1Q19A 3PNOA 4HZIA 4XJSA 4Z86A 2Y67A 3THXB 4YRZA 2CDBA 1LPSA 2W93A 3VZCA 1GRNA 1QIGA 1VJ5A 4BX2A 3EJ6A 5C52B 3I92A 1JVBA 3QWFA 2PFKA 3QZUA 4PR3A 2BCGY 4UUOA 4CN8A 1EFRD 3COPA 2JH9A 3ZXSA 4RA6B 1KOLA 1W581 1XEAA 3D7LA 1Q74A 4JL8A 3PITA 3OQ6A 4L51A 4QSHA 1YKSA 1WCWA 3PCXA 3O4IA 3LY8A 2V3CC 3RU2A 1RLMA 2AKAB 3CRQA 3NBAA 3WP0A 3AEKA 3EG5A 4LBWA 4U8HA 1YOVA 4D8UA 3TXYA 1E69A 1N0UA 1P4GA 1RLIA 1ZVQA 2RBEA 3L8DA 3VPFA 5A7FA 3BL5A 4OXKA 3PRJA 3SD7A 4FYJA 2X15A 2PT9A 1KY5A 3OHMA 1CERA 5F5NA 4O2BA 3RIMA 1BHSA 1H2HA 2X5OA 4Q7EA 2DFKB 2LNDA 5AJHA 3NP9A 2C04A 1B43A 1Z7YA 5DHSA 3RC8A 1DTWA 5ALFA 4KPUA 1XZGA 4IFIA 2GX6A 2D06A 2UUOA 2ZTSA 1JHVA 2D13A 5JATA 1QIIA 2VAMA 4GNKA 3OPYB 4M60A 4ARIA 4FYWA 3NTVA 1K08A 1YZ3A 2C3PA 4UARA 1NUTA 4BNFA 3L4JA 1NP6A 1PGPA 1DBPA 1PFWA 3CKLA 4UHJA 4UXIA 2P1ZA 1GPNA 1HL7A 1Q5PA 2X1MA 4P1ZA 4QTTB 1RI3A 4TS4A 3VYSB 5D8DA 1NXXA 2A5FA 4ZIRA 2QE7D 3IA2A 3KBBA 1EIWA 1XRLA 1JALA 2HU5A 3JQGA 3G1UA 1YA4A 1X80B 2FMHA 2Z30A 3E1KA 3Q7QA 4UQPA 5FFMA 1SXPA 4YLYA 2NWQA 4OHXA 4OM7A 1NZFA 4TTIA 3X1ZA 4R9NA 4CXMA 3OJFA 1DDIA 3L8YA 4U6NA 3WRYA 2VK8A 3D4LA 3WAGA 1MIOA 3KYCA 1U9CA 2XB4A 4EUKA 2VL7A 1EBBA 4L3VA 2WKPA 3MWYW 4M9ZA 3KKPA 5J5AA 5L8VA 4O0LA 1RIIA 4D6YA 2EWWA 1C7RA 2JJ1D 4RH3A 2VI5A 2VJMB 1FXSA 1UR5A 3GDHA 3QFSA 4H6VA 4DDMA 5G1OA 2Q49A 3ZE1B 1N5DA 4JQCA 4K46A 4U5QA 4HF7A 4G2NA 1EAYA 2G4LA 4GPZA 2GXQA 1T2VA 4C87A 3HFSA 5JS7A 2AUMA 5BV0A 1LLUA 2FEWB 4AFNA 1I2MA 4O5AA 3C98A 2OO7A 2XQVA 4MW5A 3BUSA 3L92A 3VAAA 1W85A 4E5NA 3IEMA 2HW8A 5E6SB 4MVJP 3Q6MA 2A58A 1YH3A 1HI9A 4O4IF 1FQOA 1MB2A 5BSWA 3ZD6A 2XWBF 3PUWA 4N4AA 5LZ7A 3ZZTA 4AY4A 3HJRA 4F8YA 1ID8A 2AXQA 1ZGJA 3ZU2A 3UOGA 2FW9A 3TS1A 4Q6BA 4BX0A 4QUGA 1N7JA 4EECA 3NH6A 3Q98A 4BMNA 2GCOA 2PZAA 2RHDA 5GVSA 3AONB 2FXIA 1A5SB 2WYUA 3IQHX 4G1MB 3W3AD 4B43A 1I3KA 1Q17A 1DTSA 1OXBB 5AWFC 3NV7A 4TPKA 2I0FA 2DM6A 2P11A 2ZUSA 3F49S 3FYHA 3L79A 4HMPA 5A05A 3RABA 2WMOB 3RWOA 4C3ZA 5GINE 1XRSB 2ZKLA 1FLVA 1OR8A 3MIZA 4FLFA 2Z8ZA 4E6PA 1S8OA 4DLNA 3H5WA 4GX0A 3DNFA 4G4IA 4OQNA 5D5PA 3CUKA 4UNRA 2HX1A 4EG1A 1AHPA 3ZV3A 5K01A 1HM5A 4WLFA 3ILYA 3SZ3A 2JFYA 1W75A 1B6TA 3H19A 3W0LB 3KJZA 1R0WA 2VDQB 4NBKA 5C1OA 4ZEXA 4INJA 3SZGA 4YT4A 4F8EA 1PFGA 5H81A 2OD7A 1WP4A 4JT9A 2GF2A 4ALKA 3DB2A 1OOEA 1TO2E 4R0NA 1XAJA 5JZMA 1RM0A 4HQNA 5EZQA 4R8RA 3VTKA 3ESAA 1IM8A 1PLKA 1M8GA 1GKUB 3CPJB 2ZJZA 5F5LA 1HR0B 3NRCA 1H9BA 1QYCA 4NFHA 3KVVA 3R0ZA 4ESOA 1NVWQ 2B99A 1Q83A 4H4CA 5LZ4A 1YHYA 3I9JA 3ZCXA 4CQMD 4UHEA 3GJ5A 1ZK1A 2VXOA 3RV4A 1UKEA 1TAHA 3ORHA 1KP9A 1E66A 1Y7IA 1XF1A 5BYKA 2AN9A 2UYQA 3E8XA 4R5MA 2JL1A 1ZRNA 3SZOA 4I5GA 1P3JA 1WB4A 5BT9A 1AKRA 2GNOA 1B2RA 1Y82A 5B2ZA 2I2FA 3TNYA 5HQ3B 2V59A 3AEQB 2CWDA 3C4QA 3C6ZA 2QJWA 3QIAA 1U2TA 3AETA 2WM8A 4O4LF 1Y8ZA 4ASUA 3LI2A 2ZCJA 1X7WA 2VHVA 3GLKA 4CKXA 4Z51A 3PQ7A 1WB9A 4BFSA 1T6YA 4OHZA 2QD1A 2RAFA 1U7DA 4N49A 4QUDA 1S01A 3GFOA 4TYPA 5DE3A 4TUYA 3WLJA 3IMFA 3AR5A 1RZRA 4IMPA 1SKBA 5JS6A 1FXWF 4R5HA 4JXJA 1UXIA 3PNPA 4NHEA 4NV3A 1Y80A 2TRSB 2YWDA 4J6FA 3Q5DA 2VPTA 4XVHA 3SS8A 4WDRA 1ZINA 1CV2A 5F23A 2XOEA 4REQA 1NAHA 3LBHA 3IA7A 5AHWA 2HQRA 2J9YB 4D1YA 5EJ8A 4B3TB 1MENA 4TL8A 1KQPA 4M2LA 5L95A 1BW9B 1QIHA 3RRBA 2ZAIA 5CBPB 5FUQA 3QHQA 1ZD1A 3C8UA 1XWWA 2FSVC 4MVJI 1PEYA 5GZ3A 3ADPA 2GPYA 5LR6A 4ZDWA 4IJKA 4PG5A 3JYNA 1E92A 2FP3A 2I1LA 3Q88A 1U28C 5DK6A 4DCCA 4HNUA 2C3OA 1UAGA 1VHJA 1O08A 2AL7A 2XGGA 3OOJA 4QU0A 3RS2A 4EGSA 1DAIA 3EIOA 2C9OA 5F7ZA 3R76A 2ZI6A 1GZSA 2WE8A 3ER6A 3I76A 1XUOA 1XZAA 2HBQA 4WZBA 5HHTA 4KHPB 4RK6A 1Q0HA 3P97A 2V4UA 2P69A 1TE2A 3KFVA 5KNLA 3PYLA 3JSXA 5T5QA 4BEVA 4F7DA 1FOEB 1EJ6A 1HQDA 4LTDA 1FSZA 4D99A 3C87A 3LY9A 2GXAA 3P4YA 1YFKA 1SBYA 3UNXA 3UPUA 4YUXA 2ZITA 1PV2A 4O4JA 2DPGA 1FTNA 2CE7A 4ITVA 4IW3B 3T0FA 4G86A 4EQ6A 1BKDR 2QZ9A 3L7DA 5A2GA 4ZZ1A 2BSAA 4D96A 1O0BA 1EZ4A 1K9SA 1FTGA 2CHVA 4GRIA 4KXVA 2JHAA 1G8PA 3TKYA 1MUUA 2HK8A 2XOXA 3EWAA 1X3SA 1E61A 4FILA 5A0VA 2NV6A 3TLMA 2GB4A 3MD0A 4BV3A 5JE8A 1EB9A 1UM9B 1WMBA 3ILXA 4FINA 4BP1A 3DYIA 4RKYA 3LWZA 4CM9A 3P2OA 4Q15A 3R75A 3UY4A 1JN0A 3BTOA 3EVEA 1MOSA 1O6FA 4TMXA 2F59A 4LZWA 4LOHA 4YJHA 4CPDA 2IE0A 4HNTA 3IAS1 3LXXA 3EYAA 1P4AA 2CZQA 2GNAA 1UFRA 2DLNA 2O8NA 4HNRA 4R84A 3ROMA 3TTYA 1FIUA 2Z8YA 5KOHB 2Q1SA 2VBCA 3PXUA 3UXYA 5AW4A 1HDOA 2O0KA 4LYFA 4YRBA 6YASA 1JU4A 1DIBA 3KJHA 3O9ZA 2RB5A 4CKEB 1TEXA 3QNUA 3TTUA 1Z8FA 5LQUA 2MOKA 2HZ7A 1NJ8A 5F1KA 4FMBB 5KWIA 4LDNA 5IC6A 4H1TA 2P90A 5E7JA 1BFDA 2GM4A 1Z5UA 5A3VA 2WJPA 1EBUA 3O3MB 1M67A 3BRCA 1VIVA 1EK5A 2VDJA 1DEAA 2IHBA 1QORA 3G0IA 2JA1A 4EUSA 2BGMA 2C20A 4R7TA 2RC5A 3PUHA 4C06A 3B70A 3QU5A 2FETA 5THKA 3FYTA 5C7OO 1QC5A 4YDQA 4CIYA 3CLTC 3MJVA 1RXWA 2O2SA 3W9UA 4NBSA 4IJUA 3K4HA 5WRFA 4MV6A 2ZYTX 1RXSA 1FBTA 2NW6A 3C3WA 3B52X 4IGFA 4UE2A 4E4TA 1D09A 2PRKA 3FMOB 1HEYA 2RHOA 3WLKX 4BNXA 5HPYB 1JQKA 4N6NA 1P7ZA 4HB0A 4NH4A 5AM1A 3ZXIA 4BGVA 3ZPXA 3MMNA 1FSPA 2CLMB 3C3PA 1JEJA 3HO1A 2CUZA 3LZCA 1Y6FA 1GDDA 3PHJA 3PPXA 5JZSA 3AESB 1CE8B 1YSCA 4GKVA 4OATA 2WIAA 2X1VA 1XQWA 1E6KA 2ZJ0A 3JD2A 3QVKA 1OW3B 1YMQA 2VDMB 4BQNA 1IWOA 1P0MA 4I2NA 3DE3X 3GJSA 3Q8MA 3JR7A 2J5KA 5EZYA 2NSDA 4ZCMA 1D0IA 1CC1S 3UAZA 2N1BA 3RT1A 3VHLB 3EC7A 3E15A 3ICCA 3LO5A 4RO0A 3JQ9C 2ZIEA 3AR4A 4D0NA 1WXHA 3DBOB 3KWMA 3UK2A 1DCFA 2Z43A 3NTOA 3UATA 1BEUB 3R3ZA 5LQKA 1LU9A 2I1QA 3VVLA 3DO8A 1P2BA 4R0VA 2B35A 5F5XA 3D6MA 1AN9A 3TSZA 2WG1A 3D4BA 5BR4A 1SFRA 2ZWMA 4WOPA 4YK7A 3WOVA 1KEUA 4LPKA 3ER9A 2M98A 4YJFA 5REQA 3MTDA 4GKAA 3NIWA 4M1ZA 2XCOA 2FMKA 4KXYA 1RQXA 3QRWA 3T3NA 2UUBB 1NW7A 2DQYA 2Q2OA 2V1XA 3CWQA 2ZUDA 3D6VA 3Q9NA 4W1RA 5AVRA 3K2IA 2DBZA 1ZXXA 3VJLA 5AUNB 1I2BA 4DJTA 4ZCSA 2OD9A 2REXB 4MUXA 2JD1A 1DSSG 5JAOA 2RH5A 2W6IA 2BKEA 2QSUA 3ACBA 2RHWA 4WJLA 5BW4A 1AB5A 2W2PA 3AERB 1GJRA 3IE0A 3MVEA 4FIDA 4MA5A 5CDFE 2CT8A 1JYSA 3QKTA 5I7HA 1GR0A 4FXOA 3X2EA 4IDFA 2R8BA 4E4YA 4Z4FA 4MRVA 1CDEA 4O4IB 4FKZA 2PMEA 2CL6X 2BFEB 5BVHB 4CLXA 1JL3A 4P86A 2DOKA 2GKOA 4FOSA 3NH9A 4YWJA 1GNQA 2OV2A 2W22A 4BUCA 4D98A 3UJ3X 3JQQA 1WF3A 2KYRA 2YHIB 3QLVC 2ZSEA 2ORED 1IN7A 1Y7LA 3EDCA 3JVVA 2WTAA 4CTJA 5I7FA 3OFND 4KKVA 5IJ0B 2JKZA 1THGA 3GLHE 1FSSA 1L3CA 1SY7A 2I62A 3UW3A 4YMVA 5A7GA 2QG9A 3QKRB 4M1MA 4WN3A 4AZTA 4UQLA 5KIAA 4I5FA 3BE5A 4Y30A 3AI1A 3UJ6A 4C22A 3DWIA 2KLHA 3HCAA 3PFIA 5CPBA 3F3MA 4MPRA 1OA0A 1Y0BA 4HB2A 2DU8A 1ENYA 2JIMA 1GPWB 5GV7A 1Z06A 3O03A 3C7DB 4CWAA 4QDUA 2VVTA 1TCCA 1R64A 1CKEA 2RH8A 4X94A 1OLXA 1EP1B 2JGLA 4D9BA 4FS3A 2ZW9A 4REMA 5A4IS 2OHVA 2AJCA 3PNBA 1DVRA 4H27A 2IE8A 1WP9A 3KEMA 4JXZA 2IFTA 5C2JB 2W0MA 4KZPA 3NUZA 4FTWA 1V8OA 2Y2VA 1XMVA 2EFHB 1H66A 3G8DA 1X3LA 1EUDB 1M2KA 2FWBA 3L8MA 5BUQA 5JADA 2IUSA 2BH9A 2XQGA 2ONKA 2WD7A 1M2OA 2WF7A 4RCVA 1SKQA 4TMVA 5AHKA 5DM60 1V95A 1DXYA 3TAXA 4BO2A 1TIKA 2R79A 4PQYA 1ESNA 3CJTA 5CW2A 4BNGA 3KQUA 1IEQA 1PIWA 3DUFA 2PX5A 4W9NC 2WAYA 3GLUA 3EMVA 1QCDA 2Z58A 3K0AA 2FB9A 3OI7A 1TW3A 2HHAA 1B7GO 3BWBA 3KXKA 1E7YA 1AQJA 1KYWA 2Y2UA 3F8SA 1M83A 2GNPA 2BF7A 4XUGB 1MA3A 3Q8XB 4EF5A 2B69A 4NYMQ 2ZB2A 3PNVA 5BRJA 1OI3A 1R9JA 3TW8A 4O4LB 1Z3CA 3AHJA 1N4DA 5GAJA 4V2IA 5CD9A 5DZSA 2YOHA 3RI3A 3WYEA 4DJJA 3TCNA 2A1UB 3K73O 4YACA 2ZTLA 2Q5FA 2WIBA 4LS3A 1SEPA 1Y63A 2PL3A 3OPVA 4N7RA 3UKOA 1W0JD 3GJ8A 5TQ0A 2BISA 3X0DA 4JLAA 3SS9X 1S3IA 3CUVA 4WESA 1KZ1A 2FMUA 4HZUA 1XELA 1BEZA 3H1AA 1VIMA 3OEHD 3DFZA 3L6RA 4DARA 4R01A 4C05A 1OWNA 3FOFC 4OHOA 4JBGA 1AA9A 4P7FA 6NULA 4L8GA 4BVEA 1G6HA 1WO8A 2JIOA 3HO8A 1ZM2A 1TVEA 1XKQA 2FEKA 2ZUWA 1A9XB 2FSVA 4K9KA 2B6HA 1FSGA 4FFBA 2XJ4A 1FNMA 3RO7A 2XTNA 2P9BA 3QKSB 1U28A 1NY5A 2F00A 2DKOA 2QTLA 1O3YA 1OC2A 2OVBA 4MRRA 1YJXA 4HD8A 1RTKA 1L3IA 4Y7CA 4M8IA 1RRCA 4LUCA 5EJ4A 5EIAA 5JD3A 3GUZA 4PFKA 4R98A 3V34A 4ARZA 2X0NA 4QGGA 3HB1A 4BCDA 4PF1A 3UWPA 1NULA 1V47A 2BBTA 4F3KA 3OQMA 2N47A 1JQJC 4JS0A 4OP2A 4WLNA 1HYQA 1OIVA 1KJWA 4B9AA 2CDCA 2Y6UA 5E2IA 2IQIA 3GFRA 4LGCA 5LDGA 4GM4A 3MJTA 4OLFA 4TKUB 2WF5A 4Z7JA 4GEGA 4MLDA 3GU3A 3PGXA 1L4UA 4MW7A 3TX2A 3LC1O 2I66A 1KVQA 3I83A 3HG7A 4H7JA 1TYAE 5FWAA 4I5IA 1H2XA 5FBQB 1KFKB 1KL7A 1S4MA 5BNWA 3GJ3A 4BHTA 2FPIA 1JYFA 3GRKA 1Z0JA 2QRQA 3VV3A 1NFFA 4QA9A 1L4HA 2JFFA 4AJ9A 4AY2A 1TM2A 3GUYA 3PQFA 4JBLA 2QWXA 1CZLA 4LSGA 4BFXA 3V8PA 3T1OA 2R0QC 2VAXA 3CM0A 4EAQA 3RIEA 3KYIB 4O4HF 1JU3A 5JYDA 3CF2A 2H7VA 3U3DA 1E8MA 3TNJA 3OKFA 1WOMA 1U0OC 2F9LA 3AJ8A 2IBSA 3P9ZA 2ZZMA 1L5VA 2CXUA 4XFJA 1DLIA 4KPFC 2GMWA 3CSSA 1L5WA 4JJEA 1L5HA 1OX4A 4JWKA 4ZXPA 4BO4A 5KYUB 1KJJA 3E23A 4WY2A 2MYPA 4P34A 2WAAA 2A0KA 2DY0A 3H2IA 1A7UA 4GQIA 1ESCA 2VF4X 4G85A 1K63A 4NPHA 2X3FA 2QUJA 3KZNA 3THYB 3DSRA 1UC5B 1VPLA 3DUWA 1GZDA 5IAJA 1M2VA 3ZDFA 3MSCA 5LDHA 2ORIA 3EQ7A 2Q6KA 4FPXA 4TV9A 2ZYDA 4HI0E 2O54A 2CJWB 4OA5A 4RV5A 5EQFA 3RB8A 5EPOA 4G0XA 5JU6A 1V96A 2FFQA 4Q01A 1Z26A 4UNIA 3KQHA 3A6PC 4X62B 2B8TA 3TD9A 4C1NA 4FWTA 3O7MA 4KRYA 1P7YA 4EI7A 1OXXK 2NNLD 5ALOA 3L6CA 1BFKA 4S1VA 4XXHA 1DQZA 1P5JA 4HS9A 4N5DA 1EVYA 1O9BA 3G0GA 1W9MA 4HDNB 2VUHB 2GZMA 3I34X 1H69A 3Q3IA 3MFQA 3E2MA 3HI6A 1MX1A 4KDRA 5JI3E 1MJFA 2NVBA 1IULA 3LYLA 2P6UA 1NVEA 4GGMX 4POAA 1D4AA 4RK0A 3U3ZA 4BVBA 1MZPA 3U40A 4X1OA 2X7XA 4G5HA 2WU8A 4RD1A 1Q95A 1BHQ1 3ZD9A 4LRQA 3DDHA 3S44A 3O95A 3IKTA 1Y4ZA 1VIDA 3D43A 3EH1A 3LUBA 3GJ0A 1N6RA 1ISFA 5ECDA 1L1FA 3S2UA 4I50B 4Q9NA 4EJFA 4E15A 1PZXA 3BE4A 5A4KA 1Z12A 2CGEA 3JQ9A 1ZOSA 4UCQA 4HNAB 3HYRA 4I6EA 2PKQO 1OI2A 1ZD5A 4U5XA 4UMEA 1JIVA 4ZOLA 5IJ9A 1MX5A 3H18A 4CFSA 1NQAO 2OSBA 3GWGA 4HQOA 2CZGA 4KYTA 4MYSA 2V7QD 1VM6A 4K2HA 3VZBA 2FFRA 4AQDA 3IAAA 5K0GA 3AY3A 1G8GA 1OZGA 4NCIA 2OZKA 3N2YA 5EN4A 3MJSA 1EFTA 3OLCX 4Y9RA 4QPJC 1V0JA 2HTEA 4BNIA 4HTFA 2I29A 2YV1A 4OHWA 4QHTA 3GPIA 1LVUA 1AUQA 1H05A 2HA7A 3OOSA 4EF6A 1YCDA 4MYUA 2GM9A 3CZ4A 3F3YA 5AMXA 1HFEL 1KORA 4BNTA 1G8SA 4DA6A 3EB9A 2IHKA 2XY4A 1NW6A 4IVQA 4F6RA 2VQ3A 4HH0A 2OZVA 2XNHA 3OPXA 3SVZA 1QGAA 1FXUA 4MLZA 4DMKA 3PNSA 1ZUD1 2W58A 1B0UA 3DG9A 4RY8A 3AV3A 3VO1A 4TZ0A 1JYEA 2JANA 3KZVA 4U3JB 4PYRA 1QX3A 4ZRMA 3O84A 3JQAD 4HGQA 5G1NA 4OTZA 3UXHA 4EHAA 5EMKA 4DDVA 1U6KA 1AV6A 3MQ2A 2VJYA 2ZBPA 4AIRA 1KZHA 2TMYA 4KV7A 4KQWA 5EEGA 1KQ3A 4B6EA 1XJCA 4QGHA 3ILSA 5KEIA 3W2TA 2O7RA 1V2GA 4X45A 5G4KA 4IGAA 4X6LA 5ALLA 1LVGA 3I73A 4QARA 1JJIA 3QLVA 2C7OA 3K32A 3I04M 1TU0A 1W2HA 1BH2A 4MNTA 3A1CA 2VHTA 1VIYA 4ZK6A 5TPWB 4PFSA 4RSMA 4DQKA 1HZJA 3DO5A 3V4PB 4DW8A 4QYSA 3TVDA 1UXJA 5KZMB 2ECOA 3DMNA 1VJ1A 3PLNA 4OBXA 2EP7A 3K9HA 3PQ2A 3UHFA 1V5EA 2FSFA 2QM8A 5EIBC 1XCBA 4YP5A 2GCEA 1LX6A 1ILWA 4F97A 2BWJA 4WLEA 3OTOB 4M9RA 2R1TB 1PKEA 1BU8A 1MVLA 3KKZA 3R3SA 4JL6A 3SYRA 4I7EA 4U6SA 1BMQA 1TIBA 1SRQA 4N5LA 4C4RA 2C78A 2KSQA 1KZ9A 3KHSA 2Z9BA 1AQLA 1ESEA 1TVCA 3NVMB 2JI9A 4DFDA 3HJUA 2ZAMA 4JVLA 1CLUA 3AUYA 5EAIA 5MGNA 1R18A 2C2HA 3AF5A 3WLTA 1GNLA 2BFBB 4EHKA 1Z0ZA 2ADFA 2R85A 1AKUA 1TCAA 2VDRB 1N2OA 2Z83A 1E6UA 3CVVA 1L8QA 5A3JA 4W9NA 4CMBA 2G7ZA 1KE1A 3S0JA 4IJQA 2I7XA 4CHTA 1Z6TA 4DCUA 4LWPA 2CMKA 4YECA 1ACJA 4JKYA 4TLEA 3NC1C 1L6IA 1ZCFA 1WQ3A 1WEHA 1JR3A 1LNSA 2K6GA 3K0BA 3ZQJA 2AD5A 2H17A 2GJKA 3NHUA 4BAZA 3IIJA 5EIXA 1ZD4A 4KWCA 3FWYA 1BOOA 3C45A 4UPEA 4WK4B 3IFSA 2I78A 1C9MA 3HYLA 2Q50A 5EQDA 4EAAA 5JAZA 1CY4A 1V8PA 2MSWA 1L5FA 1XROA 2P9HA 4X0EA 3WJ1A 4EHIA 1HZZC 2BMWA 3D1LA 3OBBA 3USES 2JKVA 4NCXA 2OHJA 2PRSA 3QX8A 3WK5A 1K6MA 1F38A 2OCKA 2R4TA 3AZPA 3FZQA 3P52A 4GMKA 1F7VA 4MQEB 4KXQA 2HSZA 1GU7A 2P9YA 4X1IA 3RG2A 3G5LA 3P4UA 4RM2A 1NNSA 5HF9A 4JLBA 2V55B 5JW6A 2FUKA 3AY0A 4LOKA 2V65A 2IITA 2ZDQA 4RZSA 1WZ2A 4J7XA 3RHZA 4IV0A 3GR6A 2W4IA 3A06A 3KBOA 2JEZA 3WYCA 3HVRA 1HT3A 2K87A 3ASVA 2XBMA 1WDTA 2YYSA 3H9BA 5EWMA 5F1YA 4BE7B 3L1HA 2C2GA 4MR9A 2JZOA 3PHHA 2GBPA 3JYPA 8AT1A 4JQSA 1QRRA 1LZKA 2WNSA 2J6CA 1U8TA 2GVDC 4JI0B 5AO9A 5CYFA 1QE0A 4HH1A 1R9MA 3W5IA 4J2OA 4D41A 5KPJA 5ALGA 2I3AA 3FE2A 5A06A 5P21A 4D5EA 2J09A 3AWIA 5T41A 4AAYA 2O8DA 3AP1A 1GCOA 1EFRA 1OFTA 4HDRA 4EYQA 2Q3HA 4W5OA 1VG9B 5A9TA 4U8GA 3E9YA 3PEYA 3EA0A 1WD7A 4QOFA 1WM1A 3F2VA 2R6FA 2CW5A 1NN0A 3BFPA 4D8VA 4ZCRA 5JY6A 4BO0A 4C7OA 4MKIA 3IKVA 3UH0A 1T4BA 3RVSA 2DQKA 3HSSA 3SHVA 1IRIA 3QKWA 3B78A 4F5YA 3QUCA 5CIWA 2NZVG 1T5HX 3GK3A 2VRCD 1G98A 2C58A 2HCJB 2C1XA 3M2TA 1AT1A 1S89A 1DRKA 3N28A 4J6EA 1Y1PA 4PICA 1UL1X 2YJTD 5EL0A 3VJRA 3NJRA 4UKDA 2O8EB 1N1GA 4CKYA 5K4AA 2DWUA 4KQ2A 4UAJA 3EODA 1EFPB 3A58B 5FFNA 2QM3A 3KTAB 4JYCA 4RA9A 1PTKA 2FF7A 3K5IA 3P9IA 3MCTA 1LUAA 3I05A 2EGGA 1WZEA 4LECA 3LVRE 4O4HB 3PR1A 4R8VA 3JVUA 3AR2A 3COZA 1QH1A 2CHFA 1FFWA 5EI5A 1ZH0A 4EVQA 4A2CA 1CEXA 5DGDA 2XIQA 2P0YA 1N8TA 3O73A 3DFKA 5K2MA 1SCUA 2EF0A 5LQMA 2OQRA 2HNKA 2YNMD 2W8BB 2YDYA 3G2QA 3FKSD 2D0PB 3DTVD 3T5TA 1P1KA 3D6FA 3ELDA 3ER8A 3IO3A 3ND9A 4EG4A 1I32A 4EGAA 4GR9A 4UBOA 4Y2VA 3WA6A 5KS2A 2FN3A 1N9ZA 1GQYA 2NV0A 1O4VA 2ZQ5A 1TLTA 1VSUA 2E4WA 4LMRA 5CM8B 3RHTA 1UBTS 4DV1B 5AW8A 1S2OA 1OAOC 1MX9A 1RPTA 2GJ4A 1A8UA 4E1VA 1UF9A 3NS7A 4TV8A 4K87A 1JPUA 3LBYA 4IJWA 1U1EA 1XAHA 2IYNA 1P2SA 2JCBA 4MJ7A 4W7HA 3ZU4A 4X3PA 4CEIB 2XR1A 3BL8A 2JJ1A 1JQBA 4LJ9A 3I2YX 1C4WA 3NM6B 4ZT6A 3VNUA 3KOOA 1HQKA 2R6GA 2RAVA 4L0DA 1L5GB 2QRLA 1LLQA 1DRVA 2A7QA 3KOZA 5FPPA 1XE3A 4LV5B 1Z7GA 4A8TA 1HT1E 1MXHA 3RYIA 4S0XA 4ZVPA 1C8KA 1IY8A 2GD1O 1VC2A 2J87A 2YXNA 3S7TA 3HMQA 4CM4A 5IT9A 2RHCA 4C1BA 2OO5C 2WYHA 1YFZA 4L9SA 3GELA 2WOJA 4G09A 4EHFA 1ZKDA 4FDUA 1M1NA 3QOWA 2VZ0A 3WIUA 4B85A 1C14A 1V2HE 1W25A 1ZH8A 3QFRA 3W06A 1R0KA 1WU8A 4M36A 2JHGA 2EFEB 3SQXA 3I61A 1QP8A 3Q8KA 2TMGA 2R8EA 1AF7A 2PSHA 3BJRA 1FDSA 3ITNA 3W3AA 3VR0A 1DIRA 1DKQA 2BUAA 2G5TA 3FUCA 5FLKA 3GJQA 2DX7A 1NL3A 4HKTA 3D6UA 5DBGA 3PRHA 3Q9UA 4M9UA 4RTNA 3BIWA 4DY4A 1A9QA 4NLLA 2P9FA 4IIGA 1P7CA 1PJCA 3M6MD 3ESDA 1P81A 1H93A 3H6KA 4G36A 3GRPA 5BQ5A 2D1SA 2WU1A 3KJGA 1NT4A 3V1LA 5JVDA 1Y1SA 3H5RA 3TSOA 2XQJA 3TQQA 1LDYA 3JASB 4Q7QA 1U7PA 4QUIA 5FYDA 4F4UA 5LQSA 5D84A 4DC1A 3VZDA 4DBZA 4KUGA 1MFZA 3Q8LA 4UD2A 4BBPA 3VKVA 4QJ3A 4BLRA 4BTEA 2H4XA 1U2SA 2LWIA 4PZCA 1T8UA 4Y18A 3VPCA 2CDAA 5IKOA 3K16A 4QNNA 1AGPA 2P2YA 2HM7A 4O1HA 2CCJA 2CYBA 2OAQ1 2V58A 4BFZA 1A4UA 2Z2KA 4WBNA 4K1XA 2EAUA 2JAHA 5B7GA 1JKFA 1DJNA 3W1VA 3OE4A 1G3IA 1B00A 4YCDA 5DHUA 3RFVA 1YJBA 2I6UA 3M6AA 4CQMA 4E09A 2JFNA 4U2BA 1OCEA 1P9OA 2PA3A 3WWOA 3ZE6A 2IXDA 2MTBA 1GR1A 4XIJA 4EPXA 2PRZA 1WDWB 3M1YA 2NIPA 4X66B 2X6RA 1MT0A 2WFZA 1ONSA 3GY0A 2QL7A 2V74B 3CA8A 3P9CA 2P41A 1NW3A 2GQ0A 3DE7X 2NP7A 1EMDA 3HNPA 4HAIA 2ECPA 5DLPA 4G63A 3FLEA 4BCBA 2GD2A 2MU1A 2ZRNA 1MPXA 2FEAA 4MYHA 4A0RA 2PS1A 3A6GA 3KVOA 1NQXA 3SZMA 2B9EA 2QTWB 3K6SA 1IG3A 2VJQA 1WMSA 5B1YA 1N9KA 5KNCD 2BFMA 2GN0A 5BO5A 4JA2A 2H57A 1ZHFA 1TQ6A 1U7XA 1SXJB 1T25A 3H4TA 1GUZA 1ZM9A 2H6EA 1GPBA 3BE8A 1ND6A 4R3UC 3S5JA 2QZJA 2VJCA 2HZBA 1Q0SA 3PNMA 4IRMA 2JLUA 4E94A 2IHTA 2GEKA 1M1YE 4WADA 4B2IA 3E9CA 1PFVA 1WW2A 1KKLA 4AJEA 1DG9A 4TLMB 1ZESA 2EARA 2YJ3A 4ZC1A 5DRYA 2QMOA 2CVPA 4Q1AA 3SU8A 3V2IA 3RWBA 4ER6A 4D45A 3EUAA 3TAUA 4MR8B 7MDHA 1JPJA 2R4UA 2B1QA 5AJTA 5ICFA 1A0OA 3RSZA 5CEFA 1G6KA 1J1UA 1WR8A 1MRSA 1US8B 1X38A 1X39A 1W1IA 3L9WA 5FBRB 5TIIA 1L7QA 4J4HA 3SQMA 3UWMA 4ES6A 3L7JA 1EDOA 2ALJA 3HV2A 1LPBB 1NBMD 3L4EA 2QPAA 1BCRA 1JX6A 2J45A 3FTCA 2AEMA 4BP3A 2VKQA 1ZCJA 3CNLA 4JB3A 4JLDA 1MJ5A 2IZ5A 2J7PD 4D4IA 2OM6A 4Y9DA 1QZ3A 1K7FB 2AUNA 2ZDHA 4ZODA 2Q07A 3VSBA 2W2NA 3LDUA 1HZZA 4OB7A 4WWHA 2Z5GA 2O2CA 3N9IA 1BYUA 3N7AA 2OFOA 4C2BA 2AYYA 4EHNA 2B5VA 1XRJA 2HA0A 5EIOA 2AWNA 2XA9A 5TGDA 4WOCA 3FCSB 4LWQA 1CW2B 1RHJA 1QG6A 2QQFA 2PYDA 1VYVA 4MYRA 4RKEA 1CRPA 3CNHA 2FOIA 5A4AA 3L9XA 3JQ8A 3O8CA 1AG9A 1Z74A 1B3BA 4FUTA 1G6OA 2FP4B 4J9UE 3U48A 4EA8A 1PR3A 4LZPA 2ZS9A 4PQGA 3VNRA 1M8JA 3DLPX 2AUTA 2CXNA 4G2TA 1ZLYA 4FGZA 1C3OB 1KFEB 3A6EA 4MXDA 1P19A 1DRWA 1U7TA 1M0WA 4Q1EA 1JG3A 4TXJA 2X5JO 3UM9A 3VNBA 1HE8B 3A32A 1F8YA 2AJTA 5K0NA 3SXUA 1L5QA 2ZI3A 1LI5A 2WSBA 5DHTA 4I1IA 5FUXA 3K0FA 2B36A 4KUHA 4KGDA 1E7RA 3ELUA 4AC9A 1XA0A 4O8ZA 1OB5A 2H7YA 2WHQA 5CB4F 1Z45A 1HLGA 2G71A 3PNKA 1NBEA 1V4BA 1LF5A 4URWR 1YAHA 1ADBA 2BEUB 4ARSA 3HDQA 1QRTA 1WPQA 1NLMA 3GG9A 4CNBA 4EWLA 1VHQA 5I7VA 4GZ6A 1X86B 2A5LA 3E9MA 4WH0A 3SIPA 2Q21A 4YV7A 3EPKA 1F2UA 4CG0A 1RHQA 3AHDA 1Y6GA 1N2HA 3R40A 4HDSB 3A7DA 3WGGA 2V0CA 1OREA 3M4JA 1J21A 2I4OA 1DP4A 1QCCA 3B38A 3PDIA 2AJLI 1LRJA 1J20A 1R5OA 1GCIA 2EV9A 2WF8A 3HKDA 4BATA 3CWCA 1W93A 4PSDA 4DPLA 5FA6A 1YHNA 4DLLA 3T3IA 1BDBA 3BIOA 3NUGA 5E3HA 1FX1A 4TMFA 4UDXX 3IJ5A 4KAAA 3C3AA 1PCXA 3RUIA 3TKAA 4Y1RB 1RRPA 1TM7E 3OY2A 5DCLA 4DG9A 1II0A 7REQA 3COJA 4ETIA 3CW2A 3I37X 2IYWA 4YI3A 4LHXA 3IVRA 2XMDA 4B6RA 1M34B 3QVMA 3UJHA 2ZSUA 1BXGA 1X6VA 3TOXA 3WL6A 3WMRA 3N1UA 3U44A 2IX9A 3IE1A 3HYCA 3IXLA 5I7AA 2XH8A 1TDJA 4TLLB 1IB6A 1M1XB 2GKSA 4MW0A 5T3UA 2H1VA 4I1OA 5DNVA 3F74A 4OMDA 3DAPA 1WCIA 3MMXA 2QX8A 3KOXA 5E1DA 3VO2A 2JK0A 3OJXA 1DOHA 1EVZA 2PSFA 3OQJA 3QUSA 1GRVA 1TTPB 4BFCA 3MB8A 4LE0A 4F4HA 2ADMA 4Z3DA 3HDYA 1HSZA 2RJNA 1R7RA 4X8MA 1OWLA 2JLSA 5J4HA 3MT9A 1FYXA 5BOSA 3MG9A 4AZSA 1EM8B 4UTRA 2OAP1 2VF2A 4JVOA 4EB6B 2BMFA 1AZLA 1Z4NA 2X3YA 1SGWA 3JQBC 2APJA 3NW9A 5F7XA 4C0SA 4IF6A 4QXRA 4EOGA 1YZNA 1QJCA 2OXCA 4ICIA 1Z4KA 3EVFA 4Z1OA 1USGA 4S1WA 3M70A 4NPAA 4BMCA 1EEXB 5EOVA 1T9BA 2D0OB 5ED0A 3N8IA 3Q3GE 2XXJA 5JZBA 4W9MC 1MC1A 1KC3A 2C5AA 4AMGA 2F43B 3RRMA 1QNLA 4IJ5A 2ZWAA 3ZKAA 1WVGA 1LXCA 2XYPA 1ZPDA 2OO5A 1PJSA 2PM8A 1PP4A 4KAJA 3WVNA 3GPCA 1W2GA 4I5DA 4LSMA 4BLUA 2E55A 2R48A 5CYGA 2QBYA 1RKXA 1Y9JA 2XGOA 5JMWA 3VKGA 4B7AA 1YZQA 1YB6A 4LGVA 1FF9A 5JMOA 2QMEA 2Y1KA 4E7OA 4HPXB 2IZ6A 2Q9UA 4GBMA 5AIAA 5AK3A 4BNNA 3BMCB 5BV2P 5F3WB 1HORA 4CTMA 4GXRA 4NENA 2I5PO 3HJAA 4RZ3A 1QG4A 1Z9BA 5ISMA 2L18A 1MT3A 2WJ4A 3KQTA 3RGWS 3TCXB 3DEJA 1BX3A 3LUGA 3C48A 1KWGA 3OFNA 1DG1G 1Q0TA 2EBWA 4OGFA 1ISIA 3FZNA 1IPHA 1KK0A 1VL1A 4PLZA 5GONA 4F38A 5LXTF 3TX6A 4YUYA 4N7JA 3N86A 2O7SA 3O4VA 1R88A 3OT4A 4RLHA 2OYRA 1VHLA 4G1EB 5B3JC 1PJAA 2VUTA 1KJNA 3A6JA 3S2YA 4IFTA 4D79A 1FFAA 2ZTVA 4REOA 2PMDA 3ESBA 1LJLA 4LA4A 4C2TA 1KMNA 5DN6D 3QPUA 3KOUA 1W0KD 4HH3C 2IC5A 4EJ6A 5LMZA 1KEEA 1RWQA 2N3ZA 4AY5A 5JSHA 5LLTA 3N8NA 1UXHA 2H0QA 1CBUA 2X6TA 4A8JC 4TTRA 3TDMA 5HK9A 2PSSA 1Y98A 4FBMA 1H6CA 2PVCA 1NX9A 4N39A 5CFZA 3FPEA 4Z1MD 1DAHA 2Y1WA 5FA8A 3UCEA 1IEXA 1XCLA 1KI6B 3JRXA 3UHAA 2QRUA 3KJIA 4CBVA 1DCTA 1GDTA 3LYUA 4R2KA 3OJCA 4MEBA 2XAUA 2AZTA 2GUGA 3EGXA 3IDSA 4GUDA 2IUYA 3QV1A 1A69A 2R62A 4MI1A 5DGTA 4DLXA 3ZIUA 2AC2A 1SG0A 4HZGA 2VTBA 2J3EA 3AX6A 3HFGA 4KMOA 2GO7A 3G88A 1YF3A 3V2HA 1XHEA 2P3SA 5FO0A 1XC7A 1L5LA 1YS4A 1C30B 1DEKA 3S2SA 3I72A 4NCKA 3N76A 1N78A 2WHPB 2P9CA 2GHIA 1GQQA 3HRKA 4C6HA 5B4TA 1VXRA 2GK4A 3BMNB 4IR7A 4W5HA 3VR5A 4RTPA 4BYMA 3AMVA 8ABPA 1OT5A 4BVFA 2GF9A 2EP5A 5DYNA 1IBMB 4CHGA 1U0GA 2JGDB 5GOZA 2R9VA 1GQ2A 3RTDA 4PRZA 4Q82A 4RESA 1TJNA 2HJHA 2L82A 3ZDRA 4OBBA 1PR9A 1NBME 1T2EA 3H1EA 5LKRA 1W5FA 1EZ1A 4G4JA 4D9KA 4DNQA 4RNDB 3DKPA 1LTQA 4H08A 4GLJA 4UU7A 2I2DA 1KHHA 1RPJA 2Y99A 1YBAA 3JWHA 2ICAA 3QG1A 4B71A 4YRKA 5IDQA 1XU4A 3DKVA 3IQWA 4I3GA 4WDQA 2AMJA 1Y9AA 4MYDA 2PQ6A 1RHMA 4DA4A 3AUFA 4Q3CA 1N9GB 3LA8A 4RY0A 3VNAA 4HBGA 4Y9TA 1EUCB 1TEVA 5IHXA