4GIBA

2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
AMIEAFIFDLDGVITDTAYYHYMAWRKLAHKVGIDIDTKFNESLKGISRMESLDRILEFGNKKYSFSEEEKVRMAEEKNNYYVSLIDEITSNDILPGIESLLIDVKSNNIKIGLSSASKNAINVLNHLGISDKFDFIADAGKCKNNKPHPEIFLMSAKGLNVNPQNCIGIEDASAGIDAINSANMFSVGVGNYENLKKANLVVDSTNQLKFEYIQEKYNEYIVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.27 Angstrom Crystal Structure of beta-Phosphoglucomutase (pgmB) from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 83
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4gibA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4gibA01
1Z4PX 4Y3UA 2B1RA 1T9ZA 1U02A 1QQ5A 5ALQA 1XPJA 4EEKA 5AM5A 2WF5A 1LTQA 2QLTA 3NANA 3S6JA 1RDFA 4OHFA 2WM8A 3QU2A 3WKAA 3U7FB 4Y2UA 4L57A 2P27A 2JARA 4Y2TA 2ZBDA 3AR5A 4XOUA 4Y2SA 3UMGA 5AM3A 3WKCA 1Q91A 5AVXA 3W5AA 1L7NA 4NAVA 3FPSA 4QQFA 3TLMA 1RLMA 1RLTA 1ZOLA 2FUCA 4YCMA 2YJ3A 3SKYA 5AK6A 2Q4RA 3QU7A 5AI4A 1Q92A 3GYGA 4BNDB 3J7TA 5AKKA 3PGVA 2JAOA 3U7GA 3WKDA 3MN1A 2OYCA 3QNMA 4JB3A 4AS3A 3FGOA 3UMCA 2OBBA 2DQSA 2R8EA 2NO5A 1S8OA 3QU5A 2EARA 4ZEVA 5ALLA 2GHQA 3L1UA 5ALKA 5AW6A 2B82A 2G80A 3WKBA 5AW5A 4CF3A 3QUQA 3L8HA 4OD0A 3I28A 4QJBA 1ZD5A 3SD7A 1Z88A 3ZTWA 5AW2A 2HF7A 2O2XA 2IOFA 2ODAA 3KZXA 3NALA 3VAYA 1YMQA 4HGRA 2HEGA 3ZX4A 5ALYA 1TJ3A 3EWIA 3ZVMA 3FPBA 1YJ5A 3E8MA 2I7DA 3WK4A 2G09A 1VJRA 1WVIA 4HAIA 3OTQA 3OCVA 1U2TA 2GMWA 4UM5A 1CQZA 3IJ5A 2B30A 2HHLA 2BDUA 4UM7A 4XE5A 3WK6A 2RAVA 2YJ5A 3ZVNA 2YMLA 3B9RA 4AP9A 3QUCA 3SMVA 2WF9A 3L0CA 1F5SA 4YGYA 1Z4NA 4OFZA 3ZTYA 3ET5A 2FPXA 2YJ4A 3KDPA 3PGLA 4KNWA 4UMEA 2HOQA 4C4TA 1ZD2P 2FDRA 3KC2A 3ZU6A 2C8KA 5AW7A 1SWWA 5AK3A 3EPRA 1Y8AA 5AW9A 2I55A 5AKHA 2AUTA 2RARA 3DNPA 1TJ4A 4BX0A 4NFLA 5AW4A 4NV0A 5ALXA 1L7MA 4Y2QA 4CF4A 3PCTA 3SHQA 4FFDA 1TE2A 4DFDA 5AI5A 3KOOA 5ALHA 1XP5A 1T5TA 3W5BA 1Z4KA 3EF0A 3QUBA 5AIAA 2HF2A 2IOHA 5AKGA 1NF2A 2G06A 5IT0A 1EK2A 2ZBEA 2G0AA 3MMZA 3WK7A 5ALTA 5AVYA 1S2OA 1YDFA 3ZWDA 4BEWA 5AM1A 1WZCA 3L7YA 3WK9A 1RKQA 3DV9A 3R4CA 1WPGA 3CZ4A 1Z4LA 4YIKA 1QQ6A 4UMDA 2W4MA 4EZEA 2AH5A 3NASA 1SU4A 4XQ0A 3NRJA 4CF5A 2HX1A 5AM2A 5AW0A 2C88A 3K1ZA 5AVUA 2Q4TA 4HGQA 2CN1A 3N07A 3ZX5A 5AI0A 2MSNA 2JAWA 3RF6A 5AKEA 2WFAA 5ALIA 1SWVA 2P69A 3AR4A 1RRCA 2C4NA 3FM9A 1FEZA 3WKEA 4L6AA 2O9JA 4YCLA 3A1DA 4F72A 5A3RA 4MUMA 3EF1A 1RLOA 2FEAA 1EK1A 3DDHA 1CR6A 2ZOSA 1N8NA 5JJBA 3B8EA 3BA6A 3QXGA 2HO4A 5ALGA 3ZW7A 5AKXA 1J8DA 2FPRA 4UU1A 5AKJA 1QH9A 2G08A 2W11A 4L6CA 1T5SA 4JDPA 2ZBFA 5AKLA 1YNSA 4IG4A 4O8CA 3L0BA 4IFTA 5AW1A 1Z4QA 2ZBGA 5ALEA 5AM4A 5ALPA 3QLEA 4DWOA 5AVTA 2R8YA 5ALNA 2I33A 2PQ0A 4ZEXA 4J2TA 4Y2YA 2EAUA 1Z4JA 1ZD3A 5ALOA 3NUQA 2Q5EA 3UMBA 2FPWA 4YIHA 5ALFA 2ZG6A 4BX2A 3KD3A 1RQLA 3ZVLA 3ET4A 1ZS9A 2YBDA 3NIWA 1RQNA 3I1YA 4J03A 2D2VA 4AS2A 3AR6A 2IYEA 1ZJJA 4EENA 4G9BA 2B0CA 3ESRA 3B9BA 3U7EB 5AI8A 5ALZA 2AMYA 4FYPA 2YFYA 2QYHA 1N9KA 1VFPA 5AM0A 3HYCA 3QYPA 1O03A 1Z4MA 2HDOA 1XVIA 3F9RA 3ZWKA 4Y2JA 2JGAA 4HGOA 4KN8A 4RETA 2OA0A 3U7HB 1RMYA 1YV9A 2CFRA 3A1CA 2ZXEA 3ZI4A 4G63A 5AW3A 3RFUA 4Y2XA 2WF6A 5E0OA 3NAMA 2PR7A 4KX3A 4BYGA 3D6JA 2OM6A 3QU4A 4NABA 3QX7A 3AR8A 1QYIA 2MU2A 1L7OA 4ZEWA 3SLRA 5AW8A 4GXTA 2WF7A 2YY6A 1ZRMA 3HLTA 4Y2PA 5ALDA 1J97A 1WR8A 3CNHA 3L8EA 1RMTA 4I9GA 3WGUA 3ED5A 2EATA 1TA0A 1IWOA 1RKVA 1JUDA 5AVWA 3U13A 2PKEA 3U19A 4BNDA 3AR3A 2YJ6A 2X4DA 1LVHA 2FPUA 1YS9A 4YH1A 2MU1A 1AQ6A 5AKYA 2R8XA 2HSZA 5A3QA 4BEVA 2AGVA 3DAOA 3PDWA 5AESA 2B1QA 2YMMA 3AR9A 3N8GA 3M9LA 4F71A 3MPOA 3QGMA 3U26A 3OCXA 1U7PA 3A3YA 3IRUA 1K1EA 2GFHA 2BDEA 4BKMA 4EELA 3ONNA 1L7PA 3L5KA 4KNVA 4RESA 2FUEA 3SKXA 3ZUPA 3E58A 1NRWA 3WGVA 1X42A 3E84A 4YCNA 4HYTA 1Z5UA 1VJ5A 2HCFA 1Z4IA 2IA5A 4UARA 5AVRA 5ALUA 3I76A 2JAUA 2CFSA 4H1WA 3N1UA 4EX6A 2G1AA 2I54A 3N28A 4UMFA 4BBJA 3UM9A 4DW8A 4BX3A 1MH9A 2NO4A 3WK5A 2C8LA 3WK8A 1RMQA 4KX5A 4UU0A 5ALMA 5AVSA 4C4SA 4UW9A 1ZD4A 4Y2VA 5ALSA 1L6RA 5IS2A 5ALJA 4HGPA 5AVVA 4HGNA 1QQ7A 3R9KA 3I6BA 4UATA 1U7OA 4GIBA 2P11A 2YMQA 4Y2RA 3FVVA 3IB6A 3QUTA 5IT4A 3L8GA 3N5KA 2C9MA 3KBBA 5AK4A 3A1EA 2WHEA 2G07A 4DCCA 3OCZA 2GHTA 3P96A 4UMVA 1L8LA 1NNLA 1O08A 4KYTA 2P9JA 3L1VA 4E88A 3MC1A 2NYVA 5AVQA 4EX7A 3R09A 4UAUA 4MWOA 5AKZA 4B6JA 1U2SA 3QU9A 5AK5A 3ESQA 4NWIA 3OCUA 2BY4A 5AVZA 2W43A 2RBKA 3W5CA 5AICA 2B8EA 2B8JA 1ZRNA 1TJ5A 3E81A 1RKUA 5AI9A 3M1YA 3SF0A 5AKIA 2I6XA 2YMPA 2RB5A 5AHXA 2YN4A 1RPZA 5AIBA 3OCYA 2R8ZA 3FZQA 2FPSA 4PNHA 4XPZA 3AR2A 3OCWA 3L0YA 3L8FA 4CE6A 3AR7A 2CFTA 5FP0A 5T41A 4OCZA 2FI1A 2WF8A 2VKQA 5ALRA 5ALWA 4I9FA 5A3SA 1Z4OA 4UAVA 1RC8A 2IOFK 1Z5GA 2I34A 4FE3A 5ALVA 3BWVA 3OPXA 3W5DA 5AI6A 2HI0A 1PW5A 4C4RA 2GO7A 4UASA 1L8OA 1KYTA 4CNQA
chains in the Genus database with same CATH superfamily
4ALLA 4DTIA 3RRFA 4OIFA 1I0IA 4BFZA 1CZHA 1NAIA 4KFTA 1OT5A 1PZXA 3PX4A 3ETEA 5AUNB 2WF5A 2GDJA 1JG2A 1RABA 3FYUA 3TQFA 3LTNC 4D44A 1L3BA 2ALZA 1NG9A 1UQTA 1I01A 3EVBA 4GX2A 3IIJA 5CX1A 1QRSA 5AJTA 3OEHA 2JAPA 3PUKA 5H68A 3V8BA 2IHKA 2CV0A 3ERCA 1DAHA 4Y2SA 1JBEA 3AL2A 3QXJA 4N12A 1P6QA 3AB3A 3SF8A 4CU2A 3T7JA 1D8LA 2WSMA 1Y37A 2JB9A 3CB2A 1PS8A 1XJQA 3FDIA 3KUXA 4L4XA 2YQ5A 4Q9AA 2XXBA 3BGVA 3PQ4A 1U3TA 1MQ3A 5IILA 5CEJA 3QU7A 2BBOA 2NMVA 1Q92A 4TXMA 3DDZX 1ZN7A 3E5MA 4ZQHA 4WL0A 4NKRA 3VR5A 4M2LA 4EW3A 1QSGA 1ZZEA 2P9TA 4CKBB 2K4HA 1CNFA 1KORA 2EYUA 5KYGA 1TZCA 4A0RA 5IT5A 2Q5OA 2CXUA 3Q2KA 4M22A 1J6UA 4MR8B 3W6NA 4A91A 1JHAA 3U7GA 4U9IS 4WA8A 2OCGA 1QRAA 3MHPA 2PUAA 1KZ4A 1SXJE 2Y6UA 1N8SA 1MT0A 4U8GA 5KIAA 1T5LA 1ESCA 4YD1A 3HVJA 4MO2A 4DSIA 1JMSA 2ILTA 2P1RA 2VOJA 4GGMX 4PLZA 3WR5A 2COKA 3L0SA 2JEYA 2P62A 3ZGVA 4F6LA 3KHSA 5KTYA 3Q3VA 4UBCA 1CUAA 2DU8A 2DQSA 4XJSA 3CP8A 3LVVA 1LJUA 2VXYA 1X9WA 2AE1A 2NO5A 2IIBA 2PNFA 3HACA 2EJTA 4M7RA 4Z9XA 3GF4A 1SBYA 4C4XA 2QRHA 5JQGF 3PO4A 1FJ2A 1ZW6A 3B20A 3ZNNA 3H87A 3LBAA 2VAVA 4ESEA 4QOEA 3RS7A 3G0CA 4OHYA 4OD0A 4W1PA 3CVWA 2REXB 1HY3A 1MO3A 1VE3A 1E2HA 4PGMA 3LPNA 3OHAA 1XZNA 4Q00A 4Z9FA 5FBVB 1LVUA 1E59A 3K4QA 1V85A 2VDJA 4LVNA 5ECWA 1N2ZA 2XO7A 4KN6A 2A5DA 4H15A 3ZH2A 3TLEA 5LZ9A 2I1WA 2BCQA 2BGMA 2X7JA 3LZCA 5CB6A 4Q7QA 3VNVA 4UB6U 4YNBA 3OX3A 3AESA 3RG8A 4TLBA 3BFKA 3H18A 3GIJA 3WC4A 3RSZA 2V7VA 2RFLA 3D43A 5DTRA 2BGTA 2ILVA 2GMWA 2YUIA 1PV4A 4KYVA 3TDNA 3GJYA 1GQFA 1ZHHA 1KO7A 3L6DA 3LHDA 4UM7A 1Q1BA 2ZTVA 1EP3B 3RYHB 2HUNA 4FCTA 4FYIA 4GW3A 2B0JA 4IILA 5EXSA 3TPZA 2GILA 4IMIB 3A32A 2JCSA 3L0CA 4QTUB 3IVRA 1QK5A 4R3NA 2RHWA 4BZWA 1XLTC 4DJEC 4ES6A 5CX4A 4IFBA 2IWRA 4MR9B 4RFSA 2BGGA 1NVUQ 1J9GA 4F8RA 3AP2A 3CNBA 2B5VA 3C85A 3KDPA 3Q0TA 1KQNA 3DSRA 3SC6A 4PZPA 4DLLA 4NMHA 2G1KA 4P3XA 3T41A 2WKPA 5D3ZA 5A3VA 2J9YB 4RU9A 4FKBA 4UEWA 2GH1A 1VJTA 4U2EA 2DHDA 4O2LA 5DF1A 2LYBA 5CB4B 4JXJA 4MW2A 5AW7A 3MGBA 2D6FA 4V1CA 3NEJA 2J6HA 4EG8A 1MD9A 2D1TA 1II9A 1ZHFA 2NSHA 2A9OA 3I4CA 3R20A 1EX1A 1PL7A 3WGIA 4GMFA 5FNVF 4NONA 4R4JA 1V8PA 4CMHA 4RQ3A 4LJ7A 3BXPA 3VSEA 4DWWA 5LMUB 3TVDA 2FW0A 2JGEA 2XWJI 2BFDB 2PVCA 1ANKA 1P60A 3RYCA 2BIFA 2XZLA 2ZJAA 1IEWA 3PCTA 5DZSA 1NOJA 3A4YA 1CR0A 5J0UA 1Y48E 2WYUA 1FLVA 4GEGA 1F5NA 4PBRA 1CHNA 1W93A 4ZAFA 5JMWA 5HNKA 1HRKA 3K9HA 1D07A 1N5MA 4OO3A 4JUCA 2XQFA 1QX3A 1Y3FE 5HQJA 3KJGA 2AOVA 5EQFA 5H02A 2ACEA 1EK2A 4N5LA 3G17A 4HLUA 1NK4A 5HR5A 1ZGGA 4N41A 2F62A 3TANA 4O5AA 2RK4A 4B8ZA 3W8DA 1UZNA 3UQYS 1E9EA 3MMZA 5KTSA 3GD7A 3S8YA 4X5VA 3TH5A 3RLFA 3CV3A 2XNDD 4L0QA 4RGVA 1WKCA 4JOCA 3AI1A 4FKZA 3B6JA 4MLPA 1ILEA 2GBGA 2X9QA 3G89A 4FDMA 1OH7A 4JODA 1WCIA 1Y34E 2CVZA 3AQFA 4JOBA 3NBKA 3G7UA 2X6RA 4EHLA 1GPJA 3IHQB 2W4MA 3ZGNA 4E2FA 4ECQA 2LVBA 3IA2A 4CM8A 2P0EA 1KSGA 3OM8A 1LRJA 3QFFA 4INZA 4MUYA 1TUBB 1XDDA 4QUEA 4URWR 3G13A 1W4RA 2H0AA 2KLBA 2XNDA 4BO4A 3FMPB 1NMEA 4HQNA 3EFOB 2MYPA 4KQEA 4EPWA 2RSLA 2FPIA 1YZ7A 2F44A 3KTQA 1L4FA 2BTQA 2OXCA 3A9RA 3B7GA 3ON5A 1X86B 3OWHA 3R41A 5BQPA 1XV5A 1JQLB 2HA4A 4HLQB 4A0QA 1HQKA 1UT6A 3T6KA 1JQEA 2ZI3A 1YBVA 1FNCA 1L5SA 2BEWB 2J9ZB 2QJOA 5ECYA 2C4NA 3GIKA 4KMSA 1AN0A 9ICSA 4RQNA 1IONA 5JRJA 4XQEA 5HUQA 2HHVA 2GR9A 4IIVA 4MUJA 4L74A 4LYAA 3AQIA 4RY8A 1G20A 2WPNA 4F72A 2XNCA 5DLGA 1NW5A 2GEFA 1JDSA 5J2DA 1LDMA 2QM3A 1KRHA 2PYIA 2EFEB 4BHTA 4TYWA 2MINA 2HZBA 1GZDA 4DFKA 1ZYUA 3I34X 1W6RA 2BD0A 4GR4A 4K0RA 4ZANA 3VPXA 1ENOA 1K7SN 3GWZA 4DZRA 1Q3KA 4EYOA 2RP5A 4ZI7B 1YZNA 1BTOA 3GQBB 3UK7A 2F3NA 1QAQA 2ZYSA 4IDPA 4MV0A 1BRMA 2OXEA 4CRWB 2XVZA 5EWEA 4FOLA 3ILHA 1UC4B 2W6JA 4GICA 4J49A 4OG2A 3GAAA 4KFRA 2QNIA 1EQ2A 1WMSA 2VJPA 4JCCA 4XLLA 3ZXYA 1UXOA 5DX0A 5EIHA 5ES4B 3BDAA 3T15A 1LPBB 4BWGA 1EP2B 2V0CA 4X3CA 4JDPA 1PK8A 1W4AA 3U56A 3DXFA 1EFTA 1G20E 3KXPA 3VPAA 4OL0A 2VPQA 4LGYA 1W47A 2CBXA 5EOZA 3B5IA 3CLSC 1VSUA 2ZBGA 4G09A 4UCXA 4CL8A 5K3OA 5AM4A 2XE8A 3T9EA 1Y6ZA 5CBKA 4ZYWA 3CRW1 4CQMB 1RAAA 4BKPA 1SL0A 1YZYA 1UFKA 2WAXA 1X1AA 2BRUA 2R8YA 2W37A 3UKJA 2I4OA 4DMCA 2HFJA 1MFPA 5UKDA 1SKYB 4DQVA 1P9OA 4AY5A 4MW9A 4CL2A 4B9EA 2EZTA 3FSJX 4OXQA 2V1UA 2EAUA 2WT8A 4H77A 2WKSA 4BYMA 4Z4FA 5A7FA 4RTJA 1P1IA 1CPYA 2GCOB 4H7PA 3HH8A 1XDUA 4I81A 4TTSA 1DU4A 1PJZA 2JIQA 3AM5A 4Q01A 3TRKA 3ZH9B 4JEIA 1MFZA 2ZIWA 1NK9A 1SK8A 2Q5EA 4UOEA 3MFIA 1UJ5A 2Y1LA 3Q6MA 5IVHA 2IPMA 3CH6A 2MMGA 3S8MA 1LKYB 2DM6A 4DLNA 3GG2A 4IMJB 1QGYA 1JEDA 3VKVA 4OKSA 3TM4A 3ET4A 3G02A 3B7WA 3THWB 4FD2A 1GUAA 1CX9B 2LKCA 3BK7A 2QMEA 2QKQA 4NJMA 5KFOA 4AJ2A 4TZ0A 4CMIA 5E3HA 4RE6A 3E48A 3D3JA 4DPLA 2IYEA 3HCPA 1Q0RA 3EIXA 5HHTA 2RH8A 4RPGA 5JCXA 1M2OA 1YJ8A 1FU8A 3B9BA 5B2FA 3A9VA 3BL8A 3CPHA 4QNNA 4CLHA 3HUUA 2JFQA 2WZQA 3ETJA 1WBJB 1ZMTA 2IS2A 3HU2A 1N9KA 1AQLA 1QIDA 3GFQA 4A2WA 2ZIVB 5DSXA 2VSYA 1DX6A 3GHYA 5LUBA 5JTUA 2G83A 2XTJA 2EX1A 1IN1A 1HETA 4W99A 2W0MA 5B12A 2FZKA 2V96A 3SIPA 3ZWKA 4YAJA 4BMNA 4U3JA 3CWQA 2O57A 2JJ2A 4EGQA 1L3IA 3AOGA 3GDHA 1SD2A 2H4XA 1XN1A 1XC7A 3G0OA 1MC4A 3FHJA 1PJ4A 1DAPA 1NQXA 3PKJA 4L0DA 3R9XB 2AOWA 1WL8A 1J2MA 2C58A 4UVIA 1IHOA 2Y0SF 1U9ZA 3RWBA 4NMMA 4OJNA 3NBUA 2G6TA 4LJLA 3TIFA 3WQRA 4C2AA 2NZ2A 1RXCA 3GDGA 4EPXA 4KX3A 1XKLA 2LTAA 1FYDA 4O25A 1QC5A 4UHDA 2HMUA 4HMOA 5G0UA 4DRYA 3U44A 3QKRA 4E5YA 3DOCA 2K8AA 3MINB 3UMJA 1W73A 3AIOA 3TJRA 4EHDA 3WNBA 1IN4A 4EKDA 4IICA 4UCWA 2VH2A 4D4KA 1A9TA 1PR2A 1FFCA 2P2GA 4ND2A 5DI9A 1L1FA 4EM6A 2FEWB 2FLKA 4I4LA 1UPUA 4EY6A 4JYAB 3KK0A 1KC3A 1J5XA 3PQ8A 3QF4B 7MHTA 4LDAA 1FQWA 1X39A 3WLIA 2F3RA 5A2QA 5JQGA 3ZQKA 1Y5NA 2G9NA 2X19A 4J1NA 4ZWNA 4D3ZA 1IG3A 1FBTA 1UM8A 3HCAA 2OYYA 1XHEA 2WUFA 3KFXA 4O2RA 3CUEF 2LRHA 2PMZF 1Z0KA 3OIYA 1DNPA 3ICXA 4AICA 4BJ1A 4AC9A 1HE8B 4Q9KA 5JH7F 2BISA 2IDJA 3F3MA 1KDZA 3RYFA 4FNOA 3MXOA 5LP6F 1C7IA 5CURA 2P4EA 4X1YA 221PA 4RHUA 1RRGA 3SYTA 1V16B 4EVQA 2G1PA 4AP5A 3P9IA 1E92A 3TXXA 1C4WA 3EPIA 2B1QA 3ETRA 3DZIA 1ZQNA 2HHSA 4Q43A 2DWOA 2Q3BA 3D9QX 3N8GA 5EGSA 4YG2A 4YALA 2DH6A 4A5SA 7ICGA 4EG7A 1YASA 3RKSA 3V8MA 1DV2A 4M9LA 1O95A 4GI2A 3RVBA 2C9YA 5IC6A 3QOXA 1YCDA 2F8TA 1KAOA 1S7CA 1LC0A 3CMMA 2PYDA 1GNSA 2G9UA 3MTGA 3BS5B 1WCXA 4MP3A 5C5CA 3EISA 2AG0A 2VYNA 1SXJA 1O5IA 4X5OA 3JX9A 1AB5A 5GQSA 1J2EA 5CD9A 4NE2A 2ID4A 2R8HA 1FUIA 1ESDA 4M9CA 3PY8A 3O2JA 4OI1A 3E84A 1GAQA 2B7LA 3FNQA 5H1YA 5CGQB 3RFAA 2LDBA 5IBRA 4IMRA 2NT4A 5J1SB 4BASA 5KYKA 2M98A 3M70A 1ZJ4A 4IHJB 1T5OA 3E27A 4CT4B 4F4DA 4V38A 1E3DA 4ICIA 4IXNA 1LDYA 2XA2A 2X5KO 4M0FA 3HP4A 1XPUA 5GVSA 2CVQA 2IH4A 4QWEA 2O7SA 1SN7A 1AMNA 1TCAA 2VQSA 3IV7A 4ZQGA 4QUGA 4D4HA 2BN4A 4JKYA 4LRUA 2M32A 3OKAA 3Q6NA 3QVXA 1MABA 4NZZA 1P5JA 2H1CA 4JEUA 2Z2XA 3F3KA 5ILQA 2QRGA 1NXWA 1TIKA 3NGDA 3PW0A 3NYWA 4ZIRA 4BB6A 1CFJA 4CTOA 1B2RA 2P3OA 5E6RA 2XIQA 4NG4A 1YC5A 1JSCA 3SX2A 1KEEB 4YR3A 4G5YA 5GVRA 3W2IA 3INTA 1CUIA 5EMJA 3RKUA 3FOZA 5JJKA 2VYFA 4DJJA 1Q0LA 4M53A 5FQNA 4YRJA 5JJCA 3AM3A 3SS8A 1JBQA 3PA8A 5IS2A 3HE3A 1CUVA 2Q3LA 2YWXA 3O93A 3R7AA 5K6RA 4KR6A 1WUYA 3DCIA 3PXCX 4BVHA 3AF0A 2O2HA 5CHGA 4HGNA 3AU8A 3KX2A 1FVOA 2KPOA 2JH1A 2J3IA 3EEOA 4OLBA 7ICHA 3E9YA 4HAYA 5FTJA 3TAPA 3RUDA 3TLAA 3IEUA 3KT3A 1RM4A 1UEXC 3WIVA 2X14A 2Y9PB 3EG5A 1L5HA 4H7IA 1C5KA 2B3DA 4B2LA 1YTUA 1OAAA 5SY6A 3AHGA 3EOAI 4IQGA 5I7SA 1UXKA 1TQ4A 2CKDA 4CEIA 5EEHA 2JGDA 4Q5IA 2D2XA 3PXXA 5KG3A 4IJVA 2HB6A 4XXHA 2NYVA 4DQIA 1PWEA 5AVQA 1PZMA 3H3XA 1OFUA 3KHLA 1DEHA 1BXGA 1EUCA 2J45A 2P2NA 3NXKA 4HWOA 1PDWA 2AOXA 4HNHA 3H2YA 3SSOA 4C03A 2ZI4A 5KOIA 3BEOA 1MDBA 3G0DA 1AUOA 2QAGB 2X77A 3HI4A 3JSXA 5AKZA 4PS1A 4RMGA 1VL2A 4D4MA 4J0HA 3R75A 2NGRA 1TYEB 3OJFA 4YAWA 5A05A 1E61A 1R0ZA 2WB2A 1WWUA 3PEUA 3DW1X 4QFBA 3UXNA 4BB5A 4PRKA 2OO5C 4P3OA 4UM8B 3WX0A 4NNJA 3TL3A 2WE8A 1VB3A 1LFAA 2I3AA 3HPRA 4CF7A 1N8KA 1PJTA 3ENKA 3PNCA 1CJSA 2Q6VA 5EUCA 2CE2X 5EIBC 1PK3A 5H3LA 1PK9A 3GJ0A 4OJYA 5DEOA 1T9GS 3HC7A 4DV0B 3LPLA 3KVYA 1GU0A 4JQCA 1B6SA 3HWSA 3KB1A 4Z9YA 5G3YA 1K8QA 3D7SA 4PCVA 3FZQA 1ORTA 1ZA2A 4H60A 2PRIA 4HH0A 4RF3A 1W59A 3WGMA 3Q98A 4JI2B 3U49A 3VA7A 3GZ4A 1OILA 1QONA 3ANTA 1RADA 2D0PB 3GFFA 3LXRA 5A2GA 2ZI6A 3KAQA 1SOVA 1ZH8A 1KJ9A 4HZIA 4NBKA 3W7VA 4WZAE 3A3NA 4RFSB 4EY8A 2A84A 3OMWA 3IUNA 4ZARA 5CA0A 4JMLA 5IZCC 4BPRA 2OORC 2WEKA 2DRIA 3LWNA 1DE0A 1NR1A 1USVA 3L8YA 4LK3A 4M8NE 2GBIA 4N1AA 4RSMA 3UOAB 2HJGA 3HCBA 4FE3A 3VYUB 1RD4A 3AJEA 2EFHB 3HGTA 4CM3A 4KTVE 4ZCLA 1EK6A 5MFZA 3BDIA 4Q3BA 3IAM1 2ASLA 3CJRA 4Q4AA 3UHAA 3PSIA 4D9IA 1YRHA 5JMOA 3DGEC 4UASA 2EQBA 2HBQA 1GVNB 5DSTA 1A5ZA 2DUWA 2K89A 1VLLA 2VUHB 4ZJUA 4YQWA 5NULA 1PL0A 3FFAA 3AETA 2LBPA 2QTLA 3VQTA 3A2NA 4OGKA 4LZZA 2WHQA 1GXSA 2APJA 2IPLA 1JLMA 4PTLA 4U6PA 4RL6A 5E8JA 3U9LA 4BEJA 4K03A 4DHEA 2WVGA 1R6TA 3VR5D 4DMMA 4RF4A 1GU7A 2GCIA 3C2LA 1JIXA 2BWJA 4MS1A 2D2EA 1UP4A 3DZHA 1OBFO 2FQ1A 5AM3A 3E9DA 1G3QA 5D5HA 3RIGA 3FOAA 5DVZA 5B7NA 2I3ZA 5I3ZA 3ICWA 4HDKB 2CXQA 3PD7A 3UATA 1L6IA 4JHXA 4EKEA 3KXIA 2YJ3A 4EUFA 5AK6A 4YAIA 4J2OA 3ROFA 5JMTA 1WIWA 1GUBA 2C2KA 4X6XA 5IABA 1ADBA 3MSCA 1P1KA 3TDMA 1M1YA 4I50A 2UYGA 4YAEA 1QH8B 4F6CA 1O0BA 3J7TA 5LM3A 4X20B 1IY8A 3NZEA 3N7UA 2W0SA 4G4IA 5GAJA 4F4FA 3AUTA 1IQUA 2QLBA 3WLKX 3LBFA 2RCNA 1SCUB 1ZETA 1T4CA 1QGOA 1Z45A 3KLMX 1OLUB 1QSSA 2KZMA 1RSZA 4ZCMA 5B7GA 1ATIA 3PV8A 4E4TA 2JIZD 1VA5A 5CK5A 1QDEA 2CHGA 2FZVA 4XTCS 4OO1J 4Q1DA 3SP1A 4CMEA 3V7WA 5FEMA 1FRVA 3R0XA 3ZWMA 4I4NA 3Q8XB 4NBNA 4FUQA 4BLUA 3KU1A 4YASA 4IF6A 1QSLA 1G8FA 3G2KA 4WDQA 3EH1A 4BJHB 3HB1A 1RYSA 3EXIB 3JASB 2X3UA 3BFXA 1IHPA 2AW5A 3HXKA 3L8HA 3QG5A 1R8QA 1ZD5A 1Z88A 3BMQB 3T9AA 3Q87B 4CMJA 3O3OB 3CE9A 4AI6A 3ANYB 1G5PA 1BCRA 1Z68A 5KHLB 3AX6A 4Q4JA 2PO7A 4JENA 3DBHB 5FOUA 2CD9A 4UBOA 4HQFA 4ZZ2A 2L5YA 4QRIA 2ECKA 2AN4A 3AL3A 3R7FA 3DQPA 4CXMA 1BFDA 3BMCA 4GO1A 3VU3A 4A0GA 5KYTA 5EXTA 7YASA 5BSGA 2GNPA 4LY6A 5FPSA 4TTPA 1DCTA 2G71A 3S81A 1D2AA 3R6DA 3F74A 4AWBA 2O2GA 4WD3A 1P5FA 3V3KA 2ZIXB 4JYZA 1TK5A 4PHAA 2H0QA 3QMWA 1B14A 3K31A 3O8QA 1RXUA 2B30A 2N1BA 2R6JA 3JPQA 5LQKA 1DHTA 4OI4A 5ED4A 1RFLA 2IBKA 4MVJG 3QVUA 3ZY6A 4D57A 4QXPA 3PXAA 2N47A 3WIDA 3NTRA 2WF9A 1TK2A 2DMRA 3EYWA 3R23A 4IUDS 3UC9A 3VHRA 4A27A 2C4HA 2ZSIA 2ZE5A 3ET5A 4KEAA 4QTYA 4KG7A 1TRHA 4X8HA 3NYQA 1NZDA 1FTGA 3TO5A 1W94A 4E1AA 4UMEA 4ECUA 2QYSA 4WZ6A 2TMGA 3MABA 9ICRA 5JDCC 5KL8B 1Q57A 3N5CA 2QEQA 4IHJA 1UIRA 3ABSB 3BOSA 3M1IA 4QD3A 1HDGO 4D4GA 2FDRA 1VJ1A 1DTWB 1TCUA 4PN3A 5JYCA 5FLXA 2KIVA 1U3CA 2C8KA 2W03A 5ECDA 5AW9A 2O3JA 2H31A 3E1SA 3M81A 3PMNA 2DHCA 4F60A 4UDOA 4UNRA 1QP0A 9ICEA 3C3WA 2C2GA 4BWFB 3K1RB 2V7WA 4HX5A 4Q4DA 5TS2A 1U2QA 5F9LA 1CS4C 4K9OA 3W4JA 1VHTA 3ANMA 3GN1A 4RVCA 4KLMA 2Z6UA 2XYGA 2FX5A 4BMZA 3ZDRA 3PGJA 3R40A 4RDCA 4YPVA 2O0HA 1JFFA 3K8QA 1YB7A 1GZ4A 2IEZA 1NLYA 3CS3A 1KEUA 2ZXFA 2ETXA 3K5WA 2IU0A 1CQIA 4K9PA 3BRQA 3U81A 4DDTA 1N32B 2V6IA 4DFDA 4FMCF 1WOMA 1KF0A 2D59A 2OPBA 3BMCB 3OPMA 4IV8A 4J43A 4P4GA 3VJRA 1RQ2A 1M66A 1W5SA 3A7DA 1V5GA 3KT0A 5DYWA 4DC1A 4MYRA 4YJ3B 2P8SA 1I24A 3WP0A 3WWYA 1NNI1 3QVTA 3GFRA 2JD0A 2AFIA 3A26A 3HUTA 1SBTA 2EBUA 4G89A 4KVFA 1GZ7A 1XEXB 3QE4A 3CLRD 4NESA 5E9QA 4GMKA 5GV8A 3T7DA 5ESRA 3UF0A 4AT1A 4ETWA 4YV1A 4Z51A 1N2EA 1BVYF 1EEXB 2ODTX 3L1JA 5T3UA 3UOWA 4OI0A 2YY7A 4AKHA 3MR2A 4LZAA 1R00A 3B82A 2ZM5A 3IPRA 1WPGA 1L8XA 2HTEA 4GPIB 1KAGA 2GN1A 1ENPA 2FPGA 3QV1A 4FUTA 2EJBA 4NU5A 3SIRA 4CG2A 2P2LA 1M2GA 1X2EA 4ZVPA 2J87A 1UMBA 1U2PA 1CWUA 3SHWA 2QP4A 4ZRDA 3SZLA 2R1VA 2WICA 2BSQA 2C88A 4LF8B 1CIVA 2NVOA 4INPA 3F6EX 4J9VA 3L9XA 4RPLA 5JJLA 4O4HA 3RLIA 1MR3F 1BX3A 1MX9A 1Z7BA 3GAZA 2KP7A 3OCJA 5TRTA 1GJRA 1N0HA 4Y7DA 5ELMA 3PA6A 2MSNA 1CUZA 2FSSA 2JAWA 2P67A 1KQOA 4OU5A 2F9MA 3FB1A 4CMGA 4PN7A 1YOVA 1ZEJA 1FEZA 2FZ5A 1TAQA 4F46A 3NVZA 4HWGA 4KLRA 4RC9A 4RORA 3HKCA 1D4ZA 2W58A 3GAFA 4QECA 3T7KA 5E6SA 2PD3A 3V97A 4C3OB 4E5VA 4JLUA 2C3PA 5EPOA 3EIQA 1Z28A 3D3WA 1VHJA 3DWGA 5DG7A 1DKPA 3E3OA 4TKMA 4QW9A 3IQIX 4JJ6A 2OFFA 1C0LA 3WYAA 5CDGA 3WRXC 2GF0A 2ZIUB 1OX5A 1RAFA 2XNHA 4QDUA 4RD3A 1AKMA 4FGSA 1RBYA 4ZPXA 4MW4A 5F33A 2P6UA 1NZFA 3COWA 1DRUA 3IEPA 1HL7A 3KTFA 3DE2X 3ZJ5A 5CFMA 2A6PA 1T7PA 3HDHA 3OJLA 5LNK6 1ADGA 3AG6A 3O8DA 4POAA 4Q6BA 2PSDA 1VYTA 1JXQA 2A35A 4IINA 2BF7A 5DHTA 2EGHA 2PFQA 1R8SA 1JIKA 4PSUA 3SHVA 3O38A 1GKKA 4M04A 1XI2A 4TT8A 4BFYA 4F0JA 2FJ6A 1FXSA 3ZW9A 1J70A 3VDNB 4B3XA 3DOOA 2OYSA 1L3CA 1BGVA 3CUWA 3WBJA 4ENTA 4OKNA 4TMVA 4R66A 2WAAA 1Q1QA 2P1ZA 3FN4A 4WLEA 4A8HA 1ZA1A 3BD6A 4J2TA 3PHHA 3KSBC 1U31A 3ZE0B 5KMGB 5GONB 3G5AA 3VPDA 2IP2A 3ZE2B 3MR3A 1JB1A 3W34A 2WFMA 5K4AA 3P9SA 2V7TA 1A04A 3MGVA 4YN3A 5IIOA 2UDPA 5MN5A 5LMZA 2F8MA 4IJ5A 3OZSA 1P9WA 3PX3A 4FFMA 3SQNA 3A10A 1G7RA 4WFQA 2AKEA 3DNMA 1JN3A 4F8JA 4GD3Q 2ZVDA 4YRSA 3BJEA 4M89A 3AFNA 1RC1A 3CH5A 4R7GA 1IY2A 2AV6A 4Z6FA 2V4ZA 4AU1A 1UQUA 4AXBA 1LDBA 4MWGA 3ZCXA 1G5FA 4YACA 2DCMA 5F9NA 4F56A 1IE3A 1PO7A 4RK0A 3C48A 3TG8A 2AUMA 5T8KC 5BOMA 4J91A 2H0RA 3D4IA 4UEKA 5EIWA 3VISA 4KVAA 1J7KA 4YPFA 2PGJA 4BATA 3MWFA 3RADC 1P7VA 3G59A 2FUKA 4IS3A 5LMNB 3KB6A 2DQYA 4N54A 4F93B 2FW7A 2ZUSA 5E1DA 2IEIA 3QYPA 1KPHA 2JBWA 1CQWA 1OV6A 3RB0A 2E1FA 5GV7A 4LCBA 4N7JA 1PQPA 2VJDA 3QQ5A 2ZRPA 3L7AA 3FWPA 1TPYA 3GK3A 1NVFA 2PVPA 1R6AA 4KN8A 3C4VA 1HT1E 4OJOA 2J3HA 4QL3A 5HILA 1RMYA 5IU6A 1RLUA 4RU1A 2PXCA 1C2TA 2RK6A 2JJ1D 3P9NA 4M76B 1DS6A 1NM5C 1R9NA 3I9JA 5HKLA 4O5OA 1SU6A 4BLSA 3SEZA 3E8XA 1J5EB 1LLQA 1O9GA 2JGIA 5EXEA 1J9ZA 2DC1A 1KFJB 3KWFA 2PR7A 2QG6A 5DBIA 1RWNA 4KLGA 3E3AA 4L4YA 5DIZA 4BYGA 2NV0A 1KIMA 1D2RA 2WU3A 3V7UA 3RH4A 4M0AA 3H4DA 1U8TA 4UQPA 3UBMA 1DXQA 3DAYA 4OM8A 4U7TB 3WRWA 2G36A 5SZIA 3CUKA 3H0LB 4YMSA 4AO8A 5C8DA 4JASB 1KEJA 4TVOA 4MKZA 2D1SA 1G7CA 3LIPA 4G4SO 2OWDA 5KQSA 3BGWA 1U80A 4RF5A 1QPGA 3LWDA 2ES4A 1F8UA 4JLWA 3D2NA 5DCWA 5IUNC 1H42A 1Y1RA 3MMXA 2SBTA 4YQFA 5FPKA 2MJLA 2XTNA 4LISA 4MRNA 4ON9A 1D2MA 1X14A 1NKSA 1D2NA 2O5VA 3T54A 2JEGA 1UP6A 4RVFA 2B4KA 5EMLA 1E32A 3W78A 1SKAA 1WU7A 2GZRA 1N63A 1Z8FA 3NIBA 2KB0A 3R7DA 1AKYA 4PPXA 2FPUA 2H1WA 2W71A 4QUIA 4YR0A 2Q7DA 2FX3A 1AQ6A 1BMTA 3I1FA 4ZKEA 3KJHA 1GFSA 4RTKA 2PX3A 1JIJA 1WHSA 2BW0A 5DI3B 1M83A 5C4GB 3VR4H 3C5GA 1NUAA 5F7OA 1YB5A 1YZUA 2WM9B 1IG6A 3BB3A 1T8WA 1DAMA 5EEGA 4TYMA 5KFJA 2GZ3A 2PFOA 1LSSA 2UYYA 4FHCA 5IN4A 1OV4A 1CZNA 3DBLB 4M7PA 4H3KB 4Q1EA 1ZC3A 1IZ9A 5I8WA 2O0LA 2QMQA 3H5OA 1JI3A 2K87A 2HHTA 3DMPA 1JF8A 3AVYA 2ID7A 5E3JA 4AP6A 3K70D 2WRZA 1M0WA 4R2MA 2XH8A 4UD2A 4IX9A 2FPIB 1APBA 1FJHA 5ARCA 1C8BA 3OX4A 5LB2A 4TTJA 3HYNA 3BWBA 4FGJA 5IK2D 2WOOA 3JD3A 2HM7A 4UNQA 4F9FA 5T57A 2EFJA 1MC1A 3TLCA 2Q1WA 3WS7A 2C0QA 4XWTA 1WETA 1EFDN 1RIIA 1RWWA 1EPUA 1H93A 3L6BA 4LYYA 4BIIA 4YR7A 2ISQA 4ZI2A 2Z1NA 1HEIA 4MHSA 3H8SA 3ZLBA 2WSSD 3AWDA 3W2FA 3OLZA 4PLYA 4WDRA 3WLNA 4MI1A 3C41J 3B9QA 4G0NA 4B80A 5J63A 5BW5A 1ODTC 5BVGA 5HE8A 1DDIA 3E70C 4LWQA 2CLMB 1RP1A 4P0PB 4B9SA 1YB4A 1EQAA 2VP3A 3GRFA 4M1ZA 4XUCA 4X45A 2HKIA 3CG0A 3DMGA 1Y5RA 1S3SA 1QWSA 2WIAA 5BNZA 1E79D 2BGKA 2NWQA 1Z29A 3B0XA 1MW9X 2OORA 3GLHB 5C7IO 3BHJA 3TZLA 1RHQA 5F1OA 1R5JA 2CLIB 3JWGA 1D0VA 1CE8B 1RE1A 1JIIA 1VPWA 5LPNA 4GKKB 4P0QA 1S0NA 3OPNA 1PLKA 3FI0A 1A2KC 1WYGA 1Z7GA 4EGSA 4X20A 2Z30A 4MEXA 2XVMA 1DEXA 4HS4A 2P11A 2X7XA 2QWXA 3TD2A 2XZPA 4B9MA 3I2FA 3BREA 3MA0A 2V1XA 4FHDA 4X1OA 2WAYA 2XGPA 2CK3A 2GCGA 4NFYA 4WCFA 4OQZA 1S8FA 2FPOA 3L7OA 5DP1A 4AG6A 4XTRA 821PA 1KMHA 2PN1A 2NZJA 3BWCA 16PKA 1MB9A 5B2ZA 3O75A 5L1MA 1ID1A 4D43A 1QDUA 1ULAA 4XYBA 3TCXB 3C8DA 3OSPA 4ZVUA 4INOA 3RSHA 1Z74A 2R6ZA 4S35A 2DBYA 2XMCA 1YVUA 1DJLA 3C3BA 5EJ6A 3VC3A 3L7DA 2VNJA 4TXNA 5CVDA 4OQYA 2SKEA 1P4HA 3AF4A 2EAMA 4PQEA 3G5TA 9ICUA 3K0SA 2J31A 3C74A 3ELYA 3R0VA 2KIWA 4Z86A 1U9CA 5AQ1A 1G3IA 3KQKA 3JWIA 2ECPA 5FBQB 2OCYC 5LJIA 2MYNA 4Q9HA 1NR7A 4KR9A 5BXYA 2Q0XA 2Y2UA 1A9OA 2B8EA 2B8JA 3ZBPA 4R8KA 1ZNWA 3OIUA 1FSFA 3HQ4O 3LPMA 4P7BA 2QVYX 2VIIA 4JUAA 3CNOA 4A8PA 1J2JA 1Q8KA 4P4PA 3C6YA 3KTOA 3MS4A 5AI9A 1C1XA 1P9LA 4K88A 3WWZA 3SF0A 3EZLA 3B48A 4FX5A 1IEVA 1OYYA 1SCIA 4H35A 3QOYA 3H1GA 4R98A 3P9XA 4WFIA 1UCVA 4GKAA 2PTGA 3SQOA 1Q2XA 4QOSA 2GD6A 5AIBA 2UVWA 3OZIA 3SDBA 4D9FA 3AUOA 1V8FA 2EW8A 1LDNA 1YU6A 1DTSA 4B76A 4MINA 3L0YA 4CN8A 3TCNA 2LYHA 4IHAA 4J9NA 2NXNA 2YYYA 1FDUA 2W2KB 3W8NA 1OB5A 3S2FA 3NOVA 3VI4B 4MPTA 3EEBA 5LQMA 4R54A 2FGKA 1V6AA 4NMWA 1E89A 2G28A 3WYNA 1IBLB 3O4RA 1QIHA 1YMUA 3H8MA 3HKDA 4CLDA 1Z4OA 4RT3A 3OZRA 4ZU3A 4JI3B 2FJPA 2MUTA 1NSYA 2HU5A 2C07A 4KXNA 4CCSA 3AY6A 3TQCA 4QZEA 4D8VA 1NNEA 4PAQA 4N03A 4OUDB 4P4LA 3TGWA 4W9MC 4EBBA 1NMSA 2R65A 1Z1BA 1LBSA 3UV6A 3ZIDA 5GZ1A 1LB2B 1T1IA 3MINA 3TRFA 3LHSA 4O4IF 4ARAA 5LCXA 4MV6A 1Q46A 1XCBA 1JKIA 5B4UA 5KDOA 1XELA 4N49A 1SVIA 2XVTA 1TA9A 2QVGA 4JWTA 4CQLB 4EEKA 3K5PA 3PUYA 5I9NA 1KAEA 3GQVA 3ALRA 3G8YA 4BMCA 1F51E 2WM8A 1RQXA 3SYRA 1MT3A 2OXIA 1EWKA 2V9CA 1HE2A 1N61A 1E5QA 2P27A 3A58B 5AVJA 3RNLA 2NXWA 5JS8A 2PK3A 4OHVA 3PSTA 2ZBDA 4FLMA 1S9DA 3CKYA 1P77A 1GGJA 2AGOA 1RCFA 1FNBA 3RYFB 4B85A 1C1XB 1C0EA 3KOZA 3CPSA 5B3JA 1ISSA 3EXHC 2GN8A 1L4GA 3ZWYA 4L4SA 1ZQSA 1P3Y1 3FTFA 2XT0A 4MB6A 1UDBA 4C87A 4QW8A 4NP6A 5FI0B 1DINA 2G7ZA 4PSKA 5JMPA 9LDTA 3RRNA 5JOQA 4DDKA 1NATA 4E5DA 4YUWA 4KLTA 1FP4A 3O8OA 4EF4A 3NNNA 2DPMA 3ZGLA 1TMKA 1NONA 1Z82A 3WAGA 2IJGX 3QNMA 3UWOA 3HJFA 4TOIA 5TXGA 2PQMA 4LHVA 3CISA 4ZDJA 1TD9A 4M0DA 1FLAA 4CTMA 5ENDA 4LGVA 5DYTA 5HGJA 5I7HA 1DARA 2A9KA 2ZATA 3IMEA 4MKRA 2HHJA 1AK1A 3AOEA 4NMLA 4DLRA 5KFYA 3HX0A 4ER6A 1BIFA 3PDCA 5KZMB 1V1MB 2ALJA 1DCMA 2DKOA 2FPPB 3RIYA 3EQZA 4V03A 5DNAA 4B17A 1FTYA 3WL7A 5EJ5A 2VRNA 4V02A 2P2DA 4CCAA 3I5MA 3PW5A 1BYIA 1M6HA 1Y7LA 1NMYA 1XCOA 2YYSA 1YCFA 4Y98A 5C51B 4QLOA 2C2YA 2QZZA 4HB3A 5K0CA 4R41A 1MGPA 3ZD6A 1F0PA 1ZGHA 2H4YA 3AUYA 1WZNA 4JV1A 3MNFA 3K6SA 6LDHA 1QV7A 3K5IA 4YI5A 2FEKA 2DJIA 3WJAA 4C0JA 3UHPA 5BR4A 1JJFA 5EQJB 5FYDA 3ZX4A 5K0BA 3QV2A 3M3PA 5I7VA 1CDOA 5CFQA 8ICCA 2ZIFA 3N2IA 4Y6RA 3WHIA 4Y8VA 1CLUA 5J2TA 1U0SY 3KJIA 3LL7A 3SY8A 3AF2A 3KDSE 3P2EA 2JFGA 2IYAA 2JXJA 4LHZA 4UHHA 2IH2A 2JFHA 4P0PA 3LGSA 1V2GA 3HGMA 5C3UA 2HHLA 1PUJA 5A4FS 2EZYA 1L1EA 2H52A 2X15A 4Q1CA 3E2PA 4Q3DA 5HGXA 1KY3A 2W22A 2VF5X 1C4KA 2OLKA 4A4DA 3SMVA 2LW7A 1J4AA 2XYRA 3PXBA 4HGZA 4N82A 1NM5A 4ZU6X 4D9GA 5JTTA 5TMBA 4QDOA 5BT8A 2AQKA 2UUAB 1J39A 3GZFA 3LT0A 5EQDA 2R6FA 2YWHA 4KQJA 4RVUA 1OSNA 2OK8A 3FYTA 5E9WA 4I1VA 2VA9A 1OFVA 3HYSA 2OWOA 4MAMA 4GQBA 4D4IA 4Y0AA 1I2AA 3D6UA 1Q7CA 3FBGA 4MCAA 5B3AA 3BX1A 2VJQA 3MG9A 4C4TA 2XMGA 3RABA 1UKYA 2IXTA 3BMQA 1XWLA 1G4AE 4MAAA 2FE4A 2FZWA 4Y9RA 1L1QA 4IDOA 5K99A 4BXOA 5CT5A 1F2DA 3UG7A 3EODA 3WIOA 3NFYA 1SG6A 2Z5GA 4N3BA 4DDVA 3EZFA 4ZO8A 4AUEA 1WPQA 1VB5A 1DIRA 1JKXA 1H6CA 1WF6A 2BFEB 4MQFA 1C7YA 4NZOA 5LXTA 3L3FX 2FJUA 3BD9A 5IH7A 2FGJA 3GFPA 2L18A 2IC5A 2GBPA 5FLEX 2J6BA 3LX6A 3EK2A 2IPAB 9GPBA 1UFRA 1ZQRA 3TOCA 1MVLA 5EWMB 2Q29A 1Q3VA 3I9OA 3QZ7A 1A9YA 4UAJA 3EVGA 5KVSA 1NULA 1CP2A 4Y6SA 2QVBA 2ID9A 1RAIA 4RDIA 1NZPA 2XW6A 3T7AA 4DXAA 5A1JA 5LVAA 2ZRIA 1PD1A 5JLJA 5L8VA 1CP3A 1YIAA 3UWMA 4Z54A 5CFZA 3CIFA 3GILA 1T5TA 4GGPA 4D8TA 1K8XB 2BFWA 2RONA 3QUBA 3GH1A 2B9VA 4NYMQ 4DQ0A 1SKWA 5HOQA 1MORA 4YP7A 5KT4A 4I55A 4KAFA 1GDHA 3RFCA 4EG4A 3RAPR 4JT4A 1A6SA 1XRMA 3NHJA 4RTSA 1AOXA 2ZIAA 2V6MA 3L40A 1ADCA 2V59A 3EMBA 2ORED 2HSWA 3HP7A 4G1FA 3U3DA 1T25A 2QNRA 2QRVB 4NCNA 1XSPA 2DFVA 3F0TA 3HNRA 2XRZA 1L5YA 4XKJA 1C9YA 5U9CA 3HBLA 4NK5A 4BLTA 1BWPA 1HFWA 2A1UA 2PTHA 3NRJA 4I7EA 1FLDA 2OGTA 3CVVA 1T13A 2DR0A 4PLFA 2X86A 1DWPA 1SKRA 3CG4A 4H7JA 5AH0A 4ZA2A 2JZOA 4XWKA 1CQJB 1L4EA 4B74A 2FPGB 4G23A 4PHCA 4QUKA 4ZAZA 1QUEA 3JQBC 3A0HU 1JFFB 5KWIA 3X1XA 4LJAA 4RHTA 1HEYA 3GY0A 5F77A 3LCMA 2ZDQA 4BQFA 4EW1A 2WFAA 3CX4A 3UYKA 5HUJA 2AXNA 5JISA 1OC2A 5G4LA 4LOJA 4GPZA 4IDHA 2BHSA 4XGNA 1N5LA 2C3MA 2VJ5A 4F1WA 2YVLA 2FRVA 1VA4A 3A1DA 3PI7A 2EAPA 1BVRA 4WK0B 1SURA 3TAHA 1PVVA 1JHXA 1LXCA 2I4TA 3M9XA 5EINA 4H7KA 2QSUA 3D3QA 1KRXA 4KXQA 2WY2D 4OYHA 4RIHA 3V4SA 3VVLA 3TW4A 3B1WA 2FMIA 5IKEA 3QY9A 5ALGA 1JVBA 2JIPA 2ZZNA 5TF0A 2HBMA 1Z5OA 2GZ1A 4RHFA 1I7QB 2YCLA 5ADVA 4RSGA 2ET6A 2J1LA 4D46A 3EUB2 4B9UA 2EJCA 4G4SP 2YTZA 1EFVA 2KJ9A 5DNWA 4JI0B 3RFVA 4F11A 5HBGA 1MF7A 1XFDA 2AQHA 1YDMA 4JC5A 5H3HA 4RTLA 1DBQA 1QH8A 3HDGA 4FZ3A 2RK3A 2PNJA 4DQKA 1GL9B 3HEAA 2Q3MA 4TROA 3PR4A 4UEQA 1Y3DE 3D1JA 1OLXB 3OSZA 3EASA 2K2QB 3NWJA 4IFTA 3RHZA 3CR8A 2J0VA 3M5CA 3EC7A 3U3JA 5D3KA 2WV9A 5EHZA 3FIJA 2WQ6A 2KBFA 2ZR8A 1UK7A 1NJYA 2VDUE 1UMKA 4TSFD 4N0MA 3EZ5A 4QZCA 2NTEA 5HE9A 5J5VA 4EJMA 1E3JA 1EFHA 2Z5LA 4UHKA 4I2FA 2NVUA 4WOKA 4YBZA 5J9FA 4CTNA 3E4DA 2FHPA 2YFKA 3H17A 4C8NA 1VCHA 4FILA 4C8KA 2R48A 2ZR0A 4O02B 4QZFA 5AP9A 1ZD3A 2RD2A 5ALOA 1SPBS 4JWNA 1P61B 3T0GA 2WYIA 1MX1A 1O1YA 1WXGA 2HCTA 1D2CA 1EUCB 1OE0A 4XRHA 1JAHA 2OO7A 3F78A 4JJ8A 1UA0A 4Y1GA 4ZV4A 5J2EA 1FUKA 3S2YA 3THOA 4YT8A 4DLXA 5LMCA 4J75A 5DSZA 1M0SA 4GQAA 3ZYCA 5F76A 1YJCA 1OZFA 2WB1C 3D1VA 3BZKA 3FKQA 1F4PA 3RIXA 3T3DA 3ZW8A 3U7QB 5EJ2A 2RJNA 1M6EX 3IMCA 1Z8HA 3LF1A 2DTEA 3FMIA 1AO0A 2BR4A 3UCFA 2DWPA 3KXKA 1IOVA 1TC1A 4G9BA 2EEZA 1ULHA 3TSWA 5C4MA 1M73E 3VKFA 2P7IA 2AMYA 3MTEA 3IAFA 4WBNB 4O4LF 5BRNA 3DOJA 5E7QA 1VKHA 2LHTA 1XF9A 3P26A 1W44A 2XVAA 3GEPA 1N25A 2VYVA 4RY2A 2CZCA 1J22A 4NU8X 1PWXA 5K3SA 4Z2AA 3IQFA 1B0XA 3AIMA 1A8SA 1OD6A 2AEFA 2ZRAA 1QK3A 3MUFA 1S97A 4RVHA 4Y6PA 2ZWVA 3DLHA 2W6PA 1ORRA 5HFJA 4U2BA 3VI3B 5JRDS 1K6EA 5KNLA 3U7HB 4Y0VA 3RQIA 4US1R 3K20A 1BFKA 3L01A 4B35A 1U7XA 1CCWA 1RYNA 2B4TO 3H2GA 1C1YA 4EJSB 7ADHA 5DM70 1GNVA 4P2GA 3CW8X 4ED7A 2G5IB 4DFJA 3RFUA 1K6MA 4KGVA 1XYVA 3TF5A 1YHZA 1NX6A 1RQ7A 3EXG2 2X40A 3KOMA 3UHFA 3EPLA 4XWWA 4NPHA 1AKRA 2HHAA 2QKYA 2C5BA 3D6JA 2NLOA 3QNWA 4D8XA 3T7TA 2FAXA 1VP9A 3ESZA 3ZE8A 1QU2A 1ZI8A 1ECLA 2E8MA 4K40A 1IN7A 5J0YA 1JDNA 1XAJA 1CF2O 1V41E 5DISB 2AWOA 3OIGA 4GXTA 1NDQA 5JEEA 4L0CA 3THYB 5FPHA 1U0TA 4KLIA 4B4OA 3JYNA 2NV6A 5FI5A 3LUBA 4EPRA 5CDFE 4L8LA 1EG2A 2POQX 1BWSA 4RVOA 9ICIA 3CSSA 2XCQA 1Q14A 4TSFA 1H0HA 2KYRA 2HJSA 1TA0A 4H0NA 3C45A 2H3QA 2BFEA 1GG5A 3TRHA 2SCUB 6AT1A 2ONZA 6Q21A 3HJGA 3DP9A 1EEHA 4JITA 1I4TD 1P9NA 4X41A 3W3AD 4YRCA 3GBPA 2PSHA 1RIFA 2QZ9A 3OOWA 4EB3A 2I71A 1XQWA 4DV6B 5ICMA 1DAFA 5CA7A 4Q4LA 4M1EA 4KJXA 3P0JA 1A9RA 1U3WA 1XK7A 2CK3D 1TPZA 2QENA 2XX3A 1OZHA 3MRTA 1VL5A 2SNIE 3GA0A 1ZNXA 3DEFA 2GERA 4RHXA 1G38A 3EC1A 2A5YB 5DM0A 4WWHA 2GBFA 5JDCA 1E1NA 2VN8A 1Q11A 4Y67A 1U9IC 4F8YA 2OQ2A 4F3NA 2X8JB 2E1PA 1IOZA 1F0YA 2YHBA 4RPYA 2J4FA 1T1EA 3TQIA 3V32A 3M4NA 2QRMA 3X1DA 5KOJB 2WFLB 3F5DA 1I5RA 3PC6A 4QQRA 1Y1KE 3ONEA 5T8KA 3GR6A 4QXRA 1CEEA 1P4SA 1BPZA 5HIJA 2VBGA 4KOEC 3RJTA 2DULA 1XJ0A 4MA0A 2PKYX 1UOOA 3AY0A 1G60A 2WJ3A 3DNFA 1GL3A 3K0CA 4PTZA 4R40A 4RTRA 4O5CA 5CAEA 3DE7X 1CS0A 4A6DA 4U8HA 3RBXA 1VJ5A 5FDFA 2A7QA 3FR7A 2CMHA 5AHKA 4HRAA 3WZMA 1N2GA 1KDPA 5DBAA 1C2YA 3HNPA 1L6NA 2BEKA 4N7RA 1HWYA 4FDUA 2H1IA 1ZQXA 4UMFA 3PJFA 5IAAA 1NJ5A 1IOLA 1DAOA 2BELA 4F97A 3VR2A 3O83A 1M5TA 1W35A 1KETA 4PPGA 3V2GA 3W7BA 4IPTA 4C43A 1KK2A 1AO3A 5C7YA 3AFIA 3H8WA 3PL1A 4P80A 1MH9A 4U9HS 4C80A 3FIUA 4HNAA 1T8SA 1R4MB 1XDGA 2I2WA 5G41A 5I01A 1ST2A 1QTNA 1M2VA 4KLOA 1S9HA 3HBFA 2XHEA 1RMQA 3WK8A 4KX5A 1KMMA 4IDCA 1B8PA 3KV1A 4XASA 3JQAB 4XYMA 2OHVA 1G8AA 2J7PA 2VA2A 3FFWA 4MIOA 4HDSB 4PO1A 5EJEA 4X64B 3EGDB 1CYEA 4GWKA 4LSMA 2H07A 3PFBA 4BGDA 7ICVA 2OKCA 3C70A 4O59O 3WL4A 4MR8A 2O07A 4HL6A 4EARA 3WYCA 3R9KA 2RHMA 5I3CA 2BUAA 5CIYA 3N7RC 2BLLA 3PF9A 4TXJA 1PX0A 2AOTB 1GPUA 5C8VA 2CNBA 4NLNA 4LDQA 5IYZF 5A4IS 2QD1A 5HKOA 1VGRA 1W76A 4IZHA 2QMOA 2W98A 4C6HA 2WHEA 2G07A 2OVFA 4Y1EA 3VOTA 2X23A 2GHTA 1FUYB 4D7AA 2O5EA 2GKSA 2JD2A 4WVLA 2G63A 1R8XA 8ICXA 3BM5A 3ESCA 3L1VA 1RZVA 3V6LA 4II7A 3DOIA 1RWOA 2EKPA 3PDHA 2C0CA 1PE0A 3MB8A 1XRQA 3SLKA 4OBEA 4OXYA 3W1WA 3DGFC 1TUBA 2IHVA 3CYMA 3OX1A 2JIOA 1EGQA 1FSZA 3IOEA 4V0ME 5CJ7A 1UFOA 5CLGA 1GKYA 3HDQA 3KOUA 2X1HA 3N75A 3EXHB 1XEAA 4HDMA 4HFRA 2MAXA 3DMTA 2P8JA 4LC9A 4RGBA 3V6MA 4E3ZA 1XWWA 3IIKA 3IQGX 4X7BA 5D5QA 4E11A 4NWIA 4Q3CA 2BPGA 2JJ1A 2E4UA 3HYTA 2IXGA 3G0BA 5EJIA 3VGPA 2A9JA 3B1FA 1P1JA 4A92A 1WZ2A 1R0RE 2I4IA 4L4UA 2YXPX 3ZVRA 4R2KA 2XIJA 4B84A 2AJQA 3IHLA 4E22A 4KHZA 2VT7A 1CE8A 3EEFA 4QX6A 3O4IA 3ROXA 3DBIA 4BLRA 4ZTBA 4EVIA 4F9GA 1RKUA 5K3FB 4ZYVA 1FDRA 2W42A 4MZDA 4C7YA 2JGKA 5KOYA 1MRSA 4UUNA 4IQTA 1MQ9A 4I2CA 4MV7A 5E7JA 3T5AA 1E9BA 4N65A 2FN3A 3AUXA 1YK0A 2ZSUA 4LCJA 2G3YA 2NSYA 3KSZO 3C5VA 4ND8B 4LDPA 4AX4A 1O4WA 2ASDA 3FTQA 2ATVA 4I1SA 4ZXPA 1NZJA 3HVKA 2X58A 2XOXA 3FKSD 1ODFA 3GQBA 1M5RA 3HXTA 3IMFA 4IWNA 3EIUA 3T0IA 2BKLA 3HG7A 2EF1A 5DG9A 5AXCA 1O97D 1K0UA 1FMJA 3GLKA 5EPUA 3DTNA 3I61A 2W6OA 3DMYA 4UAVA 4UBLA 4C0WA 4DVGA 5IX8A 4OV6B 2CXPA 1FP2A 4AURA 1BFUA 2P9CA 5DHPA 4HEA1 4DLBA 4JLVA 1KOFA 2C7VA 4S1PA 4Z49A 1FNSA 4K81B 2IYVA 2V9PA 3TPCA 3OAAA 5AI6A 2W9CB 3AXTA 4J1SA 4X00A 2H16A 3KKAC 4GI7A 2B2CA 1OX4B 3LKVA 4N76A 3MCUA 2YN2A 2QVLA 4AZTA 1SCAA 3SAGA 1QKIA 1GNTA 4AJHA 4LY9A 4DS4A 2PUVA 3DL4A 4MPJA 1U02A 4E33A 5FEUA 4BQPA 4ZJYA 1B41A 4AJLA 4IGEA 1R64A 5JALA 3EAGA 3TPFA 4M9HA 3WYFA 1IXRA 1YB6A 2I67A 1TVKB 3UO8B 4AZ3B 5A5FA 4XD2A 2P5TB 2HHWA 5KTOA 4O63O 3IVMA 4GM1A 4JA0A 1E0JA 4BP9A 3PFWO 2D8CA 4E21A 3OPQA 5CT9A 4DSZA 5B3JC 5DM2A 5KFLA 1EM8B 1YZQA 4KWEA 4CFZA 3UQ2A 3RBAA 3PFFA 1CUSA 2I66A 5CLHA 4BQQA 4NX2A 4Z1MA 3GRPA 4EZBA 4B4WA 4LPKA 3CPEA 3VAAA 4B9AA 4I55B 4YRIA 4E5UA 2AFRA 1QRUA 1VL1A 4XJTA 3ZHSA 4M0EA 4YXFA 4JY7A 1LLDA 3UA4A 4GDMA 3BCUA 3KKKA 4YJ2A 4N8SA 3WGTA 1V5EA 2XR1A 3DW3X 3OQBA 1XU4A 1HBJA 2QAGC 4GYKA 3F6PA 5TARA 2VUSA 2FCRA 3H97A 1E1QA 4KU4A 4KPUB 4MW7A 2X8LA 2X5JO 4RWZA 4ALJA 3QLJA 4KPYA 2Q6OA 1S0OA 3D2AA 3FKJA 4ABYA 3KJFA 2IXFA 5I7WA 2VP4A 1PEDA 4JB3A 4CCWA 2R5FA 3LPCA 4AYXA 4MUHA 3AEQB 3CSUA 1G8YA 3FTEA 2OBBA 2Y67A 1QJ4A 2BUBA 4UVHA 1P5HA 1Q1GA 2PANA 5DU2A 1O5TA 2JI8A 3COYA 5F7JA 2JGDB 2OHHA 1S8OA 2PKXA 3AB8A 4HXYA 5KFAA 1IMOA 1M5UA 2X8JA 5BVHA 4DEZA 1RYDA 1HH4A 5ALLA 2E5LB 2IYTA 3TTXA 1WDKA 4LVOA 1U0EA 3T9DA 4B83A 4BMXA 4K9NA 4V2UA 3U80A 3IMGA 1Z15A 4MUEA 3EMDA 4BO7A 2VHYA 5F7XA 1U3FA 2CJWB 2JKVA 1I9CA 1XZIA 3UC5A 4N01A 1MO4A 1KY4A 1D1PA 1U1DA 2EKBA 2PEYA 3OU7A 4WW0A 1V3UA 3FF4A 2ODAA 3TD6A 4US0R 3CN9A 1SQ5A 2JFUA 1Z08A 2PX8A 2YYZA 4LYDA 4NAUA 3G2MA 4RJ2A 4KQFA 4BO0A 2P4SA 5CVVA 1B22A 3DFFA 2A19A 2JIBA 4NH0A 2XUPA 4DE5A 4XYLA 5FAKA 5JBNA 2QPAA 1Q83A 2BKAA 2J08A 1BD3A 3UAXA 2PPVA 2XVYA 1IC6A 1Y89A 4FXOA 1PNVA 3VOAA 1S2LA 5C2JB 2Q1YA 2D0DA 3BXZA 1VKNA 4O2AF 5CA1F 2QYTA 1W19A 3FMFA 3WI7A 2ZE8A 1Y3CE 1YKSA 4UAZA 3IBYA 3ZBTA 4DQLA 4F04A 4JOQA 4UM5A 2QN7A 4E4RA 1WSBA 4F3TA 4MQLA 2VOEA 3V34A 2N0SA 5ICGA 2M9NA 4UFOA 3UANA 5FWDA 4BFUA 3QTLA 3MWDB 2QTVB 1DK2A 1QM5A 1G6OA 2W7PA 1SKBA 3PNQA 4HO1X 4RA9B 3TMYA 3GT4A 2OD9A 4PIMA 1ZRSA 3ORFA 1V8OA 4MDEA 1W4BA 3GCGA 1EA7A 3DDOA 4X6UA 1IXYA 1IAVA 3NIGB 1K5GA 3PFCA 2Q1SA 1ZD9A 2D4HA 4QICA 4BFCA 5LWQA 1N36B 1FYXA 4M0MA 1XVLA 3JQ6A 5ICSA 2BPFA 4O6VA 4ED8A 4H6XA 2HWWA 1KO1A 1K5DA 1KNXA 1NY6A 2G25A 2OUIA 1JXLA 1SCQA 1G3RA 3FTPA 3N39C 3SZUA 4DCNA 2R96A 3LW8A 2BJHA 2XQGA 3TTWA 3AERB 1FTQA 1VLJA 2HMAA 3QFTA 2Q2NA 2ZS7A 3VTKA 3QKUA 1VHWA 1YBHA 1T10A 4O3OA 4R1QA 2G76A 4IRMA 2ATEA 3SKVA 4OI2A 3J81k 4X7MA 3CHYA 4Z4HA 1EVYA 1JIUA 1YCGA 3GIMA 2A1TS 2I9KA 3FLMA 1U4OA 4TWAA 4QOFA 1HYHA 4X0EA 4MHOA 1JTEA 1VGQA 1M2OB 4LXQA 2WM2A 5BSMA 2F43B 5K9ZA 3FNEA 2VWQA 3JS5A 4CCHA 1GQRA 2AR9A 2PBFA 3B7PA 3FCSB 2EKQA 3EF0A 1W8DA 4KO3S 3JVUA 2XCPA 3ENVA 1RXSA 4HVCA 1JPJA 3DTYA 3KO8A 1XD9A 3S68A 2RC5A 2HR1A 1TZ2A 2AC7A 1SV0C 2GEKA 1PVDA 1XTIA 2DBQA 1P74A 2F1JA 1Z2CA 1XG5A 5ALTA 3OT1A 1N6PA 5AM1A 2IKQA 1Z19A 3HLYA 4DEXA 1IJFA 3ACBA 3E3NA 3FSGA 1SOWA 3CZ4A 3I9V1 5EIBD 2CHEA 2O6HA 4FHEA 4F5QA 1K6JA 1Q7RA 2ZB7A 4R1SA 4EUKA 4QGBA 1F6BA 3FWNA 1CYDA 4OH1A 1SCUA 5FORA 1H4QA 2PMEA 4HFJA 1KJWA 3JW8A 4Z4GA 5WRFA 1GPWB 4EDHA 3IC5A 3OE4A 1DFHA 2CFIA 3UB4A 3VZPA 1QC5B 2VO1A 5DTQA 4TTQA 3PEEA 4DLWA 2I6FA 2W4QA 4YRMA 1P4RA 2XOEA 1AIPA 1G6KA 3KJXA 1C30A 3NG1A 2QLNA 3B2QA 3AJ9A 4ER7A 1ZQLA 4XJXA 2VLIA 3W9SA 3DQZA 1U81A 3UT0A 1E7WA 3IPCA 1RTKA 1Y4ZA 2M1XA 4PC6A 3OJSA 4PO3X 2AG5A 2NOAA 2JCVA 3KHKA 4ZK6A 1TOAA 4RLQA 2R1TB 2WZBA 3DCNA 1DIOB 1U0JA 1B0PA 2ATLA 3DE5X 5LYYA 3TE7A 3T3GA 1EGAA 1KFDA 2K8CB 4YROA 1KYQA 3W5SA 5D8DA 3ZEAA 1WW3A 4RHEA 1MB4A 1WO8A 1DKRA 4P4TA 2MHCA 2RHDA 1GGEA 5I7RA 2YWRA 3WMGA 3CLRC 3L3BA 4LDRA 1AS2A 1GNRA 3O0TA 4MRSA 3MBIA 5T3YA 3RE1A 5MGBA 5AKXA 2WFZA 3F6BX 1M1YE 1YR1A 1WPXA 2Q5LA 1CY8A 2FN7A 1Z34A 4WNAA 3T61A 4KXUA 5IXYA 2W11A 3A7EA 1WV1A 4RQ4A 3O8QB 2A14A 1Y98A 3PV0A 1E7RA 1MQ8B 3E5NA 1FXUA 4GGOA 5GIOE 1WMFA 5E4YA 3KPJA 5AKLA 1YNSA 4TSRA 4UBJA 1WMEA 1FP4B 3M4XA 3O8OB 4JP8A 4CLOB 1GG2A 1LLFA 4CR6A 5ALEA 2LUOA 3RAQA 1E1QD 5ALPA 1LC3A 3HXLA 1NXVA 5I7AA 5KDLA 4DT1A 1A4RA 4YMVA 4GOMD 5B37A 4I8XA 5DLDA 2A5FA 4XGRA 5CXUA 1JBKA 1FYVA 1G5QA 4PVDA 4WKOA 3RTCA 4CG3A 4F6RB 5FX2A 2D8AA 3Q7IA 3I72A 2QM8A 3ZD8A 2N46A 3ZG6A 4ZOLF 2M6LA 1CW2B 4OP2A 2F1KA 2IY9A 2V65A 3HZOA 5DB9A 1FDTA 1Q0QA 4DF4A 1XTPA 2BFBA 2I9PA 3GV0A 3CR3C 4J94A 5JWRA 1FFYA 4F5WA 3VKGA 2YVKA 4Z6CA 4JT2A 2BL4A 2E2WA 3E22B 2NU6B 1GPH1 2AR0A 4OM7A 5E38A 4ARIA 4MRMA 2C57A 4ASUA 2YZ7A 4ZDKA 3A0RB 5F1YA 3HRDD 3GEIA 4RZ3A 4WAUA 8ICHA 3NIWA 3UW3A 4PZ9A 3ICOA 3HCCA 4F5OA 3FUCA 4BE7B 3PWZA 2QW0X 4KW7A 3SAJA 4RNOA 1J8VA 4S0ZA 2WK1A 3BIOA 2GTIA 1NTRA 3GRAA 3LFUA 4P4SB 1GG9A 3KKPA 4U7PB 4ZMRA 2I6GA 1C8LA 2JIZA 5AI8A 4JK3A 2XD4A 3V8VA 1EDBA 5BPFA 5CVTA 5I5EA 2FWBA 4LZWA 3ORHA 1ZCAA 1PFWA 1ODKA 3OEYA 1NJZA 1AXEA 4JV2A 4BB9A 2DQKA 4G5XA 3CM0A 3SIXA 4Z1OA 3L5OA 5FPQA 1XEXA 4H7HA 1LWNA 3PJRA 1W5AA 3LXUX 5DTIA 4DN6A 1SMKA 4RVNA 1K75A 3RC7A 1KRPA 2TYSB 3LUJA 1X70A 4LRQA 2Q8NA 3AHEA 1Z6XA 2P41A 1A9SA 1MOZA 1QHSA 2XDAA 1VI6A 4G8BA 5ERXA 2W9XA 2GN9A 5LOVF 3C43A 2XE6A 2OXOA 2VPTA 2YKGA 1PVPA 2AJLI 4PQGA 2O6LA 3VYRB 1I30A 1PJCA 3CTMA 1WU8A 4YJ2F 1SFRA 1K89A 1BEEA 1IJEA 1NVVQ 2I87A 2V7GA 3K0EA 4NU0A 5CFOA 1V8ZA 2W6ID 1TL7C 3GRZA 3HJRA 1BA3A 3M3DA 5B4TA 4TUYA 3QWAA 2HA3A 2BFFB 3L6OO 4IQUA 1Q7BA 2VWPA 5KKAA 4GF5A 4K6MA 4GLOA 3HBAA 5EWJB 2YIVX 1X9XA 5L4NA 1ZRMA 5KG6A 4I2DA 1S1CA 1QFJA 1Y3IA 1FFXA 1JVSA 1V3TA 2CHUA 3OZUA 4CKEA 2ZS8A 3AI2A 3D4BA 2QTZA 5HJ7A 4NBVA 5EAIA 3V4PB 3UXMA 1RRMA 3VVBA 2UZ0A 3MM4A 4OQFA 4OJMX 5IDQA 5HZGA 4HB2A 4NLLA 3GRRA 5JH7A 1U7TA 1U11A 3HR8A 4MA4A 2EV9A 1N7HA 3ST7A 3IVXA 1R4AA 2XEDA 1ZBQA 2PX0A 2OT3B 2Q4BA 3LQYA 2GFQA 1ZKDA 1Y7TA 3BERA 5AOBA 3RAFC 3SI8A 4KRXA 4Y7CA 2MU1A 2PAAA 2ZB8A 3SZRA 5B4VA 1U4NA 4IJWA 4MS3B 5BMOA 4RA9A 2NYRA 2VYVD 2QV7A 2A8YA 2ZJFA 3DHYA 4LOLA 2ZIZA 1TM5E 4XDYA 3MTIA 3H11B 3R8FA 3KLPX 1GL7A 1GZHB 2FETA 2V98A 2HV9A 2GF2A 3GYBA 3LK6A 5LU8A 1H2EA 4ARUA 2B34A 4DYDA 3TQ1A 5K09A 2ODBA 1EDOA 1U90A 3U26A 2RGCA 1L5GB 1BRTA 2CL6X 3IP4B 1W29A 1W25A 2V6BA 2WJHA 3LHIA 3VOSA 4CM4B 6REQA 3L43A 1IBKB 2J9FB 8ICVA 1XQ6A 3TLKA 4QWWA 4LXYA 1Y42X 3V9PA 1W0CA 3PFNA 4I27A 3TAQA 4RHCA 1NN0A 1GL6A 4NH4A 5M5BA 1GKIA 1PGJA 3T12A 2ZUFA 2G8NA 3E58A 1LCIA 3NVMB 2KHVA 3WL8A 4P22A 4MQ6A 2IMWP 4HK4A 4FEGA 1NLMA 4R83A 1A88A 1Q1AA 5CXQA 5EUMA 1NBAA 4RQ5A 2WINI 3OWXA 5GJVC 4K0KB 4GBJA 5D6OA 2Q2OA 1OIXA 2VAMA 1IXRC 1D6SA 1E6MA 2SCUA 1G8KA 3N0RA 1QWOA 1Y6RA 1L7QA 2C96A 2C94A 2EBWA 4C78A 5K8UA 1RWQA 5CCXA 3NCHA 1ATZA 1TT5B 3N28A 5C5IA 1OMOA 3TTVA 4F8EA 2OCIA 3NBAA 1CVRA 3ABOB 3KP1A 4ND6A 2JEFA 2BE9A 1JG3A 3SSNA 1JQJC 1Z2PX 5CX1B 5IBPA 2OEHA 3UMMA 5IIIA 3KEMA 1Y8ZA 1GAXA 1D5WA 4WY8A 1ZYQA 3RS3A 3CLTD 1H69A 2YRWA 3G0GA 1QP7A 1EGMB 1KOLA 4EQ6A 4IL6U 2Z2IA 2M6SA 1YB2A 3KUCA 2HNAA 3GDXA 3MYYA 1S0UA 1S5PA 2C5SA 1RT9A 2YHUA 3GIDA 5BWMA 2EQAA 4Y2VA 4BNKA 1LRLA 1X7GA 2FP4B 3FCAA 4JUDX 3RS8A 1I51A 3LLSA 3DMDA 5AVVA 5I7FA 4WFJA 2D5CA 1L7BA 4BMDA 3KDAA 1LRKA 1L5FA 1ECFA 4IO0A 1MHTA 1FFBA 3BCHA 1BOFA 3GLFA 1C30B 4ECVA 2XIDA 2X8BA 2YW2A 3M83A 1IQPA 1ORVA 3DDWA 1AGXA 1OVGA 3UWKA 4F4UA 4UNPA 4B4KA 3QY0A 5IYZA 5AQEA 2Y0BA 1R27A 3OH8A 2X3YA 1PS9A 1KDRA 5EKSA 4LRYA 1F7UA 3F71A 2H3IA 1X66A 3OJOA 3C14C 3LUKA 4K4GA 4L2IA 3FCCA 4I6GA 2ICAA 3LIIA 3ZXSA 2PT9A 3A4LA 3R5KA 1YR3A 1JMKC 1SBQA 1W48A 3URKA 1XMSA 1QR6A 2WW8A 1PDOA 3F7MA 5G53C 5IKXA 1ULTA 3KEFA 5COBA 4GOKA 5J2KA 3E15A 4C4ZA 4TRJA 1XZHA 4U6NA 3F4KA 2Q5FA 1ZWLA 2D1QA 3FDZA 3VRHA 2VL7A 1GXSB 2QARA 3DE0X 2BGUA 2WTAA 4X97A 3ZK9A 4XCXA 1G2IA 1P44A 5DGDA 3DS8A 5KKCA 1J1ZA 1KZ6A 2HQSA 1R15A 3IHKA 4NDAA 5M7EA 5SICE 5U4QA 2DKFA 2BONA 2FLVA 4XRRA 2WWHA 3R5XA 3BXHA 4Y30A 5CXXA 4JJAA 3V00A 3IM1A 5ILOA 3FPCA 1QNLA 4ZVQA 1VSQA 2VDWA 2AFHB 1RE0A 1IG0A 2WWXA 3AI3A 3P20A 4O3FA 5C1DA 1K4KA 5KTRA 3PL5A 2ZIUA 3PPXA 5L3QA 3AR2A 4BP8A 3U6BA 1EGVB 1U94A 2Z3WA 3TL2A 3GIIA 3C16C 1B4FA 5LN1A 1FC0A 1XEFA 2E8NA 5AUPB 3N2LA 3FROA 1JTVA 4HLUC 4OHKA 4J4BA 1JILA 3IUJA 1WKVA 2HBKA 4AIIA 2FSUA 2A7XA 3EVFA 5EVCA 3GC6A 4GL4A 4RAQA 1ZI6A 2NZWA 3FA2A 5CBPA 1UXIA 2GYVA 2ZJ5A 3OJ0A 1VJ0A 3Q8KA 3KU4A 1JXEA 1AA6A 2LCFA 1CVLA 3CO5A 3JARB 4JD5A 5CM2Z 2VZ8A 3VDXA 2AKYA 2CNLA 2A78A 1W1UA 1ZUNA 3Q1KA 5C53B 1KHHA 1YH3A 4RQ2A 3SQMA 9ICOA 4AJNA 1C9JA 8ABPA 2DPJA 3R3YA 4CMBA 4UAYA 2QVZX 3QBVA 1Z18A 1CVIA 2EL9A 4ZOHC 2W2PA 1OFIA 4R71A 5ABPA 5HPYB 3AHFA 5IINA 1IXZA 1YRYE 2VQ6A 3GZNA 1IEQA 1BNPA 1U99A 2NZXA 3C5WP 5BW4A 4M1KA 2XYQA 2XB8A 3DVRX 3CNNA 2EU8A 3M7IA 4LBWA 5GY7A 1OQAA 4WESA 1U1GA 1DELA 3QUSA 4ELTA 4NY1A 2DCUA 1M54A 2JANA 3ZJUA 5AVXA 3S0JA 3KV3O 1L7NA 4EY3A 1KVUA 2QTBA 3S2SA 3Q5EA 1V7PC 1LEHA 4N0QA 1Y6JA 3VU8A 2H6EA 4CKXA 4GXKA 4I50F 4EBCA 1MJ5A 1T3ZA 1TMYA 3KZ1E 4QDJA 3WMWA 3A8TA 4B5LA 2K6GA 2AOUB 1RFGE 4BL5A 2QTFA 2R62A 3NHWA 4BNDB 3N2EA 1ORWA 1BWQA 1JAXA 1SQ6A 4PFSA 3V1MA 4EJ0A 1WB4A 5HJ5A 2X4LA 1KQGA 3ZVKA 1I3MA 1P5ZB 1V4NA 1JEOA 3TS1A 2OFXA 4G1EB 5A5VA 1XIVA 3F4LA 1ZBDA 4ZOEA 1I5EA 5TPZA 2W9CA 1VIMA 3ZLVA 5TF4A 2A1JB 3OPVA 1Q3HA 2ZULA 2JIRA 3S2EA 3I6MA 5KU1A 1KU0A 1Z47A 1ZXBA 2PFSA 5KG7A 2C3YA 5KI6A 2GHIA 4WADA 3IE0A 1ETHA 4DZZA 1AU9A 1GPAA 3DHVA 4IW3B 1K5PA 4A23A 4KVZA 3LZ6A 3C1OA 1N6RA 3DKKA 1S4MA 2UUOA 2BZSA 3CC8A 4FOTA 4DUGD 3AEQA 3L8CA 4AMBA 5DQGA 4PXSA 5L4SA 1DZ3A 1VL0A 4AY3A 4YLYA 5L53A 2R9VA 4QLBA 3I28A 4LOKA 5E1OA 3W3AA 3M8KA 3EDYA 1DX9A 3PSPA 4HBGA 4NNPA 1RRFA 4PC1A 3DPIA 3U6KA 1C3VA 4QUBA 1I2DA 1U9JA 3KZXA 4TKUB 2IVFA 2F9FA 3GDWA 4JH0A 5ICCA 2GWHA 1VCMA 4LJ5A 5HKKA 2V7QD 4OJ5A 3TEFA 2C4WA 2EOAA 4QATA 4MUGA 3ZK8A 3OKPA 2AHRA 2I8LA 4N0DA 1K7EB 4RNDB 1T0BA 2G09A 1GR1A 3FHLA 1G63A 4UVDA 4UXJA 5E8RA 2FWNA 2G40A 4C7OA 8ICNA 9ICCA 3IV6A 4FW9A 1RI2A 1W5TA 4TMZA 2QQFA 3OQVA 4AZ0B 1E4VA 5FL7A 1CQZA 3IJ5A 1LPPA 2CEKA 2QQ5A 4RTMA 3IP6A 3X1JA 4XE5A 5K2OA 3HJEA 3D7NA 3F7OA 4AIRA 2YJ5A 3H0RB 2HMTA 3A1UA 4X6LA 4UAWA 3K7EA 3PQEA 1PFQA 3RUEA 2FPXA 2OL4A 5HRAA 1XZBA 2AJTA 5DBCA 5FA5A 1V71A 4IHJF 2BMVA 4B9NA 3OOEA 1EVJA 2R5NA 4MUIA 4QYTA 2BP7A 4FOSA 1PGNA 1ZW1A 2ZJZA 3DXZA 4YLEA 5DOZA 4A5OA 3ZHYA 1QFXA 3IN5A 2PT5A 2ZR7A 4BFWA 5JFGA 3SPXA 4Z1MD 3SBOA 2VXOA 5HBRA 2Z43A 2C5AA 1BPEA 1YL6A 2OC4A 5B1IA 3ZU6A 2WWRA 4REOA 4RTNA 3UCEA 3QVSA 3PF8A 3RV4A 1ZK4A 3EXFB 3QX9A 1SKMA 3L1KA 2RGEA 5B1YA 1VG9B 2QLLA 3C3YA 3JWPA 2AFIE 4G0QA 2DUUA 3EFOA 4MIEA 5HIIA 2VXBA 3F53A 3M3HA 3T8YA 4EBFA 4I46A 1OUMA 1GKLA 2C9CA 1ECWA 1XNJA 2FJ0A 3MOIA 4OMDA 5ALXA 3PSHA 4RD4A 5E1BA 4J7XA 1REQA 5E2AA 1K8ZB 2YY5A 2ZRHA 1ZK2A 1Z0IA 4BTEA 4AY6A 3E0XA 1EJ2A 1Q7EA 2GVDC 4G1VA 3TB6A 1FXWA 1LPMA 2PR2A 3Q7RA 3TSZA 1ZH4A 1XP5A 3L7MA 4D0LB 1R3DA 3Q8RB 1RHRA 3OT4A 4FI3F 1DRKA 1QVRA 4P33A 1FMTA 2OCXA 1Y33E 5JD4A 2CVFA 2W3RA 4KWHA 2ZBEA 4TTAA 2CNOA 4DG5A 2P9QA 2IIVA 2ZXUA 2C9BA 4P82A 3RVQA 2ATCA 3WK7A 1YZVA 3C6MA 1ZM9A 1HTBA 1ESMA 4H3VA 1GGKA 4KTTE 3NWEA 4ZV9A 3ZV6A 4DL9A 7REQA 3T5KA 3SCZA 3RKRA 3SIWA 1TVEA 5EERA 3L7NA 4U3JB 1CXZA 2QAIA 2YZ2A 3UA3A 4YWJA 1KH1A 2JKYA 5K0FA 3CIOA 3PRJA 4GLLA 4P93A 3ILSA 3DLPX 4R2LA 2VDRB 1FP7A 1NE2A 2J07A 4AN1A 1AQJA 4R81A 5DNVA 2IP4A 2V5VA 2W54A 2PT7A 3GLVA 2B4QA 4G0YA 2HX1A 1LNQA 1I3NA 3LA8A 4TN5A 3UEOA 1BU8A 4KMOB 1BROA 2CN1A 3H19A 1OX4A 4KQXA 4M0LA 2FR0A 1B2LA 1TYAE 5AI0A 3H5AA 3IXQA 4K2AA 4KRYA 5KJ1A 2BR3A 4RADA 1EESA 2I7XA 1L5ZA 4HTFA 2BQ3A 1FY2A 4XA8A 2KVCA 2CLSA 2WLTA 4YP3A 1GCGA 5KVVA 3HU1A 4LHYA 1L9XA 4I1IA 2BM1A 3TTTA 4ZZ1A 2YWEA 1ZQTA 5K8TA 2O3SA 4L5JA 5JAZA 2VJNA 1X9GA 2W6JD 3ASVA 4EB6B 4IWXA 5CR0A 2GD2A 3UPUA 1DC6A 2IYOA 4B3MB 3LOUA 3DG9A 2A1IA 3BZWA 2WA2A 3C3PA 2B1IA 5CVUA 1DJQA 1KI9A 4YVFA 4D3SA 4R69A 5ISMA 4RTPA 2YQZA 4RQBA 1ZR4A