4GIBA

2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
AMIEAFIFDLDGVITDTAYYHYMAWRKLAHKVGIDIDTKFNESLKGISRMESLDRILEFGNKKYSFSEEEKVRMAEEKNNYYVSLIDEITSNDILPGIESLLIDVKSNNIKIGLSSASKNAINVLNHLGISDKFDFIADAGKCKNNKPHPEIFLMSAKGLNVNPQNCIGIEDASAGIDAINSANMFSVGVGNYENLKKANLVVDSTNQLKFEYIQEKYNEYIVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title 2.27 Angstrom Crystal Structure of beta-Phosphoglucomutase (pgmB) from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Isomerase
total genus 83
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4gibA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4gibA01
4HGQA 1QQ5A 1ZOLA 4UAUA 5AI6A 2JAUA 4AS3A 2WHEA 1L7NA 3QUBA 2FUEA 2ZG6A 4CF3A 2R8ZA 1L8LA 1U02A 3L5KA 3ZX5A 3KBBA 2G1AA 4BNDB 3K1ZA 5ALLA 2YJ6A 1Z4MA 3W5BA 3BWVA 4YH1A 1AQ6A 4YCLA 2FUCA 3KZXA 2I7DA 2Q4RA 3E81A 2QYHA 1FEZA 4L6CA 5IS2A 3DNPA 3QU7A 1L8OA 5AKKA 1YV9A 3I76A 1SWVA 2ZBDA 3L0YA 4YCMA 1Z4PX 5A3RA 2JAOA 4L57A 2I55A 3AR2A 2YFYA 3QGMA 3DV9A 2R8YA 2IYEA 5AW7A 3L1UA 3FM9A 3UMBA 1QQ7A 3ZX4A 3DDHA 1EK2A 3WKEA 1RQNA 4GXTA 4Y2JA 1VFPA 4NWIA 4UASA 2B82A 4MUMA 5JJBA 1Z5UA 2P27A 4HGNA 3HLTA 2HCFA 2MSNA 1NF2A 1ZRMA 3M1YA 3WGVA 4KX5A 1EK1A 1U7OA 4UMVA 4EX7A 3KC2A 2HO4A 1X42A 3AR3A 3L8GA 3U13A 4IG4A 2C9MA 1XVIA 4ZEXA 5ALPA 2GHQA 5AHXA 3U7HB 2C88A 2I34A 3NIWA 1RMTA 3ZWKA 5AM4A 3J7TA 4NFLA 2FPRA 5AKXA 1Z4JA 2WFAA 1ZJJA 2GFHA 4KN8A 1TJ4A 3E84A 4Y2TA 3P96A 2YMPA 5ALVA 2ZBFA 1J8DA 3B8EA 4KNWA 4ZEWA 4NAVA 3QU5A 4Y2YA 2FPSA 2OA0A 5ALKA 3OCZA 3W5DA 4MWOA 4UM7A 1RMYA 2HX1A 5ALZA 3W5CA 3QUQA 2HHLA 1S8OA 3NASA 2YJ5A 4CE6A 3NUQA 2WF9A 5AW2A 5AI8A 1T5SA 5AI4A 3OCYA 2P69A 5ALOA 2G0AA 3U7EB 1RMQA 4L6AA 4HYTA 1QH9A 5AKGA 4OFZA 2VKQA 3WKCA 4EX6A 1CR6A 2YN4A 3N28A 5ALJA 5AM0A 2G09A 3CZ4A 5AKLA 3SHQA 4E88A 3ONNA 3WK7A 2Q4TA 1O08A 3RF6A 3QXGA 5ALQA 3ZW7A 2HF2A 4Y2SA 3ET4A 5ALEA 2EATA 3OCWA 4PNHA 5AI5A 3KOOA 4OD0A 5ALNA 5AIBA 1T9ZA 3SLRA 2FPXA 3WK6A 2EAUA 3PGVA 2O2XA 5ALYA 2IOHA 2X4DA 4B6JA 1RLTA 2G07A 3KDPA 1QQ6A 1JUDA 3SKYA 1RKQA 2CN1A 5ALUA 5ALXA 5AVYA 2W11A 4NABA 4J2TA 3S6JA 5AKYA 3SF0A 5AVTA 5ALWA 4EELA 2CFRA 3EWIA 3AR7A 3ZWDA 1Z4NA 3NRJA 2OM6A 2R8EA 5ALTA 2NYVA 1XPJA 1L7MA 3AR5A 3QLEA 3AR9A 2BDUA 2HSZA 2HOQA 1L6RA 5AKHA 3ZVLA 3QU4A 3OCUA 4BX3A 5AI0A 1RC8A 3N07A 1Z4LA 3D6JA 1S2OA 5AW1A 3SD7A 5AVWA 4XE5A 5AVVA 4BEVA 3AR6A 1Z4OA 2HI0A 4BBJA 1Z4IA 5ALSA 4UMFA 3I1YA 5ALDA 5ALFA 1SU4A 5AIAA 1VJ5A 4YIKA 4Y2RA 4ZEVA 3MPOA 2RB5A 2AH5A 3QU2A 2I33A 1Y8AA 2CFTA 4NV0A 2WF6A 3I6BA 4UU0A 3R4CA 3W5AA 2OYCA 2W43A 2GO7A 5AW9A 1ZS9A 4DW8A 3SKXA 3MN1A 5AW4A 3WKDA 3AR4A 2ZXEA 1WVIA 5FP0A 1Z88A 4UMEA 3NAMA 4DWOA 1YNSA 3I28A 3L8FA 4XPZA 3R9KA 4UM5A 3N5KA 3U7GA 1KYTA 2YBDA 2ZBEA 1Q92A 2O9JA 3ESQA 2MU1A 5AICA 3NANA 1N9KA 4Y3UA 4BNDA 2W4MA 1L7OA 1YS9A 1F5SA 2DQSA 3WKAA 2FI1A 4HGOA 4BX2A 4QQFA 4Y2VA 4EEKA 4JDPA 3FGOA 2WM8A 3ZI4A 4YIHA 4UW9A 5AW3A 4KX3A 4UATA 2YMQA 2P9JA 3UMCA 5AESA 3QU9A 1VJRA 2I54A 2IOFK 3OCXA 2PR7A 2B8JA 1O03A 3DAOA 3E58A 3L1VA 5AVUA 1MH9A 3MC1A 3OTQA 3ZVNA 4AS2A 2GMWA 1ZD5A 4G9BA 1TE2A 3ZTYA 2YMLA 1ZRNA 2YJ3A 4GIBA 4KNVA 3FPSA 1LTQA 4Y2XA 2R8XA 3L7YA 2YY6A 2FDRA 3QUTA 3UM9A 5T41A 1RLOA 1ZD4A 5AK4A 2B8EA 5ALRA 5IT4A 4Y2PA 2BDEA 3EF1A 4Y2UA 2AMYA 3IRUA 1WR8A 5AKJA 5AM3A 3ZTWA 3L8HA 4JB3A 2GHTA 3ESRA 2ODAA 4RESA 1RPZA 3QUCA 4KYTA 4F72A 4J03A 3EF0A 2FEAA 1NNLA 1PW5A 4BKMA 4CF5A 1Z4KA 2JGAA 2C4NA 5AVSA 3U26A 2PQ0A 1TJ3A 3WK9A 3L0CA 4HAIA 3VAYA 3ZVMA 5AVXA 4EZEA 4C4SA 2ZOSA 3MMZA 4FE3A 4XQ0A 2BY4A 1RKVA 2ZBGA 3PCTA 3F9RA 2QLTA 5ALMA 1L7PA 4CNQA 1U7PA 1YMQA 3EPRA 1ZD3A 5AK5A 5AW5A 4RETA 3L0BA 5AKZA 2C8LA 4C4RA 5ALHA 3N1UA 2NO5A 1J97A 3OCVA 5AM1A 2B1QA 1XP5A 2WF5A 3ZU6A 3R09A 2G06A 5AKIA 1RDFA 2FPUA 4EENA 4OHFA 4YGYA 4I9GA 1SWWA 2JAWA 5AK3A 3A1CA 5ALIA 3UMGA 3IB6A 5AW8A 3WK8A 2P11A 5AVQA 4IFTA 3BA6A 4C4TA 4DCCA 4QJBA 1WPGA 3N8GA 1WZCA 2YMMA 2HF7A 4HGPA 4FYPA 5AW0A 1NRWA 3L8EA 3SMVA 4YCNA 2G80A 1Q91A 3E8MA 4FFDA 3IJ5A 2JARA 1LVHA 4G63A 5AVRA 4F71A 2MU2A 2AUTA 1T5TA 3RFUA 4BX0A 2WF8A 4XOUA 2B0CA 4H1WA 4UMDA 2IA5A 5AW6A 5AI9A 1N8NA 5AM5A 1RRCA 1K1EA 5A3QA 2FPWA 2B30A 3A1DA 2RARA 4CF4A 5AVZA 2I6XA 3B9BA 1TA0A 1RQLA 2NO4A 2PKEA 5AKEA 3NALA 4I9FA 2AGVA 3WGUA 4BYGA 1YDFA 4O8CA 3QX7A 4UAVA 1RLMA 3U7FB 4DFDA 3ET5A 4AP9A 2D2VA 2IOFA 2C8KA 2RBKA 2EARA 4BEWA 3AR8A 5AK6A 1Z4QA 3FPBA 1CQZA 3OPXA 4UARA 3QNMA 5A3SA 3HYCA 3M9LA 1YJ5A 1U2SA 3A3YA 3CNHA 2CFSA 4HGRA 3ZUPA 3PDWA 5ALGA 3B9RA 3QYPA 3ED5A 3U19A 3A1EA 3KD3A 1TJ5A 1RKUA 3WKBA 1ZD2P 1U2TA 3GYGA 4Y2QA 5IT0A 1Z5GA 2OBBA 2G08A 2YJ4A 2B1RA 3WK5A 3FZQA 2RAVA 3PGLA 3WK4A 2HEGA 4UU1A 4OCZA 2HDOA 5E0OA 1QYIA 5AM2A 3FVVA 2WF7A 2Q5EA 3TLMA 1IWOA
chains in the Genus database with same CATH superfamily
2I5HA 3LVWA 2WHEA 2HJVA 4MV6A 3Q5DA 3JQ6A 4AKEA 4E5PA 1DRVA 2NQ8A 3MEQA 5J2TF 1KI4A 4MPJA 2O1SA 2PMEA 3EZLA 1SBQA 3EC7A 3AR2A 1FJHA 4KXVA 4EG7A 4U7WA 2R96A 1XWFA 4H1TA 5J4VA 3KLMX 1PJ4A 1ZUHA 2ZIUA 4DTIA 4EGSA 3NBQA 1JJFA 4NJEB 2TS1A 4RSGA 4X92A 5B3LA 1FDUA 1I9CA 3C5WP 2CCJA 1E0JA 4GE3A 1NOMA 1YE3A 3OHPA 2A0XA 4ZO7A 3U13A 3WQBA 3WLRA 4G56A 4DA4A 1EB9A 4MMYB 1H9CA 4NFLA 3WDMA 1UKEA 1Y9DA 3D3NA 3HU1A 3VO1A 2VNSA 1TMOA 1FTGA 2GCPA 5EP1A 3K0KA 5JYEA 2OCDA 2EX4A 4LDRA 4O4HB 3TKAA 5EXPA 2EVWX 1R0SA 1NP7A 3DJYA 3LYUA 2FG6C 5DM60 3S4YA 4YJ2A 2XCTB 4MQLA 2R5WA 1DFHA 2Z57A 4DQUA 3A4VA 5LC1A 2EP7A 2DFLA 4BJ3A 5IG2A 1HZZA 2A1AA 2PG3A 4MEAA 1OFTA 4HQKA 5JXJA 4N7RA 2CEKA 1JN3A 4LPKA 2W0SA 3URKA 5D5PA 3DWIA 4KN5A 4FZLA 2QTGA 3T7IA 4Q3EA 4DB4A 4IXMA 1T0UA 1K9VF 3RE1A 5CT4A 2H1FA 4R2JA 5KL8B 3J80A 1CQJB 4WOCA 1A97A 4FFLA 4KEAA 5B53A 4U6SA 2R8RA 1WY5A 1U6JA 2PKQP 4QXRA 2Y0SF 1EG7A 1ZK0A 3K92A 5FOVA 1GNRA 5KKNB 3BZKA 2KQUA 3H2KA 3PZRA 1T9CA 3KPJA 2DX7A 3UH1A 2P9EA 1KDOA 2NZUG 1XXHE 4HDKB 1Z0UA 4O1MA 1CS0A 3PJRA 2OB2A 2ZIVB 4UM5A 3FYSA 2IOQA 5K0JA 2W8BB 3JYHA 4EH1A 2KJ8A 1V8PA 4HPJB 2FSGA 5SZKB 1I0ZA 4LGMA 1GQQA 4LFCB 1Z0JA 4N3GA 2H1OA 4IFBA 3WB0A 4MCIA 4AU1A 3FZGA 1K5HA 2A5DA 3OKFA 4K87A 2YY5A 3HY3A 3VQTA 4GLBA 4DRZA 4UQGA 1I6WA 8ICVA 3GJYA 1QG0A 1Y8QB 2DPIA 4FMDB 3K9HA 2RI1A 2HRRA 3OAAA 2L42A 1JSRA 2IDJA 4C0ZA 1T5LA 4JOSA 4IZIA 4QDOA 5HNKA 1IY2A 4E5KA 2IE0A 5JMOA 3FNHA 5FI1B 4H7JA 1JKFA 1VKRA 3KZOA 3DBHB 3ANXA 1M33A 1G17A 2XNHA 4LN1A 1OOEA 2P3QA 3R7DA 3D2SA 1LV5A 2YXPX 1V71A 4RPZA 3OFKA 3TLGA 4GE0A 4ZTZB 4LZJA 1LI7A 4ZOQI 3IP9A 4RPXA 3EVGA 4W9NA 4MAAA 1YUBA 3UXYA 2HB6A 1PJBA 3EYWA 4X9XA 3P4UA 4G0XA 3TS1A 4LJ9A 1S76D 2PQMA 1EGAA 3ONVA 1OU4A 2JHCA 5C3UA 2IBKA 4W7SA 3MCVA 4YAGA 1Z56C 3IMKA 4KBYA 5KQMA 1USWA 1YKFA 2W9MA 3DT9A 3IAS6 4BBZA 3NV7A 4YAUA 3ELYA 4TXMA 3LUKA 1J90A 1BXRA 1DELA 5J47A 4O2AB 1NOKA 4IYRA 1A69A 1Y6JA 5FFMA 1E0KA 4BNFA 1UA1A 4QYWA 1IEWA 4WUTA 3CSDA 2QD2A 5B7QA 4LEIA 2ZI6A 1XQWA 1EGMB 2PZBA 4MF8A 3LX5A 1M6NA 1LBTA 1L7QA 2Q0SA 1VIDA 1K66A 4IDEA 4IJQA 4JL5A 1KEEB 2DL0A 1YQEA 4E2YA 4D4IA 1MN6A 1EK2A 2B92A 5IJZA 4EPTA 3DP7A 1KQFA 1DWQA 1LK5A 4M9SA 1Q83A 3Q3EA 5TMEA 5JPCA 5IPFA 2EP5A 1NUAA 2OK8A 4FD2A 4QDKA 2HMVA 3QIVA 1Y33E 2VF7A 4UTNA 2Q9CA 4EUEA 4NZYA 3WGYA 3GARA 3OX4A 1RABA 4QKQA 4IIXA 1I7DA 4YY3B 2C20A 3FPAA 1VIVA 3ETLA 2VP3A 3VZDA 1TYCA 4RMJA 3W5CA 4KPUA 1WZNA 2YN2A 2JZCA 5LA6B 1EMDA 5TDHA 3OIYA 4H3HB 1CR6A 3KSUA 4E88A 3BN3A 1TYZA 3PX0A 5FO0A 2EKBA 2C83A 3DMDA 1PL8A 4NYIR 1LTHR 3OZBA 2E4ZA 2BMDA 2WU4A 1ZJZA 2H1IA 1N0HA 4MB6A 4CNBA 5TEVA 3WNBA 4J2TA 3W6OA 3VR0A 2ZXHA 3O93A 4F3KA 5A05A 3IMFA 3QLEA 2W6MA 1VI2A 4QLAA 1XQ9A 1L6RA 5DHTA 3H8WA 4FB5A 3S55A 1DC6A 3AMVA 3RJKA 2IODA 4H7KA 4Y7DA 4FYYA 4BL5A 2DZDA 1RYMA 4AJEA 5MF6A 2I6GA 4EG4A 4GOND 3TI9A 2ZT7A 1P9OA 1YDEA 1GTJ1 2X0IA 1IY9A 2G25A 2GPNA 3OT4A 2CLOB 5EQJB 3ZK8A 3MCUA 4RUAA 1IPFA 3O2NA 1T4DA 2VSQA 1FFUA 4X20B 1VDVA 4CN8A 5GY7A 2DTXA 2AR7A 1EUCB 2Y0EA 2X1HA 4ZO9A 4LY9A 1QS0B 2VUTA 2O7RA 2CD9A 3K9GA 4RHYA 3G8DA 5GP1A 2HBLA 1KZYC 4AWBA 4BB5A 5LD2C 2YWXA 4DNFA 1XB2A 4LXYA 4F4IA 2O8DB 1VLQA 1D1QA 3CLRC 5H59A 5IABA 3SDSA 3EEFA 3W3AA 1MIOB 2SCUA 3UPUA 2QM0A 5A9SA 4LMRA 4AP6A 1JR3A 5FWXA 1CRXA 3IHQB 2ZBUA 4RACA 3CNQS 1FW8A 2GVZC 4WKOA 4Y2PA 1N9GB 5LZ4A 1R37A 5HIKA 3EARA 1O97D 2BHNA 3RU3A 1U28A 5K3SA 2WIJA 3VU3A 2O7NA 3OT1A 1NC1A 4L78A 4I3HA 4D57A 3WK9A 1NW4A 2G9ZA 5AUQA 3IEVA 3JALA 4ICAA 2ODQA 3OQPA 3EQ7A 4XUDA 3SF8B 1U9LA 2XIJA 4AN4A 1AJEA 3WFZA 3CURA 3LVBA 1HETA 5EIEA 4XRGA 4R0NA 3WYAA 1X7HA 1J70A 5C0OE 4Z7JA 2HU8A 4Z49A 4CLXA 4MRMB 1IOWA 3O75A 2WDPA 5MDHA 5LKRA 1A82A 2DBZA 5JFGA 2EW8A 4PM4A 2WMYA 4WN3A 5F7XA 3HKZC 5ADVA 1M76A 1QE0A 2KJQA 2XR1A 3IT1A 2A0WA 1J21A 3AR8A 3PGJA 3LXRA 5J23A 2YR0A 5ECYA 4ZV9A 1IN8A 3M9NB 3SLKA 3B82A 2AE1A 3A27A 3G7UA 5L7YA 1LFAA 3RABA 1M1YB 4M8IA 2E8NA 4RDXA 1K1QA 1GUAA 1X7DA 2KN7A 4D6PA 1YL6A 2C42A 3CJRA 2D5IA 3MRTA 2DPJA 3V7KA 4MQBA 1MQ8B 1JFFA 9ICWA 1PR0A 3IUJA 3D6TB 3V6MA 3V1TC 2JDID 1FIQA 5J4KA 4QUBA 5HUJA 5KFVA 3K15A 2GS9A 4LXTA 1L8OA 2HA2A 4GR5A 3PGKA 3ZS8A 6REQA 1ADYA 4NF2A 1I5EA 3HDQA 2JZNA 4JVSB 3IPCA 8ICNA 1UKAA 5FOQA 3FD8A 3PUJA 1IATA 2VEDA 1TGVA 1P0CA 4US1R 1CFZA 5A2QA 4YPOA 4Q9LA 3HX0A 2APJA 3DMNA 2JBAB 3E2IA 3M8KA 5I01A 2ZSDA 1C1YA 1V7CA 1P5ZB 1DC7A 2Z2ZA 4BVJA 1Q3HA 1Q7RA 2XGJA 1TUEA 3H84A 3BDIA 4HMQA 1AKTA 2O3SA 1GZVA 4IGIA 4H77A 4Q1AA 5HZMA 1CPYA 1DDIA 1H3NA 1IIRA 4P08A 4U7FA 4QZDA 3LCRA 4GF5A 4R1OA 5KT2A 4XH9B 5D6NA 4KAFA 1NZBA 4J4BA 1XRQA 1UPHA 3VKWA 5B4UA 4YR3A 1NBAA 4DQIA 2Z8ZA 2UZ4A 2FOXA 3O3OB 3WB9A 3N2GB 4NARA 5FBQB 3N2IA 1U8FO 1XN4A 2FY8A 2C3PA 3CE9A 3PKJA 2M6KA 1VFNA 3DP9A 1NIPA 1U47A 2DF8A 3U7IA 1B23P 2JVKA 4I50F 2FP3A 3SHOA 1U7ZA 5LQMA 2AHRA 1GTMA 4TSKA 5KJCA 5BWLA 3EEYA 3FLAA 5CU7A 3KR0A 4M1OA 3BILA 4PHGA 4R81A 1S2OA 3NBYC 3AUXA 4AW9A 1CJUC 1CZKA 4P86A 2WJHA 1SOVA 1OXKB 3RAQA 2AH5A 2AMVA 2BH9A 1LQ2A 1N0UA 3ZZ1A 4AKHA 2O5RA 3C4QA 4I8XA 1ZBQA 3GL9A 4LUCA 3BDVA 1WUJS 3WKDA 1UQUA 5LZ5A 1NBMD 5EQDA 4UFOA 1GUYA 3F9IA 1ZYQA 5TMPA 2FR1A 4CJXA 4OQZA 2OKGA 2A9PA 4L4UA 3JVEA 4KU4A 2VDPB 1YS9A 2W7OA 1OBCA 1MAWA 5K3EA 4C8OA 4GI7A 1OFGA 4TX1A 1L0BA 4V39A 3HCNA 3L3BA 4OJ6A 2PZLA 1U4SA 2YJNA 1KFEB 2XOKA 5AVUA 4AN0A 1L3VA 5CLHA 1Z17A 2C61A 1OBVA 1NTRA 1A8QA 2V0NA 3ZY4A 4X7MA 3I6ZA 1TZBA 1NPTO 3L01A 3GG9A 4B3JA 2NXCA 1GFZA 4ZZ0A 4IF4A 4INZA 4L4RA 4WASA 3JQBA 3ZTWA 3PQ4A 4IJ6A 4PRLA 1Z62A 4LDPA 5EEHA 1K6JA 1Z38A 4Y0VA 4I6JA 5COAA 3ND9A 3SC3A 3KXLA 2XSZD 1J2YA 1JWLA 2BMFA 4L27A 3VAYA 1FSGA 1VJTA 5J2DA 1G7RA 5AUNB 3MTAA 3FDIA 1J8FA 4HWTA 2XMDA 4QZVA 2IWHA 4PV7A 3UNXA 1P44A 4BWFB 3OO1A 3LY9A 3UATA 4MP8A 2G6BA 1M10A 1NYRA 4DIOA 1N6PA 3QBDA 3BA6A 2O2IA 2Q4DA 4WCVA 2HRQA 1YRAA 3VPAA 3SYZA 2G80A 1V16B 2HRBA 3ICVA 1FYFA 4KQ9A 3VO2A 5KQRA 1WXXA 3TAPA 3TEFA 3RRHA 1DBQA 2B30A 3JWJA 3O6VA 1DKRA 2D5BA 1ZH6A 1H4SA 5LNK1 2PX5A 1KDTA 4CW7A 4LV5B 2F1IA 2XWBF 2HMUA 4V03A 2EAOA 4FR0A 2VQ3A 4M0EA 1DJLA 3MIZA 4FIDA 1V5EA 3OEHD 2ZXFA 1KSPA 2VHYA 2BKEA 4A0FA 2ZCVA 1JW9B 5HP4A 2DQZA 2XMBA 4FX2A 1Z73A 5I8WA 1K2VN 1RXIA 4XSGA 3MTQA 3AETB 2I6QA 2IU3A 5J2UF 1YV9A 1N5DA 5FLEX 3I76A 2PLRA 4P0PB 1EJBA 4OQMA 5J5CA 1IULA 2HA3A 2VRNA 3MD9A 1EVLA 3R5HA 4NCJA 1EWKA 3UAZA 5H8WA 1EAYA 4WPGA 2DJIA 4F3CA 4HTAA 3N2KB 4F5YA 2ZUFA 3TMKA 2IW1A 1NHWA 4ZVNA 3A2KA 4ZTBA 5M3BA 5L4SA 3SYMA 3FMFA 1MB0A 3NWJA 4ETNA 1PJZA 2HNAA 2FPRA 1E9FA 5B7GA 5CP2A 1E1YA 3ZR4B 3AW8A 2I0FA 7ICEA 3NASA 4CE6A 3OCYA 5BN5A 4UTRA 4ODIA 3AF3A 1MHPA 4OJ5A 4RHXA 1C8LA 4OQPA 5AKLA 5BMVB 1GADO 3A6ZA 4KFRA 4TMFA 1THGA 2PT6A 1M2OA 1DKQA 2BD0A 2XUKA 2EYUA 3ZEIA 5EJ7A 4WD3A 1UK8A 4UE6A 1E20A 3E2PA 4UHDA 2QW0X 4IIGA 3KWLA 4IQGA 3RJGA 1R6TA 3EIQA 3RUHA 1DBSA 3HKCB 1AUXA 3EF3A 2HA4A 3CMMA 4IX1A 5ICCA 5A4AA 4DSUA 4EG5A 2NXEA 2QDXA 5KAIU 1QX3A 2QGNA 4Q9AA 1WXDA 4XKJA 3K9CA 5FWAA 1CP2A 4TTPA 1DAEA 3W90A 2MIIA 3D9QX 4MI1A 3R9WA 4NONA 5F2OA 3QKRA 1QIHA 3LBIA 4GC5A 3TZLA 1JAZA 1PK7A 4HSGA 1C1DB 1H0HA 3WZ2A 3EVZA 2CXUA 4IR7A 3H18A 4YUAA 5KHOC 5TS3A 1KLNA 1M5UA 2I66A 5KYUA 2DSNA 2QJRA 4ED0A 4E6EA 1PTJC 1JXQA 1C3VA 4H18A 1SQ0A 3RBVA 3M6MD 3DCIA 1FP4A 4G86A 4QPZA 4TZTA 5CRIA 4Y8VA 4ZQHA 2JCBA 1MB4A 3HYNA 3ZCRA 1ZW1A 3P1JA 1WCYA 4FUTA 4R8VA 1BC5A 2ZSUA 1K9SA 4F92B 5CX4A 2PKRA 4BASA 2RCYA 2W2VA 3SSMA 5AK4A 3IQWA 4J4TA 5FPQA 5U9CA 1RQ7A 4JDUA 2A1TR 3F7MA 3SN6A 2JLYA 2C2RA 1WW8A 1GGJA 1QQTA 4KC0A 4X8OA 1JHVA 1SA0B 5LYJA 1SBHA 2Y0SC 4WJLA 5K3OA 1L5YA 4EZEA 3EW7A 1ND5A 3MCAA 3Q87B 2ISOA 3RVDA 4CI0B 3GIIA 1BNPA 4Q12A 5COBA 5CEFA 1COKA 3H4MA 4KFSA 4IDGA 4BAGA 3T3HA 3A06A 4IV8A 5K0NA 3VHXA 3DFUA 1Y6RA 4M49A 3PRHA 5K0TA 3HXOA 2PAFA 3DOCA 1D07A 4I2VA 3QEAZ 1X80A 5C51B 3LW8A 2FXVA 2V58A 3FSEA 5FBWB 1QGUB 4NAHA 4QSMA 1PTKA 1AXEA 1DTWB 1EVEA 1YDFA 3I5MA 4GKBA 4RQ4A 5J2TA 2ZRMA 4Q7KA 4XVRA 2ZE8A 2B99A 4V3BA 1P45A 1XHEA 1L5VA 3L8CA 4HB4A 2OSBA 2RRDA 5BQXA 1JS1X 4FFVA 2FX2A 3K0FB 4P3OA 5JE8A 1HOTA 4IJWA 2X0KA 4G2TA 3GH3A 3OU7A 2RSLA 2V6BA 3MWLA 3ICWA 4HNVA 5HZKA 5BYAA 5HRCA 5BSGA 2V7WA 4AS3A 3O8OA 1OHHD 3E23A 1U02A 3X1YA 1NULA 4HAUA 1IHXA 4M0PA 1EK0A 4M0KA 3M6VA 2BEUA 1KVQA 2XGQA 4QGHA 3AU9A 3H6HA 1DLIA 5I45A 2R8YA 1Y3BE 4ZXPA 3PDUA 1U0FA 3BQNB 3R20A 3F5MA 4Z4HA 3GZ4A 1D4OA 2NUPB 4EECA 4NY1A 2AJDA 2XDAA 2X1LA 2RGXA 1MJGM 2G5HB 4UNQA 2WHPB 2YDXA 1XVIA 1B0XA 1OIWA 2B4TO 2XWJI 2JASA 1B74A 4WKCA 3AB8A 4Z3OA 4E4TA 1UPAA 4KMUA 1MJ5A 2JH9A 1AS3A 4C5AA 7ICIA 2L82A 3EGCA 1Z6ZA 2Q4BA 8ADHA 2AX4A 4Y9UA 4IILA 5B64A 1GPH1 1HYQA 1ZVKA 4JKOA 3Q1LA 2J0UB 5T7BA 1TPZA 1S2GA 1K27A 4EABA 3ZU5A 4MGYR 3P9NA 5CXQA 4TXHA 2O07A 4UBCA 5ALQA 1QPZA 4JC8A 2XB2A 1G66A 4MARA 3AESA 1MO4A 4LS3A 4FMBB 2R60A 2YS7A 3A1NA 3B85A 1Y1TA 4LW8A 1LGYA 2G07A 3ASVA 2PSHA 1V3TA 3TK1A 3UHOA 4B44A 5CG2A 2FZVA 3MG9A 5D01A 1LPAB 1VYTA 1SU8A 2C5FA 3D5EA 3BMCB 3ZHCA 1AN9A 1PSZA 1AT1A 3FFWA 3BIFA 2O4UX 3L82B 5JU5A 3AGQA 2WLTA 3MUNA 4AUEA 1A4UA 3BWYA 4ZQGA 3ACBA 2ZETA 4NLCA 3NRCA 2C9ZA 4D43A 2WF6A 1E98A 3I30X 1ZNXA 2W43A 3LDHA 3Q11A 2FK7A 4IVPA 5L1KA 2ATLA 4J1TC 4L4YA 1WV0A 3DBRA 2E1RA 4PY2A 4DSJA 1FY2A 1VJDA 2DC1A 221PA 1DS6A 3O9MA 1T7PA 4QT4A 3GEDA 1HDRA 1NW7A 4QTYA 4KXFB 5CB1A 3L5OA 2IV7A 2PUWA 4TMZA 4II2A 4H0FA 1SIUA 5JNWA 1UM9A 1VJRA 4MKRA 4ZRDA 4CKBB 2ERYA 1R3DA 3PFGA 4QJIA 3PNBA 1IXRA 1ZP6A 3K16A 2R8XA 5T14A 1RXVA 2R6GA 2JHFA 1BW9B 2B69A 3IA7A 4Y2UA 1RHMA 4LYYA 4RESA 1SIJA 1KY4A 1K7FB 3EG9B 1NBWB 4CDMA 4P4UA 4NTZA 1XYVA 2V0CA 4K9MA 3HR8A 2H4YA 2NU6B 1KU0A 2VJQA 5JEDA 5DGHA 2PSDA 3TD6A 4E2ZA 2OO5A 2W2MA 4F3YA 2KFNA 2DULA 1UBHS 3KOZA 4TWIA 2K5UA 1N25A 2ATVA 1QZUA 4UTOA 1NVKA 4F46A 2DP4E 5IZ4A 3VI3B 4GOLD 4RFSA 4E6PA 3PNCA 1WMSA 2PFKA 1RRMA 3KHTA 1H5QA 5KNDD 4JITA 4CMGA 3G13A 3LHFA 2P8SA 2ORVA 3PDIB 1Z12A 4IVRA 1RWBA 1XKXA 1DIAA 3RUDA 3TX2A 3V4RA 1G9XA 3N7SC 2XQIA 4XQ9A 1FC0A 3MWFA 4Q18A 2GEBA 1N2HA 3NPAA 3EH1A 2RK6A 3I5UA 3PW0A 3TXXA 3EGIA 1J2UA 2H3QA 4UB2A 5DLEA 2G8NA 3EQ9A 3MXTA 2H7CA 2X6TA 2B6GA 4GNKA 2BDPA 2IVFA 2P3SA 2DBVO 3C5VA 1YAHA 5C1OA 1AQ6A 2I7DA 3AFGA 2XUHA 4QARA 5TSDA 2CMHA 3T1VA 3PZPA 1N2OA 3L8YA 3NBUA 2EZZA 2VPQA 2PZMA 1JFRA 5G0VA 4G3IA 1SCJA 3EUFA 2XRYA 1ZJMA 1UMDA 1GQFA 4BLUA 2VF4X 1FU7A 3WYGA 2AFHB 4G5QA 2WFMA 1U2RA 4CKCB 3LA8A 2E0IA 3DC2A 5EC8A 4F8JA 5C1IA 3B3FA 1H8HD 1BDBA 2ZRJA 1SBIA 3TADC 1WHSA 5BRNA 2FPKA 4DEXA 3FYDA 1P31A 2XCPA 5J2EA 4OLHA 1L4GA 5KVAA 1RHKA 2B83A 2UV8A 1JWBB 1V9SA 2WM2A 4KWTA 4ZO8A 4TQGA 1T5SA 2FW9A 2PS9A 3ROKA 2W0MA 1P7ZA 4NDZA 5H83A 4JI6B 2ZK7A 3NX4A 3HKZF 3CZ4A 3CT6A 1VSBA 4HGYA 1R4NB 4PLWA 1KZ4A 1TM1E 1BA2A 3ELBA 3ZD6A 4DIKA 4N3BA 4TLMB 3TAUA 4H4EA 3AEQA 4D0NA 2CLFB 3N7PD 4FGZA 1U4OA 4LYJA 2H2FA 4B6JA 5DOZA 1WWKA 3K4HA 3T5AA 1W5BA 3G2PA 1SG6A 2YV5A 1NW8A 5AMXA 3GEIA 2HOQA 3HFGA 5ILGA 1Y1RA 4IVQA 3OPVA 2HMSA 4JX9A 4C80A 2GZRA 4E12A 1Y42X 4QQKA 3L93A 4C7KA 3ZXSA 3I9V1 4Q3NA 3CUWA 2RB5A 1P72A 3TQRA 4PEVA 2OB1A 1A7UA 1HL7A 3SZGA 3HFSA 2EAPA 4DPKA 1A4XA 1Z6QA 4P35A 3KELA 4DA9A 3VFDA 2JPDA 1YR3A 1TAQA 3TUZC 5GVRA 4JV0A 3DD5A 1KAQA 3TIGA 2WUEA 2B35A 2XLBA 1Q92A 2WSLA 2O9JA 1XN1A 1M2VB 4HB2A 2X2FA 1GDDA 4AKIA 1KKUA 3CYFA 7ICOA 2WM8A 3BGVA 2NGRA 2DKZA 3EBOA 1L7DA 1ZGCA 3OCXA 3LQRA 4YWHA 1EDDA 3L0ZA 4N5MA 5DGXA 1CUKA 1M1NA 1QE5A 4MWSA 5JY1A 3AF0A 5CVEA 4DYDA 3W2GA 4BGVA 3T4EA 1MT0A 3GELA 2BCVA 1R7RA 1JR3E 4MI9A 3LUGA 3H5LA 1EM6A 3JZAA 4HC4A 5IVHA 4YR0A 2XGPA 1OZ0A 1FFAA 2YIJA 3DW3X 4P3XA 4DR1B 3FTEA 4B74A 3BH6A 3HCAA 5FYQA 3F5EA 1O94A 2H6EA 1JG3A 3BWCA 2O06A 5KO2A 2B2XA 4II7A 2QJFA 2WF5A 4KAXA 1I32A 2DUWA 3SXJA 3DE6X 4U6NA 4J16C 4LJLA 4E21A 4YJDA 2RB4A 3B3AA 3FDZA 5I7RA 2O7SA 2AQ4A 4HL6A 4OOFA 2OO3A 4KN9S 4IH9A 3V2GA 3KQQA 3TSCA 3RB4A 3CLTD 2IYSA 2CDNA 3PUVA 3REQA 4JJIA 2PJRA 5K0FA 4G0QA 3Q15C 2B1GA 1FNCA 2R79A 2HR1A 3P27A 4M9ZA 2BCRA 3N87A 5CYPA 2VDKB 2P9FA 4JEIA 3OM1A 4PYNA 1P29A 4BFVA 1EXVA 1WHTB 4I36A 4ROTA 3GEMA 3AUYA 4MH0R 3A31A 4L8FA 1IZ0A 1N9ZA 4J9SA 3S0JA 1J0BA 1GCUA 4GNRA 5DHUA 3C23A 4GFDA 4ZVOA 2H9IA 8ICOA 2RC6A 4X1OA 1UDAA 2H54A 4MVWA 4F2SA 4RTLA 4F45A 121PA 5KNDH 3RH6A 3EMDA 2KE5A 1GGMA 2SECE 2KFZA 4RHTA 3LO5A 7ICVA 1J25A 1OXXK 3UMVA 4DLYA 1HE8B 2KICA 1BE6A 1N3YA 4HZUB 1CU1A 3UFBA 4RNMA 4HYQA 1WKVA 4L3OA 2EL7A 5AVOA 3T1HB 3AFNA 3PNKA 2V8BA 3RW9A 2V5UA 5CLQA 2ZBQA 4MR9A 4GMXA 2MHCA 4JB0A 4NATA 4F5NA 4GW3A 2OR3A 3B48A 1UKBA 3THRA 4I2CA 2YC4C 5CT6A 2OP0A 1QFSA 1F17A 3UJ3X 4RADA 3VR4D 2XNJA 3P2JA 2HK6A 2WMDA 4KQ1A 4I50A 3U4GA 2PDAA 2VBIA 4NH0A 3NVWA 3C48A 2ZJ6A 4DSFA 3F3KA 4OKIA 3HK2A 2ZXUA 1TRHA 4LXIA 2Q1SA 4CN9A 3CS3A 5K4LA 2F2TA 3WSTA 2HHTA 2FMQA 1U7TA 2J7PD 2KPOA 2C4MA 3I09A 3M4JA 3UWOA 4PAMA 4C3VA 1KIFA 1HE2A 3COPA 1Q17A 1SD5A 1VLJA 3R7WA 2ZKLA 2Y9PB 2EDCA 3LKVA 5BV8A 3WR5A 5BMOA 4C7OA 2QX4A 3K9FC 1Y1LA 1DQNA 4US2R 1RYNA 3JRWA 1Z5NA 2ODNA 1A9XA 2AN3A 3M33A 2MOKA 4EI9A 2XMZA 2AI1A 2XYVA 4LWZA 3E8SA 2CDAA 3H4VA 3H3JA 1PG5A 3TBKA 3NRZA 5KMGB 3WMRA 2CJPA 1RCTE 3PLAE 3VC3A 2F43A 3BZUA 1DKOA 5GTIU 3GJTA 4ECSA 3DEZA 4F4HA 1KDPA 1YGYA 2ISPA 4NRDA 1EEXB 4IJKA 2LBOA 1X19A 3LY8A 1RHQA 5HOEA 1NE7A 3QTBA 4F4KA 2O2ZA 2AVDA 1M66A 4F96A 1Y5MA 2GI4A 3PY8A 1S02A 4B9VA 3AEKA 5GINE 3AY3A 4UATA 1T4MA 3DNMA 1CKEA 1ENPA 4HWGA 4HYKA 4MW5A 1FXUA 1Z6GA 4H15A 3WMXA 4M38A 2EZ8A 4O3RA 1J24A 2H3HA 4GVPA 2PKXA 3HFJA 4PPFA 5JS7A 1CB0A 3LGXA 3Q7RA 5IJWA 4NBLA 1L5HA 2XE4A 1Q3KA 4NSNA 4CEIB 1JG7A 3GIMA 1CY6A 1M3SA 4ZQFA 1KRHA 1Z13A 2HDNB 3VHRA 2X8JA 1LKZA 2KE7A 3D2BA 2RHTA 3TSWA 1G63A 2O8EB 3QVKA 4F9EA 3UT5A 4J0QA 1QFYA 3B70A 4CUKA 2PWBA 1XLUA 2XT6A 2XUIA 1EVKA 1MDFA 1PK8A 1F2UA 1ULSA 2QZJA 4CTMA 4NK4A 4WN9A 5CAEA 1HZJA 1SHZA 3ORFA 3K32A 2QM3A 5T4HA 2AN9A 5ILOA 1S8NA 4G5OA 1RKXA 4HDNB 5BW6B 4ZYVA 1PEYA 3NTRA 1H0SA 3F2IA 4CM1A 1RJGA 7MDHA 2K8CB 2I03A 2H5IA 4D3SA 3QX7A 4DFDA 3TMAA 1Z5OA 2IJGX 4REMA 5J2UA 2LE0A 3K20A 1VE3A 4MCHA 4IDNA 4Z53A 2BFMA 4TZ6A 4I2FA 2ZTUA 2VJ5A 1C9KA 3U19A 4KTVE 2JEZA 3AHJA 2PA3A 1EAMA 1QRUA 1TFRA 5DNEA 1Z29A 4NU5A 3RH5A 1E1RA 3WIEA 5JI2E 1E32A 1ES9A 4NP6A 1XKTA 4YGXB 1GNVA 2ORYA 4O2RA 1IWOA 3SEZA 2WOJA 4GC7A 3PXDA 1XSEA 1W2HA 1Y8ZA 1FTNA 2A35A 4U2EA 4EKYA 1ZVVA 5TT0A 1WCNA 4DSEA 3G2LA 3HJGA 4A4DA 1XEXB 1S1CA 3MXOA 1D8YA 1YL7A 3AXTA 3NWEA 1SZDA 5EWEA 4IEIA 1MNAA 4AJLA 1YZ7A 2YZMA 5KKAA 4DJTA 2O2HA 4I7EA 5DXAA 2IXBA 1CVLA 1IAQA 4URVR 2UYCA 4YRFA 3UPDA 3UMRA 4AZSA 3LNTA 1CY0A 4YMTA 4CM3A 2I8CA 2ZUUA 3GDFA 4KQ6A 2HJ9A 2HQRA 2AG8A 1B26A 1SULA 3GMSA 2HHWA 1NF9A 3A1VA 3D3WA 1WQ3A 1Q7TA 2QZ4A 1JALA 1VIYA 1ADCA 1Q74A 5D3ZA 3ZDDA 4O4HF 4KPGA 3JQ9C 4IO0A 5TF4A 4DOCA 2WU0A 1K1SA 2QT0A 3ORQA 1ULBA 4CDRA 1D5WA 4BMYA 1F2DA 3L0OA 3N58A 1ZNWA 1NJ1A 5EWJB 1A7AA 2F64A 3E9MA 3D2QA 2JGDA 5ALNA 4C3OB 3HPOA 4Q9JA 4RK6A 1VC2A 3C28A 3JZIA 3GGCA 2ZTEA 3KKKA 3HDTA 1I0LA 3QA3E 4FGWA 3VR4H 1B8OA 2B3TA 1VXRA 1YB6A 3AKYA 3CEPB 5CHEA 2ODGA 4ZYUA 4IAOA 4Q7EA 4Q3LA 3W34A 3QXXA 5I4CA 2D5CA 1NSFA 2A88A 1QNFA 1H2XA 2IEAA 1WUIS 1XTUA 5JAIA 4W63A 4EZ9A 2FW0A 3VCBA 5KHAA 3ZWQA 1JDVA 4ZZ3A 4LWOA 2DERA 4M37A 3X1ZA 5LXTB 3ZKAA 3C45A 4X1KA 1TKDA 4ZPXA 3K6SA 1L6IA 1BMFA 1UMBB 2WSMA 1T91A 3C6KA 2HM7A 4MW1A 1ZQ9A 2Q7XA 3MN1A 1UH5A 3PHIA 4YJ3B 4UMEA 4BB6A 2QB0B 1OA1A 1S89A 3QPUA 4CHGA 4DWIA 5DQIA 2PY6A 1O95D 3IBCA 1B43A 2H1RA 2OGWA 1PZMA 4UE3S 3RTVA 3I5XA 2P67A 1ZUNA 4IH1A 5CX1A 2BKAA 3MFYA 2XZTA 4B3DA 2C7RA 3UUFA 1UMCB 2NVWA 4ECZA 2I54A 2EQBA 4I29A 4CI9A 1JTVA 3OFSA 4DSAA 1DFGA 4MIYA 4FMDF 4LVCA 1N78A 2HREA 2O19A 3BS7A 3WGGA 2KBFA 3GLVA 1S97A 5BUCA 1C9NA 1FP2A 2YJGA 2C2BA 3EGDB 1WMFA 3RUFA 3IQGX 1OFUX 3RIEA 2BKXA 4UD2A 3IUEA 2R1TB 4C4SA 3EUAA 5IK2A 4C7JA 2CK3D 3A2MA 1XELA 3IX7A 4MPPA 5DTMA 1MO3A 2GTHA 4DFPA 4KTTE 1LJ8A 2WAOA 1OUQA 4LJAA 5HHTA 4KYIB 3I04M 1FDOA 4FHFA 3CISA 6LDHA 5KQLA 2D3WA 2YMMA 3H9QA 4UHKA 2Z9CA 4GPZA 4LXGA 2BPFA 3VRHA 1MRZA 1KO1A 1DWOA 4XWYA 4CTKA 4XOUA 1E1CA 5AXBA 2UXBB 5G4LA 4DLNA 1ODCA 1U98A 1QGOA 3C8MA 3PO5A 5G4KA 2P6RA 3KQMA 4RBNA 4LNUA 1L3UA 2PS1A 1NJXA 2NO9A 2V7BA 4UARA 2YOHA 1M34A 4FIZA 4HGRA 1FJGB 3DE7X 1RQXA 2C77A 4ZCRA 1HEIA 2KEYA 5K0EA 3PGA1 1Q0ZA 5CVCA 1RI1A 1CEEA 1ULAA 1PZNA 1WF3A 4MVXA 4D8TA 4XFKA 3OICA 1L5WA 3MVEA 1DT5A 3NG1A 5IX8A 1QXSA 3FVVA 3T5HA 3PEWA 4RL4A 4RZUA 1I1QB 2FDCA 4DG5A 4PIPA 1YDMA 3GDOA 1MENA 3IBFA 3QELA 3RC3A 4A6DA 5HX7A 4MW2A 2VXBA 4C04A 3A9SA 4ZJZA 1CJBA 1EDOA 4GT1A 1DBVO 4FE7A 2NXWA 1C0PA 4FFPA 4JLVA 5KPJA 2HQBA 3HZOA 4Q01A 4ZAYA 1GZDA 1SUFA 3IBGA 1RBMA 1Z26A 5M34A 2XWPA 3HB1A 2BTOA 3D5TA 4BO1A 4AS1A 1PHRA 1XPUA 4NLBA 3RCBA 1RPNA 3KXKA 4EOGA 4FT4A 1FUIA 4QNNA 1Y4DE 3JATA 3CKLA 1XRLA 4HR7A 1W87A 1JEYB 5LA6F 3K6JA 4JHLA 3GFGA 2BMVA 1Y80A 2IZZA 2BUAA 2HHLA 4P7FA 1SVLA 2QAGC 5HRUA 4FNGA 4DWJA 4HYTA 2I7VA 5IJ9B 3NTLA 4BX9C 16PKA 2RHLA 2XUQA 2XYGA 1WCIA 3SLRA 1Y5IA 3A1UA 1I7SB 2KLHA 3V4PB 1OJ7A 2FR8C 1G8KA 3LBFA 3KHSA 2NP7A 2YINC 1ESCA 1RWQA 5ALXA 4JLAA 3W5UA 1F0YA 2NV0A 5EIBC 3IMCA 2GZSA 2FVYA 3UGQA 5TS2A 2PKWA 4P2HA 4DNQA 4IRUB 1TMKA 3DG9A 1B76A 3CV3A 4HS9A 1XCMA 4NZPA 5ECDA 5C8YA 3RFCA 4YP6A 1LRJA 3LDAA 1P77A 1SQ5A 4PFJA 3A7DA 4DABA 1L9KA 2HRZA 4NK5A 1CY4A 1IEVA 1GL9B 2SKEA 3OE7D 4PXYA 4YALA 5IH3A 2J9FB 4FE4A 5H3HA 1G3QA 5HUHA 3HDJA 5AW4A 4RTRA 3CF4G 3FVTA 1OYOA 4HXGA 5A62A 2HSEA 3L7MA 2IEGA 2P8JA 1BE1A 1BXGB 3O83A 5DBAA 5EZYF 4TVSA 4YCSA 3GGPA 3IGFA 4D8VA 4GC6A 4M9HA 1XSPA 4AX8A 1V3VA 4BKRA 1R66A 4QZ8A 4BFUA 3IQFA 1CZRA 3IE2A 4AZ0A 3NYQA 1V9CA 1NQVA 3NS7A 2BJVA 1SBZA 2OILA 1IONA 5GTDA 1E2IA 2F1KA 1RBQA 3E03A 3TTVA 3PSFA 1TE2A 4F3RA 4I1IA 3BE5A 1VMDA 2QTBA 1RC0A 4BO8A 1A04A 1SUAA 4PIVA 2PEZA 1WXQA 2X2EA 1FK8A 1G9TA 3LL4A 3EF1A 1V47A 4Z2YA 2DR0A 1O8BA 5EOVA 3RREA 1LPBB 4BZQA 1SZHA 1ISGA 3C70A 1SL1A 1Z4KA 3IOBA 4X8MA 1KAHA 3OZUA 1YT5A 4P9NA 2MUTA 2J4FA 1T36A 3LIPA 5LDGA 2DE0X 4HVTA 5FUQA 3G23A 4MGZR 1SUWA 1DQYA 3OZRA 2J5QA 2OLJA 4EHLA 5DLGA 1K88A 1GFIA 4Q00A 1Z18A 3SBEA 3U37A 4ZVSA 3HVUA 4ZU3A 1G21B 1ORHA 4TMXA 1V5IA 5JQGF 2A30A 1SFRA 4BRUA 2GBIA 3X43A 3FNQA 1BKDR 1NMZA 1F7UA 4TGLA 2HPZA 2QN6A 1L5SA 1L1FA 5JJLA 3C16C 3ZE9A 2O2JA 3R8XA 3UK6A 3IIIA 1XK7A 2LIPA 4FEYA 2BQUA 4OPMA 3KAKA 4F5PA 4PZCA 1TT5A 1CJVC 3ZHZA 1YCHA 5KS2A 4L4ZA 3RQSA 2LKDA 1VOTA 3FKSD 1QCCA 3F8WA 3KZKA 5TVGA 3PDWA 4DLWA 3HR4A 1J22A 2JJ1A 4MLZA 1L4YA 3JQ7B 2GPYA 2IYWA 4QW9A 3K9NA 2QT9A 1JXOA 4XVHA 3A6JA 3WO1A 2HMTA 2ORIA 3FGPA 3RBEA 2I65A 3ENQA 1DNPA 2AOWA 2I1LA 2ID4A 1ZX1A 4IUDS 1TL7C 3WOVA 2QM7A 3CLKA 2J3QA 3RIGA 4JI2B 3GFSA 1L4HA 6ABPA 3STHA 5GV8A 2VJNA 1N33B 3ICEA 1YZUA 1M1ZA 1Q0PA 1GG5A 3DWEX 2J1LA 2IYEA 1ZQLA 1VZ2A 2MRLA 1U04A 3EXIB 3ISVA 1LFDB 1KDYA 1YQXA 5EWMB 1JGTA 3R77A 2PS0A 1RLJA 4DVGA 1Y4ZA 4YQWA 2H1HA 5ALPA 4RHCA 5AHXA 5KYKA 4UBBA 1MIHA 3HXMA 2HPAA 3GRCA 1DKPA 5IXSA 1E3EA 1NG9A 3T0GA 2H0AA 2ZT8A 1I2CA 4ZEWA 3FH0A 4XUEA 4DPLA 1F20A 2QEQA 4IFEA 4GQIA 3H1BA 3G9TA 3AI1A 2RCNA 1ISRA 1DO2A 5HTKA 2C7QA 4MUHA 3HXLA 1SHLA 4QYMA 3OA0A 1L4UA 3P9XA 4L9SA 5IUJC 2WT4A 3KXPA 1M2KA 2OCPA 4MI3A 2PCJA 4BIMA 3KOOA 5E8JA 1G8YA 1RWPA 3UMYA 2EAUA 4UXHA 3U5TA 1NNUA 5ECGC 1E3LA 1ZHOA 2W11A 1OC4A 4W8HA 7ICGA 3O84A 2R66A 3EZ9A 2O14A 2WG1A 1L7MA 2VT7A 2P65A 4KLSA 5KNLA 2JC3A 4EW3A 3MWYW 4F8RA 4FOLA 4R7GA 4LVOA 4F04A 4AN1A 3LV8A 4BNHA 4H7EA 3QVMA 4JQSA 1UXHA 5AVVA 1ABFA 3KQSA 1R3UA 2BDTA 1ZQYA 2V8OA 3PK0A 4ZOEA 1Z8DA 3MPOA 2M32A 1O5TA 4BVBA 2HK7A 1N3LA 3HUTA 4I2IA 3C7AA 5ELMA 3T3PB 2UUAB 2V3CC 4C4XA 4HJRA 4KUHA 2ZE5A 5MGNA 3SYTA 5IDWA 1SG9A 4FZRA 3R5JA 4TL9A 2B9VA 4C6TB 4Y3UA 3E5MA 4AMBA 3H05A 1SKQA 4KTQA 2ZI7A 4Y6PA 1PLLA 4ZODA 4Z9AA 5FLKA 1K8YB 2H7YA 2GXQA 3T7EA 3O74A 3UQ2A 2AFIA 4PL2A 4KVFA 3H2BA 4CODB 5EE5B 3BCUA 4B8WA 4JI0B 1ELOA 3TDMA 5DMXA 1VDZA 1QMPA 3KVVA 1OW5A 1L4EA 1BO6A 1KDVA 1XRRA 2AF3C 2QZPA 2CBZA 3RJMA 2XMQA 2JI7A 1YHYA 3D7LA 5E1OA 3LDFA 4OB8A 1G3MA 4LGVA 3UWKA 3AHEA 1C3EA 4D82A 4MR7B 3TMYA 3EXG1 3CVWA 5EN4A 1T3GA 1DQZA 2V7UA 2I4IA 1VL8A 1EZ4A 4MWGA 2EWWA 5LBTA 5HF8A 2HV8A 4MKIA 2ZBGA 3LT0A 3QHPA 4O5CA 2GESA 5A7FA 3L0BA 2G9QA 2X5JO 1ZZEA 4D56A 1JIQA 4W8OA 5BORA 3L9XA 1SWWA 1QZ3A 2GNPA 3CMCO 4DQLA 3C3AA 1P75A 3IVXA 1LU9A 2XT0A 2RGYA 3OFNA 4FYPA 1GZ3A 2VQFB 1XMXA 4EMTA 4PBRA 4YRPA 4UFNA 2HU2A 2II6A 2C28A 4TYYA 3DGFC 4XYBA 4MA5A 1PUZA 2IZ0A 3B9BA 2C2YA 1D4AA 2FSPA 3RFTA 2AOUB 3FCAA 1LBSA 3F97A 1I2DA 3HCFA 2IS4A 5LMNB 4GPEA 4DN6A 3H9BA 4LBWA 9ICLA 5BY2A 3NM5A 3A37A 4HBGA 3ABRB 1X1CA 2YJZA 4RELA 4H7HA 3NR2A 1NJFA 1J2NA 4A10A 3SAHA 4MWDA 4GP9A 5IN5A 1SKWA 3ZU4A 4EBFA 4LZAA 4M76B 5CA1B 2IF2A 7YASA 1IN7A 2Y1GA 3ONWA 3NHAA 2QNRA 3KCNA 4TVBA 4G37A 2QUJA 1TXGA 4URZR 1P80A 2J3EA 3D1VA 2Q9AA 3DZFA 3EGVA 3BJZA 1NU6A 4QTUB 1UJBA 1G6KA 2XEXA 4DAEA 1R8YA 3O1JC 1TAGA 5EKUA 1G3UA 1M6WA 4XYLA 2EH9A 3BH0A 1F6WA 1OV6A 4OYYA 8ICRA 4F5RA 1KI9A 1J99A 4PSCA 3O92A 4A8JC 5AOVA 1G7CA 3CX7A 2R62A 3KT0A 5G0SA 3K0SA 1UFOA 5FUWA 3MS2A 2E9SA 3NIWA 4J3FA 4LDAA 4GO1A 1WWUA 5CCDA 3V7WA 2G5GX 3PF9A 4YJGB 4PQFA 3TLXA 3A6PC 1Q0SA 3GLQA 3CVYA 5DBCA 2BFFA 5BV7A 1QFXA 3FYUB 5CVJA 4LOJA 1VG1A 4FXPA 1TEHA 3NNSA 3K1AB 1ZQKA 4DMLA 4IXTA 2I2DA 3A11A 2DWUA 2V6IA 1P3JA 2QTVB 4XGRA 2GRJA 4M36A 3V4SA 1K3TA 5HFNA 2RHCA 1GPBA 2C94A 1FDRA 3O3MB 3KTDA 3CU5A 3PQFA 1QAMA 1R0RE 3B6ZA 1E77A 1N62A 3WLTA 2VJKA 1H0RA 1JHOA 2WTBA 2PT9A 3KVNA 4OYHA 2Y0DA 1T1JA 1PJCA 4COOA 1ZKDA 4Y9TA 3ZWWA 2R87A 3H0MB 4BO5A 4YCCA 2C8JA 1ZSVA 4BMCA 4Z6KA 1IY8A 2JJYA 3A6HA 1K5OA 4EFKA 3IR7A 3E4DA 3FOCA 2VDWA 4DW8A 2YWCA 5GOTA 4J7AA 2F9FA 4N65A 4K8RB 5DNDA 1JF8A 1TU4A 1YK1A 2P2YA 3QPDA 1IWPB 3U4QA 2V7VA 1FP1D 3NOXA 4WCFB 3MHPA 2XB8A 2I3ZA 2Q1YA 2DQNB 3WY9A 4GOXA 2W7TA 2ZJFA 3LWMA 3CUVA 2WQ6A 1SB9A 1K92A 2C96A 1AGXA 3V6HA 1SUBA 2JG3A 4GL4A 4QTTB 4Z99A 1D2EA 1NVAA 3O94A 4US0R 1PQWA 4QDJA 5DASA 5H16A 4IOKA 3RIYA 4C03A 5E3HA 5LUAA 3HCOA 3B51X 2QRGA 2JFNA 2QK4A 3U16A 3AWDA 1EP9A 4IWXA 5BN4B 1XMSA 3PQ8A 2EHDA 3ZCTA 1V4NA 2YUIA 5BYJA 2RC5A 4YWJA 5IKXA 4RZRA 3JVUA 3FAKA 4N12A 1U1IA 3CONA 3QFSA 3ELWA 4GHWA 5KC9A 5B37A 5WRFA 3LFHA 4OYLA 4NY8A 2JRZA 1QHIA 2FH5B 1PTJA 4BVAA 4DCCA 2H7VA 3OIDA 4CMBA 5DCWA 1E1QA 1JG4A 5CK4A 3QSYA 3WSWA 4R8UA 3F2DA 1X1RA 4MUKA 5C7OO 4L7QA 2QLJA 3WP1B 4Y18A 3I53A 4D81A 3G79A 5REQA 2QXTA 1JXEA 5AHWA 4HNQA 3HJUA 4XB2A 2B5OA 4N8EA 3HBAA 2X13A 2DT8A 1DBPA 3N2EA 1UOEA 2DBRA 2QW8A 1W30A 3BULA 4E15A 3DEAA 3PGLA 3PKZA 4KXWA 4BTVA 4JP1A 2UZAA 1PQPA 5HQTA 3HKEA 1RJWA 2P66A 1T2EA 5BNWA 2ZG6A 4M1WA 2JGKA 2F59A 1XUOA 4Z1MA 3AX6A 3ILSA 4YK7A 5DWVA 1XTKA 4PSAA 1J9GA 4N03A 4BUZA 1QYCA 5BSEA 3NVKI 3L40A 4I19A 4RSRA 4QOIA 3JD1A 2DUUA 4QDZA 3KKEA 3PTAA 3AHGA 2I4MA 1IJKA 3D64A 3KVYA 3WS7A 3BL5A 4DLZA 3IPRA 2V55B 1ILWA 1EHYA 4RV5A 4PCAA 3HBNA 3HPRA 4J0IA 4Q3DA 4M9XA 4TLCA 5IAOA 4F6LA 3ZV7A 2DKOA 1HM5A 3F78A 3LQ4A 1YASA 5M2QA 1SC1A 5AD1A 3V1KA 2Q8NA 5DNAA 3IDZA 2RGWA 3MWEB 3B2QA 3T4XA 1Q7EA 1WSWA 4R3UC 5MFZA 3Q3CA 3L7BA 5HQ3A 1NF3A 4RV4A 4PBSA 4KQXA 1SBCA 3NHRA 1L4BA 2HMAA 2YY7A 2BM9A 1F5NA 3OECA 4D0GA 3DOIA 2E18A 3VH2A 1JLLA 4Z8XA 2I7XA 4R0VA 1ZHFA 3ZDZB 3IE1A 4HLUC 4X1YB 2CRXA 1MJHA 2P91A 1TM5E 4WLFA 1EBFA 1I2BA 1Z16A 1E2UA 1KOFA 4CKZA 1JT2A 1JDBB 4B9SA 2VAWA 3AKDA 2W3RA 4R5MA 3HUEA 3UH0A 4KXXA 3AR9A 1FLAA 1PDOA 3RWOA 2CY0A 4YD1A 1M9NA 3K9LA 4HQNA 4HAWA 2XXBA 1WY7A 4I0WB 2PRIA 3C8ZA 4UB8U 2WPNA 3CG4A 3REOA 1T1GA 3ZI0A 5BVGA 3SKXA 1F9EA 4FNMA 2G76A 1ZCBA 1MB3A 1T29A 2OBMA 8ICCA 1DDGA 1XTTA 2AN4A 2N47A 3TLBA 5H0IA 3QPWA 1NUTA 2JLQA 1PGPA 3TE7A 2BSXA 1D9FA 2LRHA 3T5TA 1UOPA 4UHHA 2PD6A 3BGOS 1VE9A 4QBGB 2W4IA 3HA7A 5L1MA 2XQVA 3A0UA 1B8UA 1U94A 1FSSA 1K6XA 4MWBA 2H0QA 4BLTA 1M54A 4PYQA 4DLXA 4H08A 2G36A 3C3JA 3AUOA 4Z2AA 3HRDD 1X14A 4Q1VA 2A9JA 4A6PA 2HQSA 3VPXA 1GN9A 1WTAA 4PLPA 2VSYA 3P26A 3QVOA 1ZFNA 1HNXB 1GZ4A 2JA1A 1GRRA 3E9CA 4X7PA 2SNIE 2X2PA 5DRTA 2JGAA 4DRXA 5DISB 5BURA 1RADA 2HNBA 3H65A 3VOSA 1K6MA 3LVRE 4WT7A 1TCVA 3E61A 3M34A 1T5DX 1RJ9A 2C31A 1ZD3A 4J1TA 1WEHA 1H6BA 1X7ZB 1ONOA 1XF1A 4UUQA 5AKIA 3RTEA 1GPKA 4U2CA 4JNCA 1POXA 5CVTA 3T1TA 1U7DA 2HJGA 4D74A 3L8EA 4QJ4A 3SEQA 1U0HC 3T79A 3PPIA 2F4VB 1N63A 5F3DA 8MHTA 2F8MA 5FPYA 5A4KA 2KK0A 5DTEA 3LF1A 4YX9A 1LSJA 1QRRA 1WM1A 3U1TA 4AP9A 4IQUA 5LYYA 4QNRA 2SKDA 4NMLA 1XX6A 2QL6A 2WLSA 1E5TA 2PVCA 1QX4A 1MQAA 1RWNA 4YRSA 4B85A 1IZZA 5BVHB 1KBQA 4BFTA 4Q4JB 4JBLA 3LGAA 3FCSB 4L15A 2C95A 4DGSA 3GUYA 2EBFX 1M34E 3WVNA 1Q20A 2LIVA 4Z1OA 3PFHA 4QZAA 2Y93A 2CVZA 1OVMA 2JAHA 4Z5XA 3MRXA 1QQ5A 3N3BC 4EWLA 2I9KA 3T3DA 2O1WA 2PYDA 1EJ2A 1BG6A 4P92A 2F44A 4BRWA 3AEYA 4KVAA 2WSSA 4CM4A 3D2LA 2HKIA 1GLNA 5LZ7A 4PZDA 3QTLA 3VSEA 1CUDA 1F4PA 4EB0A 1IYZA 4DEVA 3MJVA 2AYXA 2XWSA 2QIPA 1NRJB 3U0BA 1RM5A 1GEEA 3WGLA 5H5JA 4CETA 4JXZA 3CINA 5I3CA 3MQ2A 1YB5A 1KRWA 5GM1A 4M83A 4ZEMA 1X94A 2DMRA 2WM3A 1LWOA 3O38A 3LQQA 3QFFA 4QODA 2B61A 3C3XA 5JO9A 3H4TA 3WLOA 1GAXA 5I7UA 1JR4A 5I5GA 3CWCA 3I9OA 4ZALA 5CHYA 2F3PA 5IANA 2WU1A 2IT1A 1RI4A 1XZQA 2BFEA 1D8BA 2DOKA 1G16A 3IHKA 3GRKA 3E7WA 3O2SB 2Q4TA 2KOBA 4W6QA 1IDN1 3QKSA 3D0KA 5GWXA 4JROA 4G1VA 5AIBA 2ZTDA 2W6JD 3W1EA 1IV8A 2O20A 3HWRA 3ZVRA 1EFHA 3QUAA 4Q1CA 4P58A 4IOLA 1RSZA 3NYWA 4F84A 4TMYA 3K5WA 4FUQA 5CRXA 3DLTA 1CIPA 8ICXA 2G1PA 5EZYA 2EKDA 1G2PA 4O1HA 3HGMA 3O82A 1RXUA 2VS1A 4TROA 2BI7A 1P7DA 3WU2U 3GMTA 5LB2A 3TADA 3K9WA 5JNSA 2HU7A 1O96A 5BW4A 2FZGA 1M2FA 1C81A 4ZREA 2E55A 4O33A 5AW9A 1FIUA 5ES4B 1ZC3A 2QI9F 2ZBVA 3OX2A 1EFTA 3KVOA 2A58A 1M0EA 3KX2A 1YQWA 5D00A 1E3WA 4UVDA 2IP2A 4BNWA 4Q82A 1W0KA 4CEHA 4R1PA 3PIDA 1KZ9A 1JMYA 4Q43A 2V03A 1XJWA 4PSDA 4F2RA 5AESA 4QVIA 3U0VA 2VTKA 4DA7A 4O3FA 4YDQA 3C1TA 3MCZA 4B35A 4RAQA 4AC9A 4DKXA 3QA9A 1PKEA 1WLSA 1AHIA 2WWVD 1LKYA 5H81A 2FWNA 2F3QA 5EERA 3WLFA 3QOYA 1BDIA 1Z83A 5JQGA 1R27A 4BFCA 4J8PA 4RKWA 2V7QA 5EZSA 4R40A 4GPD1 2ZTLA 3USCS 5KWSA 4AB1A 4K81B 3R41A 2WUWE 1U0BB 1G8MA 4YRCA 1QH1B 3WGNA 3VDMA 4MYHA 1N36B 3VV3A 2BE9A 1QSLA 4QJFB 2JLRA 2JCYA 2B1JA 5IJ0B 1RYZA 2DWCA 1O4WA 2QYSA 1ISPA 2QRKA 1WQ1R 3TIFA 2ZCUA 5K4HA 3JTEA 3DO5A 4UM9B 3UBTA 4QGSA 5FOUA 4AJ1A 4HAVA 3RNOA 1RWWA 4O59O 4YJFA 5E6SB 1EFPB 3VNAA 5DYNA 4YCNA 1E1LA 3E8MA 4BB9A 3BQTA 2RIPA 4EYIB 2UU9B 5JEEA 2HBQA 2P0EA 1KYIA 4AKGA 1RRCA 2HSWA 4PLYA 5AR1A 3UT0A 1RPJA 2AC2A 3HJRA 3NALA 2FEOA 4DF4A 3T4PA 1UMKA 3R3YA 2IOFA 2HRCA 5AK6A 2QN2A 3E18A 2BGJA 4N5NA 1IUKA 4DYVA 2XDQA 2RH4A 1JHUA 3DDZX 1YBHA 4OAQA 2BN4A 4MUAA 3WBFA 4J2OA 5B2EA 2RIRA 1SL2A 3QF7A 5IAJA 1XTQA 3UK7A 4DXDA 4D45A 4MP6A 2QTAA 2GFQA 2WYVA 4EFNA 3F6BX 4PONA 1B8NA 2ZE7A 1DJOA 1TO6A 3WYCA 2TMDA 4MQUA 1FEZA 2J3JA 4J16A 3IE0A 5I9TA 2DVMA 4ZTUB 1BOFA 1EFDN 1II9A 4OREX 4P81A 3WLSA 4ARIA 2XUAA 2HHXA 1MFPA 3VV2A 3FM9A 3KSDO 2K7ZA 1U2ZA 2GPJA 3DE4X 1FXSA 1QV9A 3WHPA 2QTWB 1XBTA 1BYIA 2ECQA 4QXQA 4I1VA 1W0CA 2DHRA 2K4HA 2FLVA 3HBLA 4KMOB 4EUNA 4CIAA 1PLJA 2ZANA 2GD6A 2P5SA 2ASLA 1LI4A 2B37A 5EKTA 4RAOA 5KC8A 5C8DA 3PR2B 2FMUA 5FJJA 2B4YA 1UBRS 3KB6A 4GD3Q 1WWVA 4ER6A 3ZC3A 4MDYA 1NYLA 2QQFA 3MRVA 2AXNA 3RRYA 3WIOA 2IIPA 4FBTA 3DHYA 1DOZA 4ZVMA 2X5XA 2CL7X 5DN6D 4U00A 5AKGA 3N28A 2X7JA 4PG4A 1ZJNA 2AI3A 3FNFA 4BFYA 1WLYA 4PX2A 3DZDA 2JBHA 2XVXA 1MVLA 1HFJA 3IDAA 5EWFA 4XWTA 2R5FA 4N9QA 3O0FA 3T7RA 2Q5OA 5CDSA 4NYMQ 4Z51A 1DDOA 1RHJA 1TC2A 1L8XA 3WWZA 1K5GA 4DB2A 4QPNA 5J5AA 1GKYA 4RA9A 5M7EA 3EYZA 2V4MA 2X3FA 2WJZB 3S44A 1F3LA 2H16A 4P3YA 2CGEA 4TUPA 1OWMA 5BV2P 1WF6A 1GGHA 1T9AA 3O21A 3AU8A 1R8JA 4AZWA 3UAXA 4M22A 2OCKA 1VE6A 1ZQWA 3NAMA 3NVYA 1AGNA 1BE0A 1H66A 5EXTA 2XDWA 3O4IA 1X2BA 1WXIA 3KQWA 3P19A 3JAKB 3NANA 1VL1A 4AD8A 5K8IA 1PVRA 1CQWA 4LXXA 3GDXA 4TV8B 1V38A 2B2NA 1E6CA 5PGMA 5GONB 8ICMA 2Q6LA 1UXOA 2W6ZA 2YXBA 1AA6A 4Y6LA 1E99A 4U0JA 1NVVQ 4RVUA 3K2EA 4TL8A 2TMGA 3DL7A 4EG8A 2HPHA 1CLUA 4RHEA 3NIFB 2HA6A 5JCPA 3TD2A 4W5RA 2AFIE 5KX5B 3Q7SA 2PAAA 2C92A 4NVRA 1WP4A 5K0ZA 1HGXA 1T2NA 4B7AA 4MW4A 3T5CA 3GX1A 4QUJA 4DANA 3VZRA 3MUOA 3LVFO 2E8MA 1ISHA 1JDJA 1ZM9A 4P5DA 4FYMA 3A4MA 5JZBA 1ZUIA 4E2FA 3BXPA 3CVUA 3W2EA 5G0TA 2QRJA 1Z28A 3G49A 4MCJA 1YR8A 4MRSA 1CYDA 2N1RA 5CXSA 2H2IA 1YS2X 1Z39A 5CFNA 3WLLA 3ZGLA 3QPVA 2LUOA 5JWOA 2J7KA 3DFZA 3TI0A 4RQ7A 4X1IA 3A9CA 4ED9A 4TRRA 2JFUA 4RLFA 2V6MA 3EXAA 3F1KA 3FRJA 1NHGA 3N75A 1L1QA 3SQMA 2G0TA 1LA2A 4AF7A 5BT9A 3EGXB 2BMWA 3PIRA 3BE6A 2WP0A 1BH2A 4ND8B 1MH1A 3VDRA 2GNAA 3LOUA 3DBIA 4D0SA 5BPCA 3GO4A 5DKWA 1HE5A 4L3VA 1J00A 4XFDA 4EJMA 4J9MA 4CPDA 4J0DA 2ZYUX 3SV3A 4YO7A 3GRRA 3DDWA 3QTTA 4UREA 2VF2A 3HBJA 3PVXA 3BFPA 3E15A 3PV8A 3D31A 5ITZB 3HKDB 2WPDA 4BX8A 5KT6A 2EJUA 1NI5A 1X1BA 1KEZA 2R8ZA 4EJ2A 1I1HA 3MBKA 3NBXX 3VDXA 3Q8XB 3WLMA 1ZJ5A 5EMKA 1WBJB 1PVPA 1M7HA 4WNYA 4Z0HO 2JH1A 4FHDA 1P6QA 5F4BA 3NT4A 1ZICA 4FEAA 5I9NA 5T5QA 1AQYA 3RNLA 5EJIA 1D4FA 5CM9C 3FBGA 3OOWA 1D8TA 2A9VA 4G97A 5I9MA 3EZFA 4Q7MB 3T3NA 1PFKA 1WABA 4CEJB 3K0AA 3ZE1B 5B7NA 3OWHA 1XMVA 3V7YA 3CR7A 3PUHA 5MGBA 1WZ2A 4XX0B 1G8SA 5L4NA 1Z34A 2W2KB 3VNSA 2VK4A 2JZBA 1TIBA 2QZSA 3PI7A 4YCXA 3KKNA 3NPMA 3QV1A 3WHLA 1MJNA 3MCWA 4EUFA 4P4SA 3HWWA 4RZIA 5DYIA 3D4NA 3FA2A 1I3MA 4YVZA 4X6UA 1E0SA 1WJGA 4TUSA 1C7QA 8LDHA 4B79A 4HKTA 2J8ZA 4TTQA 2Z58A 2FAXA 1T13A 2JCXA 3OCWA 1ECBA 4QRHA 3K0CC 3Q7PA 4WBNB 4BVKA 1SY7A 1AVTA 4QW8A 3C6MA 2GPBA 3KJEA 3OZXA 3WYNA 2M9MA 3N8KA 3P2OA 3K96A 2GASA 4EYOA 4QBIA 1H42A 2PA0A 2FUG6 3M4NA 1O58A 1E7YA 3UA3A 5EIFA 2RGNC 1EHCA 3RS9A 3PB3A 1YRLA 4KJZA 5L3VA 4DLRA 1U31A 3AI2A 3T7JA 4IHKA 1N2XA 5KZMB 3H5OA 2XCRB 4U7GA 3OHMA 2JLAA 3R0IA 2BLLA 2YQEA 4YJ3F 3JQ9A 4ISCA 4I1SA 4YP7A 1CYEA 5E6RA 3MGHA 1BVYF 4NI5A 3RAXA 4B3BA 4GRIA 1TU0A 3ITDA 1P8JA 4M6WA 4I4LA 2X9VA 3QE2A 4M0MA 1H9BA 3WE7A 1F5SA 2I2CA 2I22A 3GRYA 1W93A 1SC9A 2Y0CA 2EFJA 4ARZB 3WZMA 1F06A 4V0MA 2P3OA 4HXFB 4UEWA 4RVCA 3B78A 1KOLA 2VUHB 2XX3A 1BMDA 1II8B 4O2AF 3QEMB 3W9YA 3DAYA 1KBOA 2JIOA 3PE3A 1UIMA 4DMKA 2C00A 3LA6A 3Q10A 1MX9A 3LWNA 2XTNA 3MFIA 3PPVA 1LF5A 1PR2A 1HL3A 5CFQA 4HYYA 2MDTA 4UHCA 4DGQA 2F8KA 4BNMA 3PHHA 2YIMA 3KXIA 3OM8A 4MFFA 1D2GA 3FR8A 1DXSA 1R4ZA 4BGEA 1JDZA 4ZMSA 1DEAA 1JQDA 4DVJA 4DWWA 3RASA 1QKJA 3HB4X 3DA8A 4RVDA 4H9GA 9GPBA 1Z74A 1TF2A 2JK0A 2X15A 1MQSA 4M9CA 1KO4A 3RC2A 3QLVC 2MT9A 5GJBA 4QREA 3ZHVA 1GL3A 5BYKA 3NVDA 4M3NA 4QRDA 1ABBA 4PLCA 3OSPA 1G5FA 5G0UA 1C7JA 4H2DA 3FCUB 3ZUPA 4P4LA 3GP8A 2RGNA 4Y1RB 2I76A 1GPAA 2GAFA 2VAPA 3FDSA 2PSFA 5ITSA 2QY6A 3SQDA 4EEZA 2OBBA 4B4WA 3L84A 1AHNA 1ZI9A 2FPOA 2QRMA 1W6RA 4G8JA 4WECA 4H4CA 4NQRA 5I4IA 4QM6A 4GG1A 5BV0A 3CH4B 1M8PA 1ZWKA 2GD0A 1UJ4A 2OFPA 4JXJA 1IM4A 1Z4PX 2P2ZA 1SHTX 4G24A 4BS9A 2YV1A 2I55A 3F98A 5IU6A 4IRCA 1LK0A 4AO8A 1HEUA 2BVNA 1E7MA 4BGDA 2J31A 1I0IA 4OBXA 3OF5A 2PH7A 5F7JA 1MO2A 4U7DA 1SCUA 2ZJ2A 3OP4A 4IFIA 1J2RA 1CVIA 1NJ6A 1FFGA 4IG4A 4TWJA 2A0KA 2Q5IA 5KPDA 1IJFA 4RA6A 1GKKA 1QLWA 1GPWB 4BTEA 3H1PA 3GGJA 2YWEA 2Y1DA 4XVUA 1KTIA 1ZN2A 3AQ4A 3R9IA 5DDMA 4A5OA 2BZFA 1GNTA 3C98A 4QZFA 1T4CA 4KYVA 4BNVA 4PANA 2VTEA 1IIBA 3WMEA 5DCLA 2IEZA 1BQEA 3HY6A 1JI0A 1QE3A 4D6YA 3BIOA 5GIPE 1WDMA 1KE1A 2QP3A 3OLWA 2PGIA 2EDUA 2PZGA 4E1BA 1QMGA 2XBLA 5C4GB 4NMWA 1L2TA 3CM0A 3VKGA 3MS7A 1QHHA 1ZGAA 1T3NA 9ICKA 4W5QA 3FVQA 4BMPB 4M98A 1KEWA 1MRSA 3BB4A 2WUGA 3I9LA 4O3PA 4YI3A 1R5NA 2V4QA 3JQAA 4NENB 4GXNA 1FFXB 3GEBA 2AD5A 2ZPAA 2PT5A 5JWHA 2Z6QA 2ZW9A 3EULA 1T2VA 2IV2X 3ZH9B 5HKKD 5C46F 4CM7A 2QMQA 2CLKB 3B38A 3AB3A 1Z07A 2HGSA 5KFGA 3GBPA 4ZT4A 5KOJA 1XWIA 3TEJA 5LKAA 2C54A 3WL5A 4BN0A 2QAGA 4DNXA 1VSVA 3A2LA 1VQ1A 1DOQA 2IHMA 4BX9A 4LHVA 1YB7A 4EEKA 1S0MA 1DG9A 4Y7CA 3BXHA 3O8BA 5D6OA 3CTPA 5D5QA 2IYZA 3U3KA 4CYMA 3ZW9A 1XSLA 1X8KA 2FR8A 4RXTA 2ACWA 2DPYA 5HMLA 2NT3A 2QV0A 2YYAA 3EXFB 5LLTA 2A9KA 5KOYA 2H5JA 4EMUA 3LUJA 1V6SA 4DCJA 2YVQA 5IT4A 3T1YB 4WXPA 4OXKA 5DCUA 1QLJA 4JJ8A 1KKLA 2PXAA 4B6SA 2ZAMA 5EPEA 3QVSA 3I8OA 4HH1A 4FC6A 3KQHA 2ZYSA 2QHXA 4MGHA 4ZU1X 2NTNA 2QI9C 2M1ZA 3CNLA 3ILVA 1JI3A 3UN1A 2X9QA 3HBMA 2PFGA 1KTVA 3SC2A 5I4BA 1RPTA 4B1FA 4D9EA 2JAWA 1SXJC 4OA8A 4Q03A 1E2HA 3LOQA 2PRKA 3GLFB 3FMPB 4JYZA 3QPAA 3ETEA 1UZUA 5LQSA 3FNEA 3IJ5A 1ZQMA 3ENKA 4ELTA 2QORA 3OTOB 3Q1KA 3UFXB 4PHTA 3E2EA 4ZCMA 1Y1KE 3VHLB 2M6RA 1SB8A 5F78A 2ZI4A 1UBGA 2C5AA 1P3Y1 2RGBA 1R2QA 2NU8A 1AN0A 5AFSA 2A9QA 1I94B 2R97A 3SHVA 2REQA 3GVIA 3FBWA 3A32A 5J2HA 3AP2A 5C53B 2G3YA 1Z6PA 4EHHA 4G0YA 4WOPA 4N8DA 1GRVA 5I9LA 3N8IA 3MM4A 2ACEA 3WMWA 1X1SA 1Z7BA 3PQ3A 1ZRSA 5AQEA 3WJ7A 2F00A 3S3TA 1DPGA 2ST1A 5TB5A 4WNIA 4FCTA 5AI6A 2O59A 3IV7A 2O0KA 2ZZKA 2YWBA 1IU9A 4W1SA 4GBJA 2A19A 4CBVA 1R4AA 3BMOA 1J2TA 1ESEA 4FMPA 1L5UA 5IZCC 4AJNA 4NEGA 4FEGA 4DL5A 4IV0A 2V9PA 4MQEA 4CLOB 1VCNA 2LPMA 3D6VA 2IUTA 1HDGO 2XBUA 4RSHA 4BRZA 4GXQA 1S10A 5G5GA 1DUVG 5CCXA 5IBCA 1KZGB 2NT4A 3W3AD 1MU0A 3W1WA 3TI7A 1HIWA 2PV0A 1GAEO 1K0UA 1SOAA 2VP5A 4PSUA 4TRMA 4Y2TA 5KVQA 1JR3D 4CF7A 4EYHB 1L1EA 3U7QB 2NQ2C 1U9YA 1EFCA 2PK3A 1R6AA 4ECWA 3G5MA 3MWDB 4AF8A 1I30A 4KBGA 2F55A 3TACB 2C9CA 2W2LD 4KLHA 1PJ2A 3H9GA 5IFKA 1E7RA 5AI5A 1U0TA 4HF7A 1OYYA 4Q3OA 1C30A 2DTEA 3JZMA 2DUMA 1A8IA 4B8YA 1P0MA 1QRSA 4BUCA 4EZBA 2E4WA 2BGRA 3AVTA 3FCOA 1OH7A 4NAUA 4R63A 4D9KA 2YICA 3V9AA 3A14A 4RGBA 1XZ8A 1YVUA 2ZIAA 3I2YX 1W52X 1E6UA 3W9UA 1K63A 3UJ9A 4NXZA 3MPUA 4ZT7A 2FHSA 1SPXA 1RQGA 2Y27A 3GN2A 4MGIR 4MROA 2K2QB 3KOWA 9LDBA 1MX5A 3SGLA 2WNSA 5BR4A 3RRGA 2HLPA 3AQIA 1NXPA 4C2UA 4P7JA 3MSXA 4JP5A 3O7WA 1Q1ZA 4TKUA 4YMUA 2GNOA 4FSHA 2IYVA 1GTVA 5CITA 1MW9X 4C20A 4F91B 1AZLA 2AOTB 3IAS1 2QQ0A 4P32A 4J9KA 1UFRA 4E3ZA 1V4VA 3ABOB 4JVMA 3R24A 2HCBA 5I7FA 2JBWA 3UICA 1MO5A 4DE5A 4BO0A 3AEUB 5FRDA 3PX4A 2OESA 2P78A 4N5IX 1XROA 1HNNA 2BPGA 2CLEB 4LOAA 3TQQA 5FTJA 2G9UA 3H8JA 3C6YA 4JZKA 3FMVA 1E89A 3SX2A 4DY4A 2AE2A 3T4UA 4Y2HA 3IXLA 1ND6A 1XCBA 4WZZA 1PNOA 2C4NA 1SUSA 4YCAA 3BWBA 4YP3A 4R1MA 2ATXA 4O5EA 1J39A 3MR2A 4J0KA 2J41A 4IQVA 1IBKB 3MGIA 5DQHA 2K6GA 3GQBA 4BNXA 1JHYA 1V95A 1Q11A 1XLWA 1E9EA 3ADKA 3OJ0A 1Y8RA 2WUVA 4YMGA 2JIQA 4I5EA 4WBXC 3ABQB 1K7YA 3LUCA 1OLUB 5GZ6A 1NFRA 2AEEA 1E64A 4OSEA 4B4UA 4CV2A 3VR1A 2IY8A 3KL2A 4PGAA 3IQZA 1JHAA 2UZ1A 4F8YA 2PI4A 5I9IA 4EZIA 5E7QA 3UC5A 2HDHA 3RYTC 4GRDA 5D87A 1L5FA 1M75A 4DFMA 3CZRA 4BB0A 5BMVF 3OBBA 5CB4B 3QX8A 1FFDA 4RJKA 3IKVA 1W581 2Q1WA 1D04A 4N01A 1E3JA 1B22A 5CNKA 1CRZA 1D2MA 2I4NA 1VL2A 4CR6A 1UBTS 1FX1A 1YQGA 1XRPA 1XZPA 1T8YA 4Z0TA 9ICCA 3VYWA 2OHOA 5K3FA 4WXHA 2FRDC 3MGAA 3FY4A 2OZVA 1YZHA 2XYPA 1T6ZA 2JANA 5SV2A 1EH5A 1JBQA 4CCSA 4PZ9A 3CVOA 5KYYA 2RHDA 5KREA 2RBGA 4I4CA 2PUFA 1BPZA 3CHYA 1D6MA 3ITEA 3IXQA 1NZPA 5JI3E 1JWAB 3EPPA 5JTTA 3LPNA 1GSAA 3TZCA 4AXXA 2MSNA 1GNLA 4DUZB 1B2RA 1U7OA 5D8DA 5TNXA 5EE3A 2LKCA 1OTYA 1GU0A 4P2GA 3EVFA 4JV1A 5KTKA 3HNOA 4KN7A 3IO5A 2X6QA 4XVCA 4MUIA 2QMEA 3I42A 4YRAA 2OA0A 1D2CA 1DMRA 4IZ6A 4B9EA 1HYGA 3FFAA 4FS1A 2EQYA 4K3VA 4RLQA 2XD9A 2VP4A 3SMQA 5KCZA 1YR2A 5F98A 4OHRA 4KDRA 3EUEA 2VAXA 4HNAB 4IMJB 2FN9A 3SHQA 4EQZA 4J49A 3ZWXA 3UJ8A 3WK7A 3TCXB 2DFTA 1UCFA 3JD3A 1Y7TA 1KKXA 2DPLA 5LN1A 1UAYA 4H4DA 3ASZA 3W2HA 4AULA 4MQ6A 3UT6A 5CDUA 3V4OA 1FUUA 4D4HA 2EDAA 2WJVA 3SFVA 1QCKA 1TQDA 1FE8A 3NDIA 3I39X 5B2ZA 4BHTA 1JLSA 1RFLA 1JDPA 5JWRA 5SYNA 3RYCB 1Z22A 1Y9JA 4DIUA 4HUQB 5AKHA 4MUEA 5HJ2A 2FOIA 1EX1A 3K1YA 4A8JA 3DVSX 3HXTA 4WZBA 4XB1A 5ENZA 1Z4IA 4UKDA 1X9HA 1X7YA 3S2FA 4IJMA 4LBZA 1RWKA 1UFVA 3S1AA 1PWEA 1B93A 1FO4A 1FLNA 3SX4A 1ZQOA 3N5KA 4IJ5A 2OBYA 4RTMA 1L5QA 4E2WA 5IXJA 2BT4A 2EANA 4B6RA 4DQRA 1FQKA 3UQYS 3GI1A 2VA2A 1CUEA 1RNLA 3TE6A 2OZLB 1E8MA 3ESAA 2GSWA 5AW3A 4GLOA 2CUKA 3QY9A 1H2BA 5CCBA 3MJHA 1G3RA 1N4AA 4NJEA 4NJMB 3DDNA 3H7AA 4CM5A 3LZ6A 2PFPA 3BE8A 1U80A 4YXMA 2X58A 4KQKA 1SIBE 3JQGB 3QIAA 2C9YA 4UZEA 3L06A 3R6LA 4RTSA 3H9CA 3V42A 3C3WA 4I3FA 2J0SA 1AU9A 1N8TA 4L51A 3FB4A 4O4HA 2HWUA 3FPHA 3R1IA 3ES9A 1ZO8A 4MJLA 1DRUA 3K70D 5JMTA 2AL7A 2VDNB 1H1LB 4O4IB 3ZCSA 1ZGJA 3RVOA 4BAZA 1WX1A 3OZCA 2C7PA 4M1TA 1V39A 3SYRA 2O8BB 4F6RB 3STVA 2VAVA 1RZVA 1FRQA 1ZA2A 2DU8A 2OWDA 1WXGA 4BVLA 1BJKA 2R8GA 3FVWA 2WF8A 1BPEA 4U2FA 3A1DA 2RD2A 1Q1AA 1P0FA 4IDQA 5EE9A 3ZIAA 3WLHA 1GGEA 4UAVA 1AE1A 1CQJA 3URMA 3TECE 3KFVA 1MGPA 1V48A 3SJ7A 1U2EA 3A4NA 1L4LA 5KYTA 1OZHA 3D0QA 1Y0BA 4MYDA 1Z5WA 3ZZTA 2COKA 3T6KA 2H2GA 1VBMA 4OMDA 4X24A 3BXOA 4HNSA 2X41A 1QFMA 1DG3A 2Q3MA 4HDKA 1FMCA 3Q2OA 5AM2A 2D59A 1KR5A 2ZIVA 3HUUA 2AZDA 2ICAA 4LY6A 4YXWA 5DTIA 2HCTA 4MO9A 2W8BA 3FJ1A 2WIGA 3S1SA 4RKYA 1KVTA 2NRXA 3F96A 1U0JA 2XHEA 1U9IC 2A86A 3A70A 3FWYA 1RC1A 1X40A 1JIKA 3IP5A 1PNVA 2NTEA 4HDQB 2IYFA 2PSJA 3HNPA 4HB3A 1EM8B 1VHLA 3EWAA 2ZRIA 5E1BA 3O4JA 1F2VA 2KSOB 4D3XA 1JJAA