4GIOA

Crystal structure of campylobacter jejuni cj0090
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
b'QNTVILGSNLPKSLVKQFQKRINSNGYLEFEVILRSTFAKDVIYKVDWLDKDGFVLRDVLNEDYQALRIPAGQEVILRKLASDTRANDFRLEIKAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of the Campylobacter jejuni Cj0090 protein reveals a novel variant of the immunoglobulin fold among bacterial lipoproteins.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Unknown function
total genus 15
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07233 DUF1425 Protein of unknown function (DUF1425)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gioA00
3O0LA 4GIOA
chains in the Genus database with same CATH superfamily
4YQXH 4MKTA 2XA8L 3QDGB 5IW6A 1IAIL 1TQTA 4ABWA 3ECUA 3OKYA 4BFJA 1TZAA 4ZFGL 5EZOH 3HC3H 1D9KC 1PAMA 3QRLA 1U8LA 1IC7L 4GI9A 3L7EA 3T3PF 4B9GA 7FABL 1Z32X 5CJQL 1DLFL 4PRIB 4G71B 5C6TH 3RDJA 5I1KH 3VDAA 3UL4A 1CFSB 2DQHH 3MJGX 4HDIB 4ZSOE 5I74C 4AQ8C 3FQNA 4IBSA 1P84J 3DX4A 5TDPB 1MWAL 2HG0A 3BC9A 1P9MC 4QRQB 3WG7B 1MFDL 4Z3GA 1UWEH 3UEZA 4PJ8D 1NIDA 1CR9H 5GGSY 3UAEA 2CUIA 3AS2A 3F7KA 3RWFB 1VCAA 5TQ0H 3GI8H 4QRAA 1S9VA 2YC1A 1UJTA 2DDQL 3P3TA 1KCBA 4TVPH 1UURA 5IB2A 1ET7A 4GO8A 5JXEA 2BSRA 4JW3A 5F1OB 4G7VH 2Q3AA 3LQAH 2BW5A 4LOVA 2SEBA 4ZUTB 1LDPL 3L1FA 5FM4A 4FQ2H 2OTWA 4L4VE 4AGQA 4ZMQA 4S1SH 2FQEA 3Q9QA 1HXMB 1RZQA 3ARDC 3GBEA 3VSTA 1UH4A 3GSXB 5C0AB 5C08B 1FYTB 2C3XA 1XD0A 3HC4L 5EUOB 1HXYA 3O9WA 4WFHD 4P4KB 5IQOA 3CCHA 3QO1A 4MCYB 5GS0C 3ULVE 3OKLA 5D1XD 3EJQA 1S9YB 3OJMB 4L3EA 3NGBC 4DUXA 1ET8A 3LKOA 4YDLB 1LYQA 1J1XL 5KYWA 4U1LB 3K5RA 1DEEA 2W60B 2G5UA 3KPMB 4LHUD 4G6AD 2J8UF 1WCBA 4M1CC 3L3JA 4Q0XL 1IBGH 5GRYA 5IV2B 3ZDYE 2BFVL 4BA0A 3EF7A 4WK4B 1WZ1H 4PBDA 1FBIL 3L3KB 2H3NA 2JKNA 2MSPA 2VSKB 3TESA 5GIRA 1R19A 1X4XA 1YLBB 2RCSL 1IAMA 2ATAA 3BKYL 1DDHA 1XCXA 3HS0B 1JZJA 4RIRA 2L7JA 3IE4A 3VFSA 5F7UA 1RZFH 2FATH 3D07A 4YGAB 4OKVA 5C0DB 5C9KA 2H2SD 1UZ8B 1K5WA 4XP1L 3SJVA 4Y4HC 3V7AG 2BH0A 4MD4A 2ADIB 5AAWA 3CLEH 2PW1B 1S3KL 1TEFA 3B1TA 4R0LA 4ZW8A 5D2LB 2CBMA 2GEEA 3OSKA 3VUAA 5C0RL 3HZYB 3V4PA 1P7KA 2BX5A 2WO3B 4L0PB 2WLLB 4GNKB 1EVUA 2DQFA 4LU5L 3ECBB 1W6WA 4UOW0 3V4UL 1ROWA 4ZOAA 1TJMA 2P43B 5F7KC 4DKEL 1QWNA 4IRJC 1Y6MR 8PAZA 4Q9CA 4GSDH 2NQCA 1JWSB 4JANA 3BWSA 1FFPA 4QNPF 1CBJA 1CICA 1AR1B 4OCXH 3ELAT 4DQOH 5DJZB 4XBPA 1FN4B 4Y7MA 3NRPA 1JZHA 1DCLA 4HC1H 3HUJE 1SDAB 1A6VL 3WSQL 1MCWW 1SY6L 2LTQC 4NKDA 5ESQB 4EZLA 3VG0L 1I7UB 1Q9LB 2GJ6A 4KROC 3IJ7A 2VQ1B 4XHJD 5E4OA 1B0IA 3G5VA 2DMHA 2K4WA 3IXTB 4PJBB 4XNXL 1NTDA 3QDMD 4LASL 2L8AA 5T5NF 4U7KA 3ZJAA 4U6TA 2D3JA 1HZKA 3BVWA 4XO9A 3WN5B 4N0UE 1F3JB 3CDGA 3LH9A 4A63A 3MX0B 5CN3A 2BY2A 3V6ZB 1YYML 4POYA 2DWXA 1DBJL 3G5ZA 3SDYL 3EKCA 4Y1AE 4YUEL 4E9RA 4ZG1A 2XRAL 5H37A 4PGEB 4TQIA 3L2NA 3MLTB 4XMZA 5G55A 1FYTE 2A6JB 3BP5B 3QPQD 5DZJA 5EUOE 4MNQB 4NQCB 1S78C 4Z7QE 1U8IA 2DBLH 2GY7B 4X98B 2DM7A 5CGTA 4LLDA 2J25A 3HCVB 4K3HA 4NS0A 4P46B 2VZUA 3VFTB 2AXJA 3TTSA 1XIWA 2AXFA 3GMOB 1LMKA 3TN0D 4WJ5A 1MN4A 2BW4A 1OSPH 2OSXA 3UTSB 1AQKL 1RK1A 2NQ3A 3B2UC 3VW3L 1CGSH 3C08L 1KV7A 2A9NH 3NPZB 4FXTA 2ZWKA 5DHVH 1BSIA 1QATA 1T0MA 4NRZB 4RMSA 3S4SG 3UX9B 2CNYA 4HCRL 1L9RA 2F74B 1YEFL 9PCYA 4NHUB 2K7QA 3HR5A 4H20H 3U4BL 2O61A 3UO1H 4LSQL 4KKCD 5HGAA 2E6JA 5BMFH 3VXTA 3WLBA 3FC8A 2F5BL 4NZJA 3ZL2A 1H6UA 1Y1UA 1NDGA 2VTFA 2C9AA 4ZQKB 3T0EC 2VLKB 1FCGA 3REVB 5E2VH 4YHOL 4I13B 1J5DA 1FL3B 2VXQA 4L8BA 1RZGB 2QVTA 1ZVYA 2F19H 5CIPA 5ALBL 1LO0L 5DMGD 4ZODA 2OSLA 4MJ6A 5DD0H 3DYMA 4CGTA 2LE9A 2XG4B 3D85D 4J7RA 1LP9B 3QQDA 2NW3B 2BIOA 5MENB 1ZA3A 5I73C 3WTTA 3PWUB 2YK1L 2J7LA 1PGRB 1GYVA 2WXQA 5DK3A 3FMGL 2JIXB 3RTQC 4EO5A 4XNMB 2J5WA 1AZRA 1N0XH 4G7RB 1VZHA 1TT6A 4QWWD 2Q8AH 1JZ5A 1QRNA 4KTGA 3LRSB 5A40E 3F83A 3UBFA 2HJFB 3GMQA 2E7DA 3IN0A 4XE0A 4YNYB 5AB9A 5T33L 1F4WL 4HMDA 4MWFA 1PKQA 4MCNA 1TZIB 4XVTH 5BZDB 5DSCA 1RVFL 1OM3L 4Y2OA 4DGWC 4U2ZA 5ICYB 1JF1B 2Q3ZA 1IGML 3REWA 3QDJA 4FG6D 4AEEA 2Q9OA 2YMXH 4EE2A 1CDBA 5G5DB 3QR2A 4APQC 1FO0A 4PJ5D 4AJYV 4FQLL 1G7MB 1KY6A 2AK1L 32C2A 3O6LL 3IF1B 3OR6A 5I2IB 2WWMD 4GT0A 3O3DB 5DDHB 5F1KC 4HQQH 1JPST 2UWEF 5AW9B 3DJ9A 5HGBA 1I7RA 1RUPL 2VZSA 3TBWB 4D0BA 2RTTA 1N0LA 4LGSB 1C5CL 3X1FA 5SX4I 2E5EA 3RJQB 1CI5A 2QBWA 1UENA 4NQDD 3MGOB 4B41A 4B5EA 2E7HA 5CFHA 3A6BH 4OFYD 1AKPA 2JE8A 4NQCE 4HEMA 4P48A 2VWEE 1E9QA 4M03A 4PJIB 3UDWC 4MHHG 2O5YH 5BNXD 2QPUA 2OR7A 4O5LH 2AJ3A 4UTAA 4Z78A 2IIJA 2CBOA 2AP2A 3GJFH 2BIHA 4OZGF 3UTSE 1WJ3A 1ND0A 4JQVC 5K33A 4UI2A 2NY0D 3FQXB 1E40A 4S0HA 1DFBL 5H35A 2ZUYA 4PFEA 2R29L 2FQFA 1MCJA 1IC4L 2AJVH 1EV2E 2F54E 3SCMD 2DQCL 1KGYE 4ZS6D 4HC1A 2BP0A 1JL8A 1I8IA 2KUTA 2UVEA 1I4FA 4C56D 2AJSH 1XF2B 1KJ2H 1KIPB 1U8HB 5E1QA 2E75C 3S36H 5ABAA 4JN1H 3RUGB 3SSGA 3ROOA 1CG9B 2FLBT 3F6IA 3LB6C 5D96C 4ADIA 5A7EA 3RPBA 3GRWH 2MHAA 5GS0H 5LBSA 3BVVA 3BSZH 1C7TA 3VXSE 3IDGA 4K5OA 5JNYA 3KL3A 3CFBB 1R3HA 1IGIH 1QPPA 3P3YA 4OGYL 3ULUD 3HZ3A 1RURH 3HMXH 1F8TL 3TU6A 4QXUH 3MKKA 3NCEB 4TNEA 1NA8A 4IIQC 3ZZSA 4Z7WA 1ZGLP 3T65A 3C8HA 4JM4L 4ZQTA 2DM2A 1JHLL 4I1NB 4KKAD 3P0YL 4PG9A 1EAQA 3VCLB 2R4RL 2X2YA 1GC1L 2QADB 3FT0A 3HS0C 5IHUH 1MXGA 3GMLB 3QO0B 4XC1L 2XWZA 4FD0A 4G9DB 5J6SA 5CGMA 2CO7B 3ZT6A 4LNRA 3C6LD 5CZVH 1I9RL 4I89A 1MIEH 2BSDA 2Z7UA 3NESA 1HHIB 1P5UB 1SDYA 4BXVA 2XWDA 3QQ9D 4FTVD 5FKPA 4J8RB 2I7OA 4JEGB 4OKDA 3VXNA 1NIEA 3UJJH 3ECVA 2UV3A 1YJDL 1AGBA 1ZA6B 3FO9B 3EOBA 4WZ9A 3U0PB 3TEZA 1SM3H 4JFZL 4AXWB 5I71B 3IJEB 1ZGLB 1J8HB 2KI6A 4JMNA 2Q86B 1H8OA 2KERA 5AVZB 1AR1C 3CFJA 4ELMB 1SF3A 3ZLQC 3QP3A 5JPMB 3F05A 1MUJB 2HKHH 5GGUB 2BSTA 2WQWA 4FA8A 3HMWL 5BVJA 5CCKH 3W9DA 1RP9A 4L8DA 5B38A 5HJ3B 2O5XL 1TJIL 1FDLL 1N67A 2ZX6A 3NJJA 4JZOB 3B6SB 3NCYS 3DVGA 2XWXA 4N2EA 3V55A 4HLJA 1IQDB 1EH9A 4JO8A 4JFDA 4PJ9D 2RQEA 1F6AB 2JKTM 3WN5C 5BS0B 2DRUA 1LDSA 4I3SH 5IESH 1SEQL 4YHLL 5ILTH 5JUEL 5E94B 4XMKH 4HIIA 5FYLD 4F8PA 2XN2A 1U58A 5DC9B 5ADPL 4KK5D 2X2HA 3NFPA 1UUNA 3KHQA 5SV4A 5IGXH 2FDBP 1XEUA 2K9FB 1CF8L 2CE6A 2DWDB 2Q5BA 1K6QL 4Q6IA 2FEDD 4U3SB 1HEHC 2ZOLB 1RH8A 3O6FC 3NZSA 3QUZD 5IZ7A 3UBXB 2QKIC 4P46C 2W9EH 4L3AA 5D2LF 2A9AA 5HHOB 2WOYA 2PR4H 5BUGA 3O4OC 5I1LB 3VFGL 1LO5B 1CE6B 2B1AL 1YQ2A 5IOKA 5JHLL 5KSVB 3WIHL 1ASPA 2XZAL 3BGMB 4L4TD 1NCTA 1BQLH 2ORBH 4D0CA 1YN7B 2BC4B 5F96H 5GRVK 2LAGB 4B9CA 1KB9J 1T7VA 5DC2A 4YXLH 2F1AA 5KYXA 2VMFA 2QKSA 1HL8A 3GJFA 5DMIL 1A7NL 3MJ7B 4KQ4H 4RMVA 1QSVA 3U9PL 4CC4A 3TO2B 4P2OB 1BQSA 3D4ZA 3MOAL 3ZHLA 5JIMA 1XF1A 3C5ZD 1NCBL 4RCAA 3BEWA 1BPVA 1EAPB 1QLFA 3IBEA 1ZHNA 3BZFB 5T1KD 1TMQA 3ZR6A 2R2BB 2ZF9A 3VFUA 4YDIH 5EBWB 3JXAA 3UTZA 3QHTC 1TCMA 5KVMC 3JTSB 2ZUTA 4MAYD 1JGEA 1M3IA 2PW2A 4W6XB 5C2UB 4ODSL 4F33B 2X0UA 3WJLA 1U2CA 1X7SA 3RL2B 4P3CL 1YMMD 3D39D 2OA9A 3GT6A 2EUZA 3B7SA 4NENB 1FG9C 2OQJA 2E7CA 4ELME 1DVZA 1UHVA 1E30A 1QPKA 3BSZA 3JV4B 4AENB 3WTXA 2OJZH 3EHBD 3G6JB 2CO3A 3US1A 3VFWA 4G5ZL 3FU3A 2DQDH 1KPVB 1XGUA 2Y4SA 4CJ1A 1BBDH 3HMXA 1NSNL 1D6VH 4CC0A 3CXDL 3HFMH 2R0WH 4ZFFA 2D7NA 4M62H 1MIML 1YNKL 5L6YH 4ORGA 1L0PA 3L5XL 4W6YB 4WKXA 3WELA 4JJHA 4XPGL 4NWTL 2HUEA 2X10A 4L1TA 4D9QE 2P5EE 3WFDH 1U8LB 4HK3J 3DRQA 1MVFA 3L7EB 4HUMB 4LPUA 3BH4A 1WAAA 3P40A 5EOCL 3BRGC 1D6EB 4XN4A 1OGTA 4MQ7B 2E8ZA 1HSBA 2XYBA 2ZNWA 2JFCA 3EFOA 5A3IC 2APVA 4JDVA 1QP1A 1GOFA 2XV3A 1LO2L 1SHMA 5DGRA 2WB1A 3BPNC 1U3HA 1WFNA 1JWUA 1U30A 4RFOH 4XPHL 3VD7A 1OHZA 3QRFM 3ZHFA 1E2ZA 4R5TA 1I1AD 3KXFA 3R18A 5L88H 4FQXB 1S9VB 4XXWA 3WGVB 1LP9F 3EUDA 1MREL 2YD0A 1S9KC 5IB2B 1HZLA 4NUGH 3CSPA 1UASA 2BSRB 1RP8A 2QV2A 3VTAA 4TS6A 1RD6A 2DM3A 3BH9A 5DVPA 2SEBB 1NINA 2ICWA 1G4RA 1ULVA 4MMXA 1NEUA 2AQNA 1HILA 3MHZA 1ZS8B 4I9WD 5C07A 5JOPE 5I23A 4GW1A 4NOFA 4X8JB 5TD4A 3OKLB 4XNDA 4L3EB 4XOAA 3LZPA 1BIIA 4Y2DA 1HEZB 5AKVA 3W3BA 4EI5A 5C0IA 3RVVC 2HZHA 2EKSB 3S88L 3Q6GH 3D9AL 1JWMA 3FF8A 5KVFE 2AV1A 3BFQG 4MD5B 5LO7A 3NPSB 4QJ5B 1E4HA 4KUZL 3GXMA 2I26N 4U1NA 3VACA 5MERA 1KXTB 3A67L 2RB8A 4GUCA 4CVXA 2RA1A 4OKVB 3QARA 3OL2A 4IHBA 4F5CA 4HGMA 4PJIF 3SJVB 1O0VA 5CSBA 4UT6L 5F6IC 3RY4A 3L3OC 5B3SB 2XA8H 4ZNCD 1F02I 1DVSA 3G6JE 1IAIH 1T22A 3P2BA 4MD4B 4R97C 2K8MA 3ESPA 4XBEL 3QYCA 5CLZA 1AKJB 1UOWA 3WENA 2Z31A 4ZFGH 1E5ZA 1XSOA 1WT5A 1T0PB 1IC7H 2ATPB 2QADC 2WV3A 2Y1YA 4R0LB 4F9LA 7FABH 2GFBB 4AH2A 5CJQH 3B5GA 1DLFH 4YSTA 3V4PB 2GBTA 2I5YL 3E6FA 4N2NA 3VWJC 2DQFB 1HQRA 4PJAA 1IFHL 4D3CL 4YAQA 5AB0A 3TJPA 4H1LA 1T7WA 1MWAH 4UOZA 1MFDH 2ZKYA 4JANB 2GB2A 2BIMA 3QJQB 1BXAA 3E80A 3GGWA 4S1DD 3EYFA 1GZQA 1NCOA 4U0QB 1SN0A 3S48A 4C54A 4CC1A 3C60D 4NC1E 2GJ6B 4NO0B 4QHMA 2DDQH 3RUGF 5I71C 4P2AA 1JN6A 1X4YA 3FONA 3HG3A 4TUOA 4MJHA 1IV8A 3SDCC 3VA2C 1D5ZA 1G6VK 2A9CA 1PCSA 2GBUA 1OVZA 4E5XA 4RMWA 2GJZA 3AACA 3EAKA 1SJMA 5CILL 1LDPH 1IIIA 5JPMC 2FNWA 1MEXL 2R0ZL 3CDGB 3I6GA 4Z3JA 1G7LB 4GSQA 5GS1C 4U7SA 1G84A 2R2EB 3D2UA 3HC4H 3IKKA 4GRLD 5EIIA 2WVUA 3FUFA 3MZGB 5CR1A 1IKFL 3VWKD 2L7EA 3RBGA 4HV8B 3JTTA 5CJXC 1O5PA 4ZW6A 4BFIA 2W9LA 2MNJB 1XL4A 5ETUB 1MCLA 4DKDC 1J1XH 5LGJA 1TTBA 4DP1X 3FB7B 4NO2A 2I60L 4FA7B 3HE6D 4Q0XH 1OSYA 3JUZA 3GMNA 3E8VA 4LLDB 2BFVH 3AREC 4L3EE 4PJXB 4ANUA 1FVEA 4HZLA 1FBIH 3W82A 4U6VL 3I9GL 1A8JH 3BGAA 5CEXA 4WJ5B 3APFA 1R3LB 3ZL1A 2RCSH 2X4SA 1RK1B 2M26A 3BKYH 4JM2D 4WK0B 1ZLVK 2DYRB 3DIDA 3RPIB 1HOEA 4EI6B 3P3SA 1GC1C 1T0MB 3ET9F 2E76C 1S7UA 4ENED 4XP1H 3QI9D 4GKSA 4Q8BA 4ZYKB 4FXKA 1UA3A 1D2OA 4EN3B 2XKSA 4IDJL 4O02L 4MZIA 4W4NA 4DFHA 2NXZD 3LKNB 2HVJA 1JZ3A 1RZ8A 1JZIA 2IGLA 3SJVE 1U95A 1NCUA 2EDDA 2A74C 5C0RH 1KTLA 4N2GA 4D9RE 4IW4C 2K4AA 3B37A 1XZ0B 1YJDC 5FO7A 4F9PC 1L0XA 4LU5H 1M2OA 4JFWA 3V4UH 3RZCB 4PRAB 5HDBB 4DKEH 4OJAA 5CIPB 1RK0A 2K3HA 2OSLB 4MJ6B 3KVQA 4MAZA 2OMBA 4HF5L 3MRMA 4JRYD 3QAQA 2GEQA 1T4KA 4KKZA 4NQXB 4U4IA 1XAKA 1TSRA 1A6VH 3WSQH 4KXZI 1SY6H 1A9EB 4BINA 1YYLL 3GRGA 3O81A 1P4IL 1KTBA 1BZOA 4ODUA 4HJEA 1L7IL 3GMQB 2HWZL 3VFVA 3QR1A 3QG6B 4MWFB 4XNXH 1PKQB 1MRCL 1NBYA 2WLZA 2KHAA 4LASH 4HFUL 3NEXA 5DSCB 2GJ6E 4Y2OB 5E6IB 4EAEA 5ACMA 1XT5A 4TTGA 3CNKA 2YXMA 4E68A 3QDJB 4NP9A 5ANMA 3I6LE 1NCAL 1KNOB 2OX5A 3VX1A 1YYMH 3JYCA 4LKXA 1QZ1A 1DBJH 1XXDC 3SDYH 4KH9A 1IZJA 4YUEH 3WMQA 3MBEA 1RSFA 1E5UI 4NRXB 2XRAH 5F7FA 5HGBB 1I7RB 1IM3B 5EO9A 2MJWA 1N0LB 3H0TA 3DGDA 3RAJH 2XWRA 4AMWA 1Z1WA 1GPOL 4B50A 2OBGA 4HKXA 5DFAA 1U8NA 1CN4A 5D1QD 4IIQA 4FFZA 4RX4D 3HAEB 2AEOA 3FQWA 2APTA 1VENA 1QMUA 2DMGA 4ZXBA 3MYJA 3TYFA 1ID2A 4LCVA 4O02B 1AQKH 3VW3H 3HG1A 2PP7A 3PWPA 3C08H 3WAJA 4FTDA 6PCYA 1HX0A 3IGAB 2R8SL 1FL6A 3U2JA 4Z77A 2Y36L 1GZPB 3BO8A 3DVNB 4HCRH 2ICWJ 4N0CC 3T8XA 5CLWA 2CDEB 1YEFH 1L0YA 2OLDA 4G7SB 4WDIA 4LO9A 4G9FD 4Y4KA 3U4BH 4LSQH 3U48A 2AJYL 5KSBB 2DKMA 2VR9A 5JA8B 1BM7A 2D9QB 4JRXD 4JX0A 4BCXA 1IE5A 2H6PA 2F5BH 2UZXA 1W2KT 4HKJA 1DO6A 4WJKB 4JKWA 1KLUA 4QRUA 2Z1PA 1HCVA 4FQXC 4YHOH 1ZTXL 2ENSA 2HTLD 2VL4A 2YAPA 1MLCB 3F58L 5ALBH 1LO0H 4UM8B 1I4FB 4IGBB 3KBFA 4DGUA 4PRHD 4XMXA 3S3SA 3FO2B 3FHEA 1ZJAA 1Y18B 2HA1A 1LEIB 2YK1H 3KEHA 2WBJD 3M8OL 4W9FC 1CE1H 3FMGH 3CSTA 2EUXA 3IDGB 1NGWB 1V7ML 2GCYA 3TA3C 4TSBL 4MDIB 5T33H 1JYXA 1CIDA 4QLRA 1F4WH 2UY6B 4PJHB 3N55A 4AIOA 5D1ZA 2FIKA 3T71A 4Z7OE 2OW7A 1YN6B 1RVFH 1OM3H 4MBRA 5C7XL 2WBXA 3KPRD 1KENL 1GW6A 1CYWA 1QRNE 4QHNB 3HZMA 2PABA 2ZCKL 1J05B 1JGDB 1PKQE 2BVQA 3AGWA 5F7HA 4FQLH 2AK1H 5IQ9A 4F2FA 3O6LH 4BIKA 3BX7C 3NPSC 1XGTA 4PG9B 1JZEA 1RUPH 1UA7A 3KCPA 1QSEA 3MRNB 3QDJE 4PTTB 3IU3A 3WS6A 4CVZA 5HD8C 1C5CH 2WMPB 4RGND 3O6ML 3EZ8A 4PJ7F 1SLWA 1YZZA 4ANVA 4PLJC 5MHSE 3OD3A 1R3KA 1JERA 1UGNA 1XH1A 2CBPA 2I69A 3NFNB 3SE6A 2QHLA 2H9GA 3DARA 3HB3D 4OLWL 4UANA 2QLVB 3F84A 2XTJB 1OPOA 5K59F 4EDWL 1Z9NA 5B1JA 1OGAA 3GC3A 1Z3GL 5GISL 5FKPB 4YDVB 3CXFA 1VFAB 4WHCA 5C0GA 3W11C 2Y6TE 3DYPA 3GHPA 1ZY9A 4RISL 2C7UA 4DPCX 3NZ8B 2EDTA 5I30L 1A7PL 5B1BB 4J3WA 4HEME 3OF6A 5C6WH 3LKRB 4HWZA 5AUMA 1JZ8A 1DFBH 2EE3A 1A8ZA 4H40A 2D9CA 3P4OA 4TVUA 4UDUA 3UPRA 1JZFA 3PRZA 4RMBA 2FNBA 5GGSA 2R29H 4F80A 1FRGL 1IC4H 4M3HA 4KTDL 2DQCH 4W9JC 5FV2A 2V8LA 2F2HA 5BVJB 3W9DB 4L8DB 3ZT7A 4FRWA 5DI8A 4R3SA 3NH7L 5E8DL 2XBTA 3JWNE 5IVNA 4E36A 3ASWA 4LAJH 4YZFF 4EUPG 2UX7A 3N40P 2OK0L 3ESVF 3WFHA 4JFDB 2VM4A 3CN1A 3BMVA 1F56A 1E4WL 1F2XK 4PGDA 2PNDA 1HAUA 4AUUA 3GSQB 4OGYH 1G43A 4APXA 1VB9A 3NFPB 1T66C 5BV7L 2Z7ZA 1F8TH 3ZDXF 4AEHL 2SODB 2AHIA 2CXGA 2ZP8A 3H9SB 4Q6IB 1OK0A 3A22A 1JGVL 3EBGA 4JM4H 1JHLH 4M4RB 3TO4C 2WLKA 3P0YH 2HX7A 3P4NB 3BWAA 4LLWB 4LF3A 2R4RH 4XBMA 3NACL 1GC1H 2X0VA 1QI5A 4Z7WE 2BDNL 2H41A 4PLOB 4XC1H 2GPZA 1Q90A 2MOVA 5F0JB 3B4NA 5I8EA 1EXGA 1E4KA 1UWFA 1I9RH 4MZRA 4BRVA 4EN3C 4DHLA 3OAYK 4HCRA 3GMRA 3KAAA 4GW4A 4NC2B 3TVMA 5IIEB 4CSZA 5AW5B 3V52L 2Y06L 4K3DL 4Q7DA 1YJDH 1AD0A 4B9JA 3QIBD 1PJWA 1Z5YD 2VAAB 4J23A 3U36A 3BYTA 4MVBC 1K5NA 4J8QA 1QLFB 4L0ZA 3WNIA 4JFZH 1ZHNB 5KJRL 5E0FA 3VFUB 1LLAA 3ISYA 1HL4A 3UTZB 4QAMB 4KKQA 1DQQA 4LCWA 2PW2B 5C0JB 1MI5A 1U9KA 4GQRA 2HLAA 4M6NL 1QUPA 1T1ZB 2YMTA 4U6HA 4WO4A 5LDUA 2KMWA 1PZ3A 2O93L 3HMWH 4KKRA 4Z5RA 1WHOA 2OQJB 3QVAA 3KWVA 3INUL 1TJIH 5E7FA 3WYRA 1NFDA 3I6KA 1FDLH 1MFAL 4ODXA 1UACL 4PJXF 4UMGA 3FAXA 5E6IC 1P53A 5BV7B 4PPTA 5IMLA 1NUNB 2ZKHL 1FP5A 4P2QD 1SEQH 3K72B 4YHLH 1RZKL 5JUEH 3S37X 1CDIA 1OCOB 2G3NA 4ORGB 3SBWC 4JFDE 5ADPH 2Z6FA 3DJSA 3NCFB 5FYKL 4AYFB 3M17B 1R34A 2VERN 3H1ZA 4YDJB 1CF8H 3PP4L 4QJ3B 2ZKXA 1K6QH 1BM3L 1BZ9A 4N0FA 5GGVY 4LDOB 1HSBB 2QV4A 1ZGLM 4TRPL 1G9NL 4JDVB 4W81A 3U83A 4ZFZA 3A47A 4X6BB 5EU6B 1IL1B 3THML 3BPLC 5A1AA 3RY6A 1FHNA 4Y5YC 1TPXB 1TUPA 3VFGH 3OGCB 4KWUA 3OZKA 1IBFA 2B1AH 2ZG1A 3W5NA 5JHLH 5HDBF 2I9TA 3WIHH 1JYNA 4B27A 2XZAH 3AABA 3HVDA 2Q6WB 3KXFB 5GRWA 5PAZA 2IADB 3VWJA 3S5YA 1OK8A 2B39A 4OJCA 3LZQA 5DMIH 2X4RA 2XVLA 4HIJB 1A7NH 3U9PH 5FF6B 1A6ZA 3T6XA 3AY4A 3ARBA 5D93C 5C7ZA 1DUYA 3RWHB 3MOAH 2ED9A 2MTPA 5I8CA 2ICWB 3F3HA 4JFPB 4MMXB 5E1AB 1JTPA 3TH4T 1NCBH 1QA9A 3LH8A 3C2SA 1QBML 1XF5B 2JH2A 2XZCL 1HILB 1KIUA 5BRZA 4M8RA 1WFTA 2GW5A 4GW1B 1XTLA 2XQYA 4GPVA 4IGBC 3BUDA 4JZJA 2E9JA 1SMAA 1Q1JL 4N90E 4NKIL 1OT2A 4AGOA 4Y2DB 3CH1B 4ODSH 5E99L 3ZKMD 4YMPA 4YBHA 3OHMB 4P3CH 4PREA 4IMLB 3VXOA 3N0PB 3DRTB 1WO2A 2OR8A 3NIDB 3O6KL 2DJMA 2AV1B 4KKPA 3DV6B 3NEOA 5K93A 3FTVA 2F1EA 5KVEL 5CZXD 4U1NB 1FZKB 2EABA 4B3VA 1GKEA 2HT3C 3E1ZA 4G5ZH 4CVXB 4Y16D 1NSNH 2HVBA 1NJ9A 3CXDH 4OFPA 3F12A 3OZ9L 3MQIA 5DJ2B 2IAMB 1B6DA 2EDKA 3PP3H 1MIMH 2IANA 1YNKH 1T22B 2IXQA 2JI1A 4J6RL 4JY5L 4A2HA 4C83A 3L5XH 4U49A 1AZVA 1MQKL 4XPGH 4NWTH 3F65A 5DK2A 5A2CA 4P5TA 1I1FA 4G8IA 5EOCH 3GSUA 3UTTD 3FQ2A 1LK2B 5LB1A 4Q97A 1QLEB 4KQ3L 1NIBA 3MREA 5KSBF 2F7QA 3AM8C 2PPCA 3NUKA 3TZVD 2JJSC 3HG2A 4PRNA 4XB3A 4PGCA 4YAQB 2XTJC 3O2DA 1LO2H 3IJYA 1ZD6A 1WAAE 4XOCA 4PD4K 1KLGB 5IB4A 1OSZA 4GRWB 4NFBA 2GC4C 3BWZA 4WI2A 4TLSA 4XPHH 4QRPD 3MRJA 4HOZA 3S3DB 2A74A 1ZSDA 1SBBA 4ZO9A 5CM1A 3EYFB 1GZQB 4E0RA 3LMJL 5F7DB 5KSAB 3E2HC 3ZRCC 1T89A 3ARGB 3BP4A 1MREH 3K6SB 1JN6B 1U2HA 1RMFL 3F5WA 3FONB 5ES4B 1C7SA 3TV3L 2FIRT 5I17A 5LN8A 3KXFE 5F88A 5IM7B 4BFGA 3RL1B 2NY4C 2OFQA 4M29A 2ARJA 2KLTA 1V55B 3BVTA 1EO8L 4LXFA 5C3TA 2F7PA 3WKYA 4W1TA 4JQXC 3MLVL 1OAXL 4Z7UF 4ZOEA 4PJHF 3TCTA 1P2CA 3LZNA 3QUHA 1BQHB 1F42A 1KPRA 1DQTA 1W16A 3QIUD 3L4CA 4KRPD 3K5SA 3JTTB 3EXJA 2NTFA 4XX1E 4BFIB 5GZND 1WFUA 2VLRB 3GKZA 1XGPA 4Q14A 4WW2C 4A2LA 4HOMA 2H0JA 3G04A 5C07E 1NKGA 4NO2B 3VQ2C 2D3LA 4PBXA 4KJYA 3S88H 2P5WD 2XIBA 3D9AH 4OAWB 3U4EA 1RHHB 3F7PC 5L7XL 2FEJA 2X4TA 4HZLB 3QG7H 3EJYD 3H4FA 4KUZH 2X53A 5CEXB 1HSAB 3DPBB 5L8JB 1U8OA 3A67H 3GM8A 5EZIL 3UADA 4G8GA 2ESVA 4OIFA 3X13B 4W9EC 1AGDA 3DV4B 5C09E 2ROXA 5D7JA 1S7UB 3MBWA 2BOBB 2FUTA 1X5JA 1Q0YL 4OLZL 2W80C 4H8HA 2ZYSA 2W91A 5G4MA 4XBEH 3KCWA 1ITBB 2YAHA 4B7LA 1TTCA 5C0BD 4F5CE 1IFGA 3MODH 1U95B 1NFAA 1JIBA 6CGTA 4CW1A 4UQ2A 4OZIA 2EO7A 1GKOA 2I5YH 1Y1DA 2FB4L 4WWKA 3D0LA 3OJDB 5CD5C 4KNSA 4JVWA 3WUWB 4D3CH 3B7TA 4YK4C 4R83A 4QHLA 3PGDA 3DX1A 2XXGA 4YFEA 3RGVA 3C8KA 3CVHL 4AGLA 1T4KB 1Y6NR 2ZOUA 4MA3B 4PJAE 1HFUA 5FO8B 3II2A 2KZWA 4UQCA 2YD1A 4IIZA 4PW4A 4XRCB 1ZHLB 4ZRGA 3OR7B 3BVNB 4ONOA 2UZYB 4XXCA 4XZ4A 3V5HA 2ZYIA 3LRHA 5LCVA 3T0EE 3OC5A 2NNFA 3FRPG 1I1RA 3I02B 1MPAL 5MEPA 4NJ9L 4RAHA 1Q4NX 4K3GA 1Q72L 5CILH 2YQGA 1XMEB 2Y69B 1JI1A 1MEXH 2R0ZH 3W0WA 5ANMB 1JSYA 3U1SL 3ZVVA 4YXKL 2YN3A 1HWGB 4LZKA 3ZIMA 4JPWL 5JMRA 2BM3A 4HALA 4LKXB 2Z0UA 4IK6A 3RNKB 1IKFH 3E9UA 4Q9RL 3GM0A 5KBMA 3VXUE 3MBEB 3KPNA 4FXLA 5DLLA 1FI8C 1UKSA 5EO9B 3FUEA 5BO0D 5FB8A 4V1DB 4MD0B 1X4ZA 2VKXA 2ICCA 3QT2A 4JQIL 3O3AB 2KLRA 1MQ8A 4OFVA 2I60H 5BV7C 2FH6A 4ODWA 3EJTA 4Q4EA 5ELIA 3TASA 1L0QA 3VXQA 4HKXB 4NXKA 2HUHA 2G5BA 3RWDA 2KYIA 3NSXA 4MB5A 3UYPA 3O0LA 4U6VH 3I9GH 3N40F 4X7CC 5IKCB 4NZUL 3R19A 3MYJB 3TYFB 3MA9L 1DUZB 4LESA 5C0CA 2DLTA 4GSXA 3TBSA 4EZMA 4JKLA 1N6QL 1IGTA 3QORB 4Z77B 1XCQB 3IMUA 3T8XB 4K71B 1X5IA 1W91A 4IDJH 4QRSA 4O02H 3SYCA 4PR5A 4LRNL 3F7VA 1PMYA 3PJSB 3QB7C 3AG4B 1HNGA 1BJ8A 1UQSA 2X6VA 1QVOA 2UZXB 5IQMA 3CFIC 4HKJB 4NZRL 4N8UA 3WGUB 3CSGA 4QRUB 2XQBL 3FUHA 3L4TA 3OTTA 2P8LB 1G6RA 1N3NB 1UVQA 2Y7NA 1OAQL 3NIFB 3UTQB 2RD0A 1IKNA 4KHTL 3BW9A 2YZ8A 4HF5H 2XWEA 5K69A 3L13A 2BSED 5K1VA 3WNPA 2FD6L 2V33A 4WU7A 2OZ4A 3DBXA 3L4XA 1C16A 3RFZB 3RU8L 1YYLH 1NGXB 1P4IH 2NYYC 4OUOA 3CFNA 4LP4A 2J43A 1A6WL 1OCWL 2GCYB 1L7IH 1EBAA 5D4JA 5J6GA 1S7TB 2HWZH 3S8WA 4RAVA 4ZMYA 1MRCH 1PZ5A 4HFUH 5DRWA 4L1SA 4WEBL 2CCWA 1KZYA 1J0ZA 1YY8B 2WXFA 5DHXB 3IAPA 4Q9BA 1IEBA 4AT6B 4BE5A 1ACZA 4CKVX 2GTZA 2ZE0A 4NO3A 1NCAH 5E7BA 2DMCA 4K5NA 3UG5A 1GTFA 5IQ9B 2YUXA 4IRZL 1F5WA 3DDGA 1G9EA 3E6HB 1XGTB 1RZKC 3V5KB 4OBSA 5CCHE 3O4LB 1QSEB 4CVZB 2VLLA 2XJLA 4HISA 4OF8A 5DRXA 2V37A 1AANA 3ATBA 3FJTA 3FPYA 4MS6A 1GPOH 3I9IA 2Y5TB 1TTFA 2JCCF 4DF9A 4L8SC 4U1MA 3MBXL 1DQLL 2IAMC 1AR2A 3ARFA 4KMTL 2WUBL 1M4KA 5FGBC 3A6OA 4OCSL 4F7MA 4UT6A 3ZKQD 4FX5A 5FUZL 4R7XA 3TP4A 1G9ML 3EO1B 2C7UB 4PWKA 3TT1L 2VO5A 2R8SH 5HHPB 3FN3A 2Y36H 1DVXA 3G3LA 4AITA 3GNML 2ITDA 2XWTA 2CK0L 4MQSB 4OD3L 2E9GA 5DYFA 2J6EL 3HG1E 3W5MA 3PWPE 1K4CA 4XCEA 5DFVC 1CZ8L 4OIIL 2V3DA 2AJYH 4K73A 1IE4A 2O5NA 3P4OB 3UPRB 3MV8A 3PDDA 1DSWA 4PP1D 4P99A 4JFVA 1OZUA 1T5WB 3LRLA 1WITA 5KSAC 3WY2A 1QBLL 2Q1EA 4IBUA 3UG4A 1ORSB 1D5MA 3M86A 2V8MA 3DHPA 1ZTXH 3DX3A 3U6XA 4LCUA 3ARGC 1T5KA 3VTTA 3F58H 4CGUB 2ZCHL 4NUQA 5I1HL 1FJ1A 4WEEA 3NIDF 3QXWA 5GS2H 2VR6A 2FSEA 1KDJA 4L2YA 3WTYA 5KSUA 3RWEA 3SDAD 3W1ZA 1DBBL 3M8OH 3WXVL 4GG6B 4WUUD 4UMSA 1PDKA 3QDMB 3NBNA 1U3NA 4PGDB 4YL4A 1V7MH 1HNYA 1VA9A 4TSBH 1DR9A 1HCYA 1PQZA 1Q1PA 4FXGB 3AY2A 1ZSHA 2XN9E 4I48A 4S1RL 5HP5A 4ONFL 4I0KA 3KLHD 2J88L 5C7XH 1KENH 1TYEB 3I2CL 4KZEL 3QJFA 5F1IA 2ZCKH 4EXKA 3Q06A 2GQHA 3STZA 4U6XB 2CG9X 3V95A 4AQEA 4WFFD 2V2WA 2WIMA 4OD2A 4HUWA 4JE4B 5SWSD 3BWAB 4I9XA 2CHXA 4LF3B 2MTAA 3IJSB 3V0HA 4LDCA 5CD3B 2WNXA 3V2AR 2AKRB 5KOMC 1ET5A 3EXLA 1CGWA 5K5YA 3OLEA 2M83A 4GRWF 4HJTA 1TVDA 1NQBA 4OB5L 4PVMA 2COQA 2ED8A 2QQLL 4OLWH 3RHWK 3BWUC 1PX8A 1T0OA 2BVPA 4EDWH 4AYID 3GMRB 2WLIA 2PETA 2Z35A 1Z3GH 5GISH 1O7DE 1KB3A 3BVUA 5FGCE 1NKRA 5JHAA 5EN3A 3DX6A 3MZTA 4IQHA 1UXSA 2Y7MA 2TAAA 2Z34A 2V0AA 4RISH 3RA7L 4Z3HA 5I30H 1D5XA 1A7PH 1G7QA 3FN9A 5KVDL 1OGAE 5I8KL 1UFGA 3NSCA 4X6DF 1W8NA 3QZMA 4X8XA 1UWXH 4N5ED 3HRZA 2JK5B 5AAPA 3L5IA 4LLQA 1E5CA 4NYLA 3S6CA 5AL8A 1QI3A 1EXUA 2BOLA 4DEUA 1MI5B 3TNNB 4NCC2 3GLAA 2HLAB 1FRGH 3U6XS 3W38A 1YUKB 4KTDH 4HYTB 3VE0A 3RLSA 2WKGA 4N8VA 3W9EB 4Z5RB 3FPXA 1Y6KR 1E4JA 1LNUA 1NZRA 3ZYZA 5E8DH 3NH7H 4AM0B 3I6KB 4CUCA 3G5YB 5AOKA 2XACC 2OYKA 4NPYB 4NOBA 2OK0H 1NC2B 2J44A 2KS0A 1D9KD 5I8OL 2HJKB 3MRGB 1QBBA 2CPCA 1PLAA 3DO7B 2NNRA 1MHPL 2CIIB 3AXIA 3IGFA 1E4WH 5I19L 5JHDD 3B8YA 1XB3A 4M7KL 1HI6B 1MF2L 3VFNA 4PJEB 1VAHA 3SDXA 2QSQA 5BV7H 4X7SL 4QYOB 4AEHH 3VH8A 4M8UA 2VR7A 4PJ5B 4KQ0A 2R56L 4JDEA 3ULUL 4BGLA 1JRHL 3FBQA 1XDTT 2C9XA 2XWJA 4FMVA 4N0FB 3CHXA 4XWGL 1JGVH 1DVUA 3BD4A 3LD8B 4N8CL 3FCSA 2DYPA 2HMIC 1WWBX 3DX0A 2J8OA 3IETA 3HE7B 3Q13A 3AADB 4NUJA 3ZKNC 1QACA 2AMGA 2GABA 2ZUXA 3LN5A 4XPTL 4LL4A 1KJMA 3KH4A 3NACH 2X6BA 2BDNH 4U1JB 3OXSA 5C71A 1ZLUH 4KH2A 2I9TB 3H2WA 4NEHB 1J10A 3SBRA 3QORC 3IWUA 2WPGA 4K71C 1QSFB 1FNLA 4DP6X 5T1JA 3ARDD 4W9IC 2X40A 4XN9A 1MJ8L 4M6OH 4XWOC 4JO1L 4FEMA 4FQJL 1BYOA 1A6ZB 3PNWB 3V52H 2Y06H 5HYJD 3K91A 4K3DH 5TQ2L 3TNMA 1PX3A 3PQYB 3CPLB 1MHHA 4JFQB 5KS9F 1PLCA 1KIUB 4G5AA 4PJ8C 5DEZA 4X7TB 1BPLB 4M1CD 4XVSL 5FW8A 5KJRH 5I16A 4D2NA 2NSQA 2NPLX 3D3VB 4EIUA 4L9LB 3S3CB 4NO5A 1IIKA 4HPOL 4TUJB 2B08A 2KPNA 2WN2A 4PB9L 5JW5B 2YSSA 1RUQL 3PIQA 1KXQA 4M6NH 4PREB 4XOBA 3H9HB 2YPLE 4JQXA 2QDVA 4URKA 3RFZC 1SXBA 2X4NA 3O3EA 4TNWF 3EZJB 3C5XA 1N59B 3SE9L 4LCWE 4Y4HD 3INUH 1MI5E 2L3BA 3L9EA 3RVUD 3OKDB 4Z3FA 2YRZA 5CJBA 2ZG3A 5BQDA 5FDWA 2I25N 1UACH 1XGRB 3BLKA 4WW2A 3KPLA 2OULB 2RH0A 3LZFL 2H47C 1JXFA 1NFDE 2ZKHH 5BCAA 3LQZB 3MOBL 4N1HB 1RZKH 4D8PA 1JK9A 2IXQB 3T1FA 3N1MC 4TUKL 5I6KA 3V6FB 5FYKH 5JXAL 5DK2B 2YFNA 3LRGA 5KAQF 5FYLL 2DLIA 3PP4H 3MRDA 3GSUB 2VLJD 4U0RC 3UEQA 1U4EA 2H2PC 2WO4A 1J9RA 1BM3H 4I4WA 1ORQB 5AKTA 3MREB 4KTEL 1A4KB 4TRPH 1TVBB 2GSIB 2MCPH 4H8QA 3NABL 2Y3NA 4KROD 3DK2A 3THMH 5IB4B 3NJNA 2H2SC 2HFFB 4NN5B 1NL0L 5EC1A 1TNMA 1OALA 2JKSA 3KLDA 5E8PB 1QFWL 1WQVT 4IJ3C 5ACZA 4KJQC 4W9HC 4CADB 1ZSDB 2EYSA 2DWTA 4E0RB 3BP7A 3NIFF 5D6DA 1S7QB 5ESAA 4PGBB 2XV6B 5J7CC 4FTVB 4WI6A 2CDFA 4P2CG 4GRWH 4OZ4A 2KZKA 4LMQI 3BP4B 3G7TA 3MCKA 3F5WB 4JK0D 3DTXB 5A43C 4LSVL 5FW7A 1OGSA 4XT1C 4GS7B 1CLOL 1X5GA 3HEIB 1QBMH 1S78D 2XZCH 1P2CB 4DGYL 1FVDA 3D33A 3LKQA 1KPRB 5T3XE 4BQ8A 3L4VA 4NKIH 1FNAA 1Q1JH 2NTFB 2XT1B 5E99H 1IAII 5BRZE 3B2UD 3G04B 3PL6A 3OBAA 1IBYA 3QJUB 3VYPA 2IWGA 4HSQA 2PR9A 4HS6B 5J12B 3T6QC 4MMYB 5CUSL 1WGVA 3U4EB 3O6KH 5FS5A 3QUXB 4NNYB 4Z0XB 3NCJL 1JOIA 5KVEH 1J87A 1FNSL 3QUMA 4JUSA 3S97C 4FXGC 2LU7A 3AUVA 4GYBA 1ACYL 4ZUWB 2IPUK 4G8GB 2ESVB 1WDAA 4Y19B 3SY0B 5D7JB 3MBWB 2WZ6A 3C12A 3OZ9H 1FFNB 2CDGA 5CP7A 1N5AB 4B6ZA 4WEMB 2NY2B 4IU2B 4J6RH 4JY5H 5DYOB 1S7VB 5ADOL 3GSWB 4Y2NA 1MQKH 3SOBL 1K3IA 1T0NB 4R90L 5JORB 1WGOA 4UILL 3W2DL 4UNUA 3ZQWA 1XCTB 3ABGA 2YGPA 1G9MC 2F53D 4XCNB 2IANE 5G4OA 3X14B 3GPSA 4XGZB 1CVSC 4XC3H 3F01A 4KQ3H 5DS8B 4WWKB 3TN0C 4JFED 1KCSL 4YPJA 3BZEA 2E74C 1ADWA 2VQTA 3RTQD 2NNXA 4QTHA 2J1WA 3DX9B 3NA4A 1LQBC 3IFOA 3AU1A 2G9HA 4LRIC 3VXRE 3AXHA 5SWQB 4X0KA 1NPJA 5D1ZI 4YWGL 2A2QT 1AXSA 3LMJH 3LZOA 2QVIA 1SMDA 3QEUA 4OUUB 3UBXG 1MFCL 4APQD 1RMFH 2WKOF 3V5HB 3U9WA 3TV3H 4CN6A 4UINL 4GG6F 1ZDQA 3GUFA 3ZW3A 4MTMA 2NCMA 2BRQA 5GSRB 4W4OC 1EO8H 2F6AA 3KPSA 5DMGC 3MLVH 5DFTA 2C9UA 1P84K 3W0WB 4DVRL 5AZUA 5I18L 1C8QA 5FGSA 2G9KA 3B9KA 4O2FB 1U8PA 5F9DC 4KKNA 4PVNA 2GBVA 1KBGL 3QDGD 5FGRA 3GB7A 4F92B 1YMMB 1IM9B 1WV7T 3KPNB 3BAIA 3D39B 4K3JL 5L2KE 2A6DA 1VIWA 4XMWA 1MCWM 2VXUL 4QWWC 4P06A 3N42B 2NDFA 4ODWB 1XXFC 3VXQB 2FBOJ 3FU7A 4PRID 5H2BA 3K8KA 5IHZA 3EHBB 1WCQA 5L7XH 3RWDB 2G5BB 3GPEA 2GT9B 4O2CA 3VU1A 4DKFL 3KE0A 5EZIH 2FJHA 2OR9L 2RJMA 1EZSA 3TBSB 1Q9KA 3AGVA 1E5BA 2W0PA 1IGTB 4QT5A 3N41B 1GS7A 1H5BA 4L18A 4OLZH 1Q0YH 1L9PA 3AS1A 2OMUA 3HS8A 4G8GE 1U93A 2ESVE 4MA8L 3HE7C 2EDHA 4N9GA 4WTZG 3JV5A 2ODHA 2DN7A 4L48A 4GXVL 1QVOB 4Q9QL 2NY6B 4H0HB 3G6AA 2EEFA 3H6AA 5DMKA 5TDNA 2FB4H 2X2IA 1P0SE 2CD0A 3U30B 1A4JA 2VCOA 1DJYA 4PVLA 4NQTA 4UM9D 3VXPA 5C2BL 5C0AD 1OD9A 1FYTD 1L9TA 1UVQB 5C08D 5F0PB 2ZKMX 1VERA 4MJIA 4R7VA 1E8ZA 4P4KD 2G30A 4OZIE 3BW9B 3PV6B 3LXBA 4GXFA 1AXTL 1OO2A 2BHZA 3CVHH 3POCA 4LP8A 3VXMA 4E41B 3DBXB 3CAFA 2MWCA 4PJ7E 5E9NA 1C16B 1HH6A 1LM8V 4M7LH 3WLWD 5ICZA 1KGXA 3IE9A 4DOHB 2WXOA 4HJ1A 5HPOA 1XSKA 2XLLA 2ZAHA 3ETTA 1M05B 4J2XA 3B2DC 2Y2TA 4NUPA 2ZUQB 4NJ9H 5EFIB 1Q72H 4M5TA 3GJEA 2R1WB 2ZXBA 2EH8L 3IVKA 3ZE2B 5FEBA 2GTZB 4PJEF 3U1SH 4AJ0A 3KS0H 4YXKH 1HHHA 4JPWH 4JHVA 3MNWB 1I1YA 1KSRA 2AANA 2IDSA 5DD6A 4B0MM 4Q9RH 4HIEA 1E5YA 1E90A 3PWLA 4N2KA 3RNQA 3W0WE 1HL5A 4JQIH 5I0XA 1ZEAL 3SKJL 2YBRA 5AFAA 3QA3B 3P02A 3ULUC 3O45A 1Z9SA 3ARFB 2W65A 1XF3A 4ODBD 4AC2A 4F7MB 1G7HA 3LH2L 4NZUH 5IBTL 1BEYH 3MA9H 4XAKD 5EBLB 3B5TA 2IBZX 3QQ4A 4YZFE 4LLVA 1AR1D 1E42A 1HU8A 4KKAC 5G4NA 5ALCL 4GQQA 1N6QH 3QPXL 3DX8A 3QUYB 1W0VA 5BZWA 1QR1B 5I6PA 5L9DL 2ITDB 1YO4A 4A2EA 5ID1A 1OD7A 1WZLA 2Z8VC 3GXDA 5C0CE 4IU3B 2K6YA 4XCEB 3S5LA 1M6OB 4TLUA 4G8AC 4LRNH 3KYNB 4NN5C 4NQEA 7PCYA 3F00A 4NZTL 1P7QB 3MV8B 1VZGA 2VUOA 1NLBL 4YBQC 3AWEA 2B14A 4NAJA 4ADJA 3QYMA 3ZDXE 2KDGA 3RI5K 3WNOA 2XQBH 2J71A 5B1AB 3VRJA 3IDXL 4QCIB 1AFVL 2WO2B 3G5XA 3PE9A 3OXRA 5C0FA 4GBXB 3NJHA 1OAQH 4JR9L 3IDIA 5JW3L 5AVXB 5IQLA 4KHTH 2YKLL 1O9ZA 5SWZA 3CHQA 3MO1B 4F37K 2EICA 4U1KA 5L0QB 3WU1A 4ETQA 1LL1A 2FD6H 3KPPA 4JJ5A 5DFWH 1EEQA 3RWEB 5BJTA 5K9QI 4MNQD 4NQCD 3DJTA 5EZJB 3RU8H 3MRQA 1R33A 1A6WH 1OCWH 1VCBC 2VJ0A 4WI5A 5T1LA 4F24A 5F71A 3EIFA 3EGSB 3GQFA 1PQZB 1ETZA 3MV9A 4P46D 3ULUF 4I48B 4WEBH 4ZPTA 1S8DA 3UTSD 4YHIB 1KBWA 5F1IB 2I07A 5JR1L 5J12C 3VGFA 2K1MA 1WTGT 4OGZA 4OW6A 3AAZA 1AZZC 4U1SA 3STZB 3VGEA 1RSYA 2V2WB 4OD2B 4URTB 4IRZH 1U8QA 2J5LB 3MA7A 3QUXC 4HUWB 2VDLB 4UDTA 3BISA 3UPCA 3WKQA 4P4RA 2VDNL 3ZE2E 2DWYA 4LNVA 3HE6B 3WCYA 2CM5A 4F8OA 3EFFA 1HL9A 4RWHA 4NGHL 4XCCL 3MMEA 3NP3A 1SXSA 1YEEH 3S35L 4U1GC 1E2VA 2VLKD 4N2FA 3MBXH 1DQLH 2CJTA 3DO4A 3QJXA 4KMTH 2WUBH 3MV7E 2BVPB 2NY2C 3SQRA 3Q6FB 4OCSH 4AG4L 1A1OB 3SBQA 3U9UA 1KTCA 1QRKA 5FUZH 4RSVA 1G9MH 3IBOA 2FEDC 4KV5F 1A6UL 3QZWA 1MSPA 1ZRUA 5A6LA 3BZ4A 3NCBB 3S3JA 1PEZA 3QUZC 2P46B 4IBZA 3TT1H 3HZKA 4ABUA 3AQZA 5E9DA 4A7GF 1QHOA 5MEND 3ZQXA 3D05A 2XKNB 2CK0H 4OD3H 2GUOA 2K45A 4L5FL 3K71A 3W39B 4HUXB 2J6EH 2JIXD 3ZY7A 4DT2A 1QW8A 1NANH 1X5YA 1CZ8H 1PJ9A 4YSPA 4LLQB 5EUKA 4NYLB 5E6UB 4EIZC 5D8JL 3PHQA 4R7NB 2DH3A 2EDXA 1EXUB 1IGYA 4I87A 4ZMXA 2HFEA 2R69A 5ISZA 2E6QA 5EZLB 3RIKA 1MJJB 3QHZH 2R51A 3RGHA 1FNFA 1HJCA 1QBLH 4G6FB 1OE2A 5IVZA 4HIHA 4PRPA 4KY1L 2OXHA 3D4GA 4RWYL 2ZCHH 2DLFL 2DEWX 3C5ZC 3ABZA 2DQ6A 3MGTA 5I1HH 2DD8L 4X4XB 2WUCL 3Q1EA 5DTFB 5KEZA 3DVFA 1Q0EA 1Z3RA 3LHPL 2EH7L 2VMEA 2BNQA 3IT8D 4UWQB 1DBBH 3WXVH 4KBPA 3QR0A 2APFA 2XX0A 1FL5B 5T3ZL 1J9TA 4HX1B 5A3ID 1JGUL 2VDMB 1XH3B 1QOKA 4OZHA 1LD9A 4G59C 4FKHA 3UBHA 3UBXI 4S1RH 1JXJA 4ONFH 1F11A 1WUZA 2J88H 2VDNB 4PJDF 1AQDA 1ECZA 1QW9A 4WENB 5CU5A 4F57L 4JDEB 3I2CH 4Y7OC 4KZEH 4MGXA 4AQ1A 3ALWA 4BZ2A 2XWJB 4O51A 5D1XA 2C3HA 3EHBC 2AQRA 2E6PA 2DYPB 2PXYA 3SO3B 1ZXKA 3ME0B 3S2AA 1AGEA 2AERT 3PWNA 1QEWB 3C9NA 1OQXA 4LHUA 1M1SA 4E9QA 1MAJA 3OXSB 1FFQA 5AOIA 3V9CA 1QSZA 2IALB 4NM4L 3AWGA 4Y0GA 4OB5H 1MCKA 4HWBA 1ZXQA 2QFPA 1E7VA 2QQLH 4HH8A 3IAQA 3KPOB 3NA9L 4MRBA 3VO0A 3K3QA 5LGKA 3DHJA 5CBAB 3D25A 4IM8A 1F97A 4KRNA 3V0VB 4BFNA 3RA7H 3KPQA 1OAYL 5AZEL 3DIFA 3RX5A 4G9FB 4MS8D 2PPAA 5KVDH 1NBVL 4PUBL 3HAEG 5I8KH 5ITBL 1G1CA 5GS3A 4R7DB 1UYWL 4F7KA 5ECJE 1JBJA 4JHBA 4R7LA 5E00A 3I9AA 1CMOA 1X6NA 1YPZB 3PYCA 2YSSB 3PIQB 3Q8AA 1O6SA 3CBKB 1FNGA 3A24A 4PCTA 2AABL 1ODAA 3QISA 4GOSA 4WCYL 4AJVA 4MAUL 3HIZA 4MNHA 4UM9B 2WQVA 5F3BB 5E5LA 2VIRA 2ZUQC 5FDWB 5DVLA 4K7PX 2IBZY 1J7VR 1VPOL 3KPLB 3OQ3B 5I8OH 2QADD 3KYMA 2XFGB 4FLHA 1P1ZB 3CX5J 5JPNC 1EHKB 1MHPH 4XBGA 4D8PB 5I19H 5DUML 3UH8A 5D2NB 1MF2H 3T1FB 3U82B 3FYEB 3N41F 3FSVA 4X4MA 2AEQL 2XETA 4X7SH 2V2TB 4FFWD 4N0YL 3U4KA 2GI7A 3RWGB 2R56H 4M93C 3OKNA 3ULUH 2QJDA 1LO3L 4M61B 1JRHH 3KDMA 4XWGH 1CD1A 4Z7UE 2DI7A 1HWHB 4OD1L 3SDXE 3JYBA 4N8CH 1ASQA 4HXAL 3RIAF 4WF7A 5I1GH 3ZHDA 3MNVA 2K7PA 4XNBA 4YJZL 1Y0LA 4Y88A 5EBMA 1P4LA 4LEXL 1E27B 5D7EA 2D7TL 4LCIL 5EC1B 4XPTH 4ZS7L 1J8HD 4R4BB 1SJEA 5ACZB 1J5CA 2Q76A 2CMRH 2EYSB 3QUYC 5ESAB 2V7NA 3N44B 4Y9BA 2XPYA 5DO8A 1R5VB 4FE9A 2H8PB 2CDFB 2R4SL 1MJ8H 3QWRA 3QWOB 4JO1H 3GUTB 1JPGA 4G1EB 5DEFA 4FQJH 4J3UA 4NUMA 2CGRL 4XVOA 1B3JA 3GXIA 1CXKA 1XCWA 1UB6B 4NM8L 4TOYL 3BUIA 2G2RA 5DJXB 1RQ5A 3MRPB 2CK2A 1UD8A 2NXYB 1B4RA 1AI1L 1FVDB 1WBZA 2C1PA 2YXFA 3FKUS 4Y4FA 5ITFB 4MMZA 4XVSH 5BS0D 5JMOC 4S1DC 3X3FL 1D7CA 3CFMA 1ZPUA 5I0WA 4GBXC 3M1BA 2PYFA 1RUKL 2ZCLL 4PB9H 5L0QC 1KB9K 1LQSR 1RUQH 2YGNA 3O11B 3BQUB 2BHUA 3M07A 4JPSA 3RZWA 4DOHE 2BPBA 2P24A 2YOAA 4DCQA 1KJVA 3FU8A 4XPFL 1N8ZA 3SE9H 3FTZA 4JY4A 2IFGA 1NUDA 5CJOL 2P1YA 3TBCA 4MJJA 1KXQE 4QY8B 5F9JA 4F7EA 3QZPA 4AV4A 2MCG1 5HHOD 4A2FA 3ZDZB 5DJCA 3LPFA 5I66B 4GRLC 3C09B 2QQKL 3LZFH 2NR6C 4OR1A 3BCFA 4ZDHA 1YUHA 2Z1KA 5JQHC 3MOBH 3CFEA 4XVUD 3VFPA 1FZMA 1ZHKB 2HAZA 2X42A 4NPJA 5CP7B 3SQBA 4DVBA 4LBEA 5HJGA 1CK0L 2J5LC 1UJ3C 1FNEB 3PAYA 4TUKH 2I9LA 4PP2A 5EH1A 3HE6C 4W9CC 5JXAH 5FYLH 3UAJA 4X0NA 3S96A 1RHFA 1RL1A 4Q89A 1NDMA 4P2OD 4XHQA 2ILLA 4KTEH 1CUOA 3O2VL 4JM2C 4NBXB 4RSYA 1NL0H 4NQDA 8FABA 3KL5A 5DHYB 1SBSL 1QFWH 1SN2A 2NYZA 2R7EB 4PTUA 3D69B 4X0KB 3FFCB 3O8XA 1FFTB 4JZNA 3SGJA 1RJYB 2YD3A 1M2VA 1T1WB 4POUB 3QEUB 4HLZH 3QJOA 1KB5A 4GKOA 4QOKB 4WFED 5JO5A 4ZD3L 3UZQB 2KQMA 3HHSA 3D1MC 5F97E 4J1UA 4J4PA 2YLHA 5E1GA 5T5FL 4BDVB 5M94B 4LSVH 2B1HL 3BPCA 4MXQD 4LIQL 3V4VB 4J28A 1GGBL 1RIVL 1YNTA 5CEZL 2Q7NA 4DK5A 1A7BA 1CLOH 3KPSB 1BWMA 1MFBH 2AMUA 4NSKB 1MCDA 2BCKA 1GW0A 4DGYH 1BD2E 3B9KB 5AVTB 3ZZQA 4EZKA 1JF6A 4JKMA 5IB5B 4F7TA 4XE5B 2X9YA 1KEML 3SCMA 5HTSA 2A6DB 2C3WA 2VLME 3BLPX 3VD3A 3NIGF 4BQ9A 3T3MB 4EVNB 1H3XA 5IB3A 2H6UA 3LRKA 3DWTA 1E5AA 5CUSH 4IHOA 5H2BB 3IDJB 5HJBA 4FGMA 1QASA 2X5PA 2MNUA 5SV3A 2VJXA 3NCJH 1REIA 3UTPE 1FNSH 3RY5A 1WG3A 3GMPB 1ACYH 3H7BA 4GEJA 4NQVB 1I53A 4P2QB 4JM2F 5ICUA 3LV3B 1Q9KB 1NC4B 1KC5L 4J3TA 1AE6L 4QT5B 1H5BB 1NAMB 4Z7VA 5D5MA 1Z9OA 3JWOL 4XB7A 1TJHL 2HPOA 4QKTA 3WO4C 5ADOH 1OW0C 2DI9A 4XB8A 3SOBH 4R90H 1JV2A 4UILH 3SODB 3W2DH 1O7SA 2XYCA 5JXED 4FFYA 4DNLA 3PDOA 3G6AB 4AKPA 5DMKB 5TDNB 4YHML 4RZKA 1CURA 1KCSH 3DDFA 4G6JL 4WW1A 1A4JB 1YYCA 2XPZA 1NCWL 3VXPB 1W72L 4KX9A 5I6LA 2FO4B 2EYTA 1AC0A 1YCSA 4KFZC 1NGYA 3VFRB 3TC9A 3GBLA 4JFOB 1LE5B 3VXMB 3TCXA 3WNJA 3C6LA 5ECGA 4L3ED 1VF5C 2ICEA 3ISRA 4K7PY 1JV5A 1KOAA 4X4ZA 5HYQB 2FYYA 3X1BA 3EH5B 3GXUB 3SEPA 1MFCH 1KTKE 2X3CA 4TNFA 2JCCE 1QEXA 4FCHA 5IR1B 4MYWB 4F58L 3TWCL 5BOJA 4U3HA 1CFTB 2BZCA 4UINH 3LSOB 4NKOA 2P3YA 2WLMA 4A6YA 1RZJL 3FTYA 1E67A 3UZVA 2HTLC 3HS9A 3IEAA 3IVKB 1CO1A 4DVRH 4BSVA 5I18H 1MZZA 2BVYA 3VI4A 4U1IB 3SJVD 4GH7B 4MJ4A 2WNKA 1I1YB 4G6KH 1KBGH 5DD6B 1VDGA 2EC9T 2YPVL 3CFUA 4CNIA 4HIEB 4K3JH 2CKBA 5JIIA 3PWLB 3QIWA 3RNQB 1CYGA 1AKJD 1IILE 1TXKA 1I7TA 2VXUH 3W11D 4UB0L 2AK4A 2WN3A 3SE4A 4OJDH 2JVUA 2C9PA 2DKSA 3JUYA 5D7LE 2GVYA 3MR9B 4BGDA 4YE4L 5DWUL 2W65B 4HPYL 5D2NC 4DKFH 3QQ3B 4Y16B 4PJ9A 1G7HB 4YHPA 3APNA 2OR9H 4M7ZC 4LLVB 1Q38A 3GSRA 1XBDA 1YVLA 2CQVA 3V0DA 4B9IA 1W0VB 3SKOA 2GITB 3EDFA 1RZPA 3DI2B 5HVWA 1BJ1J 5L4JA 1Q9OA 2GJ6D 4MA8H 4NO0D 5MI0B 2IGTA 3UTTB 4CU6A 3SPHA 4GXVH 3FFOA 3E3QC 3MDJA 4HT1L 3HB3C 4PW9A 4YSSA 5A16A 4JPIA 3T4YA 5HGHA 3ATEA 3GJFK 1MCFA 4DGIL 2WLHA 5C2BH 1YPZF 4P3DA 5I5RA 3VRLF 4V11A 5CP3A 4RNRA 4Y5XA 1B2WL 2CRIA 3RIFK 3G5WA 5C0FB 4L4TA 4PWIA 2EDEA 4UUJB 1AXTH 4U1KB 1T66D 1EX0A 2CLZA 5D9SB 3FDWA 4JJ5B 4PS7A 5BJTB 4MJIE 4YGVB 3VXME 1DJXA 2QQQA 4XO8A 1LHZA 4HJSA 5FK9B 5IQNA 3MV9B 1ETZB 3BZDA 5AD0A 4KI5E 3S36X 1B6UA 2BRRL 3MLZL 2D7QA 3UOAB 4UQ3B 2BNRA 1DSFL 2EH8H 3BQUC 5T1KA 5KYNA 3LVEA 4WHYG 4I0PB 4XO3A 3ARRA 4HIQA 3AQYA 4MAYA 5HDWA 3IDNA 1AQ8A 2UY7B 2F1BA 2WXLA 3MA7B 4ODVH 4X6DE 4UDTB 4EN3D 4P4RB 2CHDA 3QEQA 1G7IA 1J18A 2FJUB 1Z9PA 5I1KL 3MMEB 4GAAA 1TU2B 1BQHG 1U8CA 3GMMA 2OCCB 1HDMA 1ZEAH 2IH8A 2WXKA 2C5DC 2JWYA 3SKJH 5EEXA 1IZKA 2NY3B 4PSRA 4Y5VC 3M1CA 3M6DA 4KOCA 3J07A 4MVBD 3NQIA 5GPRA 1UWEL 3Q8BA 3VQ1C 4XNYL 3RZCD 1AG0A 3U9UB 2Q20A 4WKZB 3LH2H 4X4KA 9CGTA 5FHAL 1I9EA 3N44F 5JLZB 1A47A 3QZWB 2C9SA 3J2PA 3RFRA 3VGHA 1UXWB 5ICXA 3IJHA 4E42A 5L2JA 1IAKA 4YHYB 3UAFA 5B22A 5ALCH 5E9DB 3QPXH 5FHBL 4L4VA 5L9DH 2O4EA 5E4AA 4K8RD 2M1KA 5LHDA 3HI5L 2IH3B 1L9MA 2P52A 4NZTH 4YSOA 2N3JA 2ENPA 1NLBH 5ISZB 3MLUL 2FLMA 4KO5A 2IBBA 3RDTA 1E8YA 2BS8A 2UUDK 5E6ID 4NQEE 4HKBA 3CPUA 1WZKA 4HIHB 5GGRY 3T2NL 3VRIA 3ZE1B 3QDJD 4PRPB 1MFNA 3CZLA 3IDXH 2VSCA 1AFVH 1CJYA 1PZ2A 2EJ1A 2VW6A 4JR9H 5SX5K 3QIBC 5EF0A 1XO8A 5JW3H 2D8KA 1I1AA 2YKLH 3NDYE 3MGTB 5C1MB 1IM3D 1ZVSA 3WUWG 3GSVA 2VE6B 4LGRB 2EP6A 2XNAB 1I85C 1BX2A 5K9KB 4LLYA 1DHKA 5DZAA 3ZDZF 5HHMB 5SWZE 4PY7A 2MH4A 1AGFB 4FZ8L 5HYSB 2X4PB 3PPSA 1CGTA 5H94A 3KWWB 2FATL 1Z5HA 3SYOA 5KW9L 1U8JB 2Q7YB 1F11B 5FOBA 3U25A 5EIQA 1BG9A 4B9KC 4UAOC 4AQ1B 5JPNA 3UIYA 2X6CA 4AQZA 3PV7A 5E5MB 5IMKA 3FU6A 2PXYB 1PS3A 2KKQA 3CFDB 3DA0A 4HGWA 4YR6B 5KYYA 1CLYL 1AGEB 1IGJB 2VDNH 3C9NB 4JLRA 1IVLA 4XCCH 4FS0A 1JD7A 4OCMC 2XDHA 4ZBJA 3B1UA 3UP1A 3S35H 2E7LA 3C6SA 2AJZA 4FYQA 3X3GL 2OMVA 3TCLA 4XMTA 4D0DB 3NOIA 2HN7A 1D5BA 4AG4H 1U3JA 2ZNXA 1IFRA 4WEUD 4IGBD 1A6UH 5DEGB 1JYVA 3KPQB 2EILB 3OM3B 4FQCL 1QFHA 2I85A 3WFEL 3CN0A 2XPGA 4Y8DC 1L3WA 4CKQA 5B7EA 2CUAA 1OV8A 4L5FH 2FZ3A 1ANUA 4PGZA 3MACL 3SPCA 2FLRT 2NT1A 1JNLL 5E00B 5E9DE 3U79A 5D8JH 2QLYA 3BJLA 4Y1AA 3LKPA 4HUUB 1WP6A 4R2GB 4KC3B 2BXYA 4AIEA 4G8EA 4A2MA 5KAQG 4YVUA 4JL2A 5TGBA 3WEXB 4CMHB 3D09A 4KY1H 2WXNA 3T3MF 5ISZE 4B60A 2A6IA 1UKTA 3PF2A 4RWYH 2DLFH 4X5LA 5K9OA 1T6BX 1OB1A 4Z8FL 3EDKA 5E8OA 2DD8H 2WUCH 3T0DA 2DWEA 5E95B 3C60A 3KLKA 2L7QA 3LHPH 3WFCH 5HVFB 2EH7H 1HHKB 1SUHA 1M56B 2EQDA 2AZAA 4KRLB 3OQRA 1T1YB 4JDZB 5T3ZH 1ZV5A 3TEYA 1JGUH 3DVIA 5E0QA 2XTJD 2BNQE 4X5WA 1KTRL 3IXAB 2CUHA 2Y7QB 4LT7A 4F57H 5C6PB 4H0LC 1OIOA 2OTUB 4HU2A 1KBVA 5DQJB 3KDMB 3VWKA 1CXEA 4G1MB 4OZHE 1CD1B 3ML8A 3S98A 2JLPA 4QRRA 3NTCL 5F2FA 4MLIA 2Z92A 4H25B 3MNVB 1XB8A 4BZ1A 4Y16C 2EECA 2X0WA 5I75B 3JWOC 3QDHA 1P4LB 3ARZA 3F7YA 4WFHE 1U92A 5EHFA 2HRHA 1BVKA 5D1XE 4AMXA 2AFNA 1SJEB 2J2ZA 3CHOA 4DUVA 3V6BR 4FI6A 3Q7JA 5GS2D 4QXTA 3BH8A 3MRKB 4WNQB 3V6OA 3B9DA 3NA9H 4F7PA 1A65A 2EZ0C 3JZYA 5MI0C 5HHVL 4BYHA 3FUJA 2W1NA 4EQ3A 4CU7A 1UH2A 3FSWA 4Y89A 3QI9A 3ZRSA 3NJIA 1OAYH 1T03L 2G2RB 5AZEH 4C8XA 4ODTL 4JFDD 2QPFA 1NBVH 4PUBH 4JB9L 5J1SC 4F7TB 2RFXA 3EYVA 1UYWH 2C8NA 3FU0A 4Y4FB 4MA1C 4YIQB 5HGDB 3M1BB 4KZCA 4X99A 5AVUB 1BP3B 5IROC 1WFJA 3MNZA 1JTOA 5HJDA 3WNKA 1UADC 3MXVL 4AMKL 1RZJC 3IFPA 2P24B 3MCG1 1T2JA 3SQOL 2AABH 4DCQB 1MFEL 1PNCA 1N8ZB 2R1YB 4WCYH 2PCFB 2CHNA 3H9SD 3N1PC 4MAUH 4MDJA 4UQAA 4JRYA 4GRMB 3WS3B 3CQPA 2Z93A 3EUUA 4YZWA 2ZX5A 5EPMA 3MJ9A 4WO0A 4ILDA 5FCUL 4FYRA 5DJCB 4C47A 1VPOH 5B3JE 3MUZ1 3QIUC 3AZUA 2VMJA 1YEDA 1BAWA 4I0PC 2CA3A 1ETJA 2DH2A 4IOIA 2XN1A 3CFEB 3VFPB 4YLCA 1JDDA 3L9YA 3SQBB 4DVBB 5DUMH 4OTXL 1T7XA 1T2XA 4JPVL 3QJSB 2I9LB 4PP2B 1YRKA 4MB4A 2AEQH 1DL7H 3ILEA 3B8SA 4U7MA 4ZAKA 3FT4A 4GKZA 5HHNA 1IT9L 4KTYA 1IBDA 1LO3H 4RLDA 2NUTB 3EJYC 5DVMA 3WNNA 3L3DA 3MAWA 2FBRA 4N90D 4OD1H 2NY3C 5BO1L 4X4ME 1NICA 2XVKA 4HXAH 4LPCA 1ADQL 5TJWK 3PU7A 4KK9C 4CMMA 1OEZW 3WIFB 4LEXH 1OW0A 4ZS7H 2D7TH 4LCIH 2I7SA 2FX9L 2VDRL 3EGDA 2EDFA 1NGZB 4NQSA 1A1NA 1AD9A 3MCYA 1OAJA 3BAJA 1NEZB 3DLQR 5D1QA 3F64A 3O8XB 3HHRB 4JZNB 4BH8A 3Q2CA 4ZUSB 1M2VB 3SB3A 2YWZA 1KB5B 4FYTA 2PWGA 5JO5B 4H5SA 5IT2L 2R4SH 4PV9A 1C5DA 3I6SA 1SHSA 1EEZB 1JPTL 4CL7A 1FLRL 3PXHA 1URLA 2WXPA 2CGRH 4UTBL 1TFHA 2DIEA 3DOSA 1Z66A 4Z7NB 1A3LL 4TQ8A 5KN5B 3L54A 2Z3FA 3GSNA 4FG4A 4NM8H 4TOYH 3GKWL 4PJFA 4GXUM 2VXVL 1EZLA 3ASNB 1SOXA 1AI1H 4JRXA 1CFNB 1AIFB 1QLRA 3X3FH 4MBOA 3VG9C 1BDYA 4POZC 3V4VH 2ZCLH 5GRUL 1JNHA 2HG5B 1B90A 3CVBA 3SDDA 5F7EL 3SD5A 5MP6L 2OSWA 1EEYA 2X44D 1UM6L 4UIMA 4XPFH 4XPAL 4IHOB 5HPMA 3PWJB 4PRHA 2GTQA 4KO6A 1EVTC 3H3PL 1ZLVH 5CJOH 4JO3L 3HPJA 5LBVA 2N0KA 4GLRH 4NLAA 1BFOA 4O2EA 1K4DA 2CR3A 1Z5LA 5EU6D 3H7BB 2WBJA 3SYQA 5H4YA 2B9BA 3O41A 4Z23A 5F9WB 5AAMA 3T2OA 2QQKH 5DURB 1F4YL 1BVNP 2HVKA 3D0VA 3PUUA 2WIIB 4YBLB 2XCMC 5AG9A 4Z7VB 4YFLF 3KXFD 1CXFA 2MKLC 5D5MB 4DP4X 1URIA 1XF4A 4PHXA 5B8CA 4GQ9H 1CK0H 2VQUA 4TXVB 3D8MA 2C4FT 1UKQA 2VDQL 4DP9X 1JV2B 5I28A 1J9QA 4ZPVA 1ES0A 1HT6A 3OMNB 1NAMH 1MG3C 4I5BB 1YEJL 2XXMB 3BPOC 3T4AC 3D5OF 5FUCE 15C8L 4WW1B 3O2VH 5EDXA 4CILA 2VKWA 3HFFA 5E5UB 1WYJA 3QNFA 2OJEB 2NYYD 3QNYA 4A2GA 4JE0A 1HYSC 3CDZA 3FOMA 4JVPA 1NGYB 4BE6A 3MUHL 1SBSH 1F4HA 3NT0A 3ZE1F 2O30A 1BAFL 1BOGA 2ICEB 4Y2DD 3HA0A 3P9LA 2C34A 2FYYB 4D7BA 4NQDE 4ZD3H 2BOCA 4M43L 5ID0A 2ZXQA 1DN0A 2EAEA 2GIYA 2B1OA 3D4YA 5EO0B 4X5XA 5D4QA 3SKMA 5T5FH 2VISA 2B1HH 4R2GC 5CLTA 5AW4B 4LIQH 1XQ4A 1GGBH 1RIVH 3BDBA 3BP6A 3UZVB 5CEZH 2MPAL 2X7LA 4E9TA 5FYKD 4JG5A 2BVEA 3ZSSA 1R24A 4BSVB 2ZWNA 1CDYA 3SGDH 3BQVA 5D6CB 4X6CB 3VI4B 1XR8A 3QPKA 2IAMD 1IO4C 5INCA 1KEMH 3QIWB 4JGMA 3QXVA 3CFKA 3OX8A 2WWNA 2EIZB 5F1SA 1T6VN 1BMGA 2AK4B 2G0KA 2IDQA 3BGFC 1RXLA 1ETB1 3EGXA 4IMKA 5EOTB 4CSTA 3VFOA 1CDHA 1AO7B 3KHOA 1MCHA 1A21A 2AJUL 4LPXA 2FAUA 2CBTA 2JB6A 3QFJB 4HCGA 2A6KA 1HK6A 5KVGE 3ETBJ 2VDQB 2F15A 4R4NC 4BKTC 1OZTG 3DMMB 3GSRB 2WW8A 4CJ0A 1KC5H 1AE6H 1A6PA 1BYNA 1RJZB 1UFUA 3GBML 2UZIL 1DVYA 1CGUA 3BT2L 2W0FA 3JWOH 2WTRA 3HOGA 5KSAD 2NX5B 4FMKA 1TO5A 4EXPX 2X3BA 1TJHH 3AG2B 2UYLA 4ZFOA 5IVOA 3ARGD 4Z76B 4TULL 4IS6A 4HD5A 5A16B 3CBJB 4DZ8A 3N5AA 3ULUE 4JPIB 5FA3B 3T4YB 5INDB 2Q3XA 3T0AA 2W88A 4YHMH 2DJ4A 3QZNA 3ZTCC 4G6JH 2O6DA 1J11A 4OIAA 2CIKA 1NCWH 3VSQA 1S5IH 4PWGA 3ZN6A 5IWLC 2ALAA 3ULVL 5KBNC 4Y5XB 3D2UD 1HKFA 1CDJA 1BMZA 2H32A 3CHPA 5HDLA 3I84A 3OLDA 2HRLA 3UAAA 2VLRD 2ZONA 5DQ9A 3TEUA 1F3DH 5TTRA 4FFVC 1IC5L 2XWBA 3WJMA 1G0YR 4F58H 3TWCH 1FFOA 1BQUA 4NKMA 5EORL 4KK6D 2EYRA 4R5XA 5AD0B 5J3HC 1FGVL 1JCVA 1XGQB 4OJYA 1A3QA 1RZJH 3NRQA 3LS4L 2BNRB 1KTDB 3HFML 4JREB 2WINA 5KBPA 4ZNEA 1R6VA 3LCYA 3COOA 4X8GA 1JZ2A 2WXMA 4I18B 4OF7A 4YLQT 3FO1B 4ZSOB 3DTUB 4WWNA 1OAKL 2JJTC 2YPVH 1HYRC 3NN8A 4WHTA 3QEQB 4TL4A 3O3BB 1DBAL 1G7IB 2JTDA 5I6XC 1A7QL 2X1WL 3ZKXB 5J11B 4UB0H 4XN7A 3ZGIA 3ZOAA 3CN2A 4FQHB 1ONQB 1OWRM 4AV0A 1SVZA 3WDHA 4YE4H 3FB6A 5DWUH 3KLHC 4HPYH 1WD9A 4JY6B 4K9EL 1IAOA 5EU4A 2AK4E 4KOBA 4GUPA 4L37A 2AW2A 3I9PA 4TKWA 1BEXA 2FUQA 5ERWB 5ICXB 2OV0A 1IAKB 1L6ZA 4P5MA 1P5VA 5GXBB 3BI9X 1W0WA 3GBNL 3GS4A 4L4VB 1QNIA 1HAWA 3FBKA 5EC2A 4QF1A 4HLEA 1OPGL 5GGQL 4QGYA 2YGVA 3WIAA 2DICA 2Z4QB 2PKDA 4XN5A 1FVCB 4FLSA 4HT1H 4OLUL 5I1DB 4F7CB 1NCHA 1GSMA 1A3ZA 1MFMA 3RDTB 3P69A 1K9TA 2QFRA 4DGIH 3Q3GB 4LLMB 3VRIB 5E8EB 3ZDYB 1B2WH 1C12A 2FT6A 4E9YA 3GXPA 4HK0A 3LIZL 3MBED 3BIKB 4LL1A 2OL3A 5EEYA 4OFIA 5T5FA 2DYSB 5F9OL 4N5EC 5DF0A 5I76A 3GSVB 2JSFA 2LAAA 4L4TE 1BX2B 1JD9A 3GIVB 2XQYK 5F89B 2XG5A 3CZFA 4PY7B 4WTXA 2KZBA 2V5MA 4OJFL 1ZVNA 1MELA 5IG7B 2B7DT 1SEBA 2XBZA 5KANI 3ZKND 2BJML 2BRRH 3MLZH 3BDXA 3O2WL 3LS5L 4C58B 5FOBB 3CSYA 1A9BA 1DSFH 3WJJA 3FQTA 5E23A 3V79C 1BZDA 1E7UA 4JHUA 3RJOA 3UPAA 3QORD 1ZIAA 3GDBA 1DN2A 4PJCA 4OM0L 3L95A 3OHXB 4HGWB 2BNRE 5AOZA 4XWOD 43CAB 1BBJA 4UZUA 5KG9A 1FIEA 4JLRB 2X38A 3NDZE 2VITA 4UTCA 1LEGB 3WEBA 2YD7A 1PYWB 5HHQA 1FG2A 1TETH 2BERA 2OMYB 3C6SB 2WCSA 1FAKT 3OAYH 3HUJB 5D4IA 3QEQE 4EDXB 2EO9A 43C9A 2HN7B 4LCCB 1D5BB 1O6VA 2A5UA 3VNZA 2OMWB 4XNYH 3H42L 2XZQL 2AQQA 2FRGP 2V9UA 4K55A 5FHAH 5DJ8A 5JW4R 4P49A 2VABA 2Z0BA 1M42A 2HT2D 3ZYIA 2JJUA 5FHBH 5AYUL 1R17A 1TCRB 2ZXWB 4Z7NF 4N0UB 2FZ3B 4NN7B 2DQGL 3HI5H 4FABL 5DUJA 3FQRA 2EEAA 3FB5B 4ZW7A 1B9ZA 1W72A 4LLUA 4Y1AB 5DJDB 2HKFL 4C4KO 5IW1B 3MLUH 3TZVA 1VFBA 4Y9EA 4JHAL 4Z7QB 4JFYA 5TGBB 2JV6A 3RQ3A 3FT3A 4H8WC 3T2NH 1S9XB 5T1MA 5FLVA 2ZSWB 3QJVB 1VLXA 4AYGA 1QO3A 2B3IA 1YDPA 4ERSL 3DROB 3GD1C 5E8OB 1FF5A 5IJKC 1KT2A 1H3GA 1NWOA 1KN2L 3O4LD 4WRLA 1QSED 3GINA 1HOCB 2P80D 1TKWA 4HKZB 2H2PD 5D7IA 4LCYB 1QHQA 1ZWIB 4FZ8H 3MLXL 2G5RA 3GEFA 1PG7L 1UD6A 2GAZA 5LGYA 4ZUUB 5CAYB 5KW9H 4K2UL 2A73B 2PCXA 3RB7A 1HXKA 2W95A 2YEZA 1G7PA 1VKXB 3V7AE 3RVUC 2YAMA 4KJQD 1WUNT 3B9VA 5GZNA 1J0JA 3D12B 4OZFB 2WLYA 3WMPA 2D31B 1CLYH 1GXEA 1JI2A 4I9WE 3F7YB 4OQTL 1G7JA 3N85H 4PS4L 4W6WB 2X9ZA 4CDHA 4DZBA 5C9JA 1EJ8A 3NJKA 3CFCL 1BVKB 1LK3L 1NPUA 4BSWA 3DMMC 5FW6A 3V9EA 3RBSA 4P2RA 3D48R 4BFBD 4RQQB 3ULAB 3X3GH 1H3WM 3QJHB 4H8VA 1QD0A 1W9XA 3QZBA 3BH8B 3L5JA 1NUGA 1ZT7A 4WUKL 4F7PB 4EUPH 4AGPA 3FT2A 3WMSA 4XH2A 3P9MB 1OY3B 5CLYA 4FCAA 3WBDA 1KXHA 4FQCH 3BVXA 4LEOA 3WFEH 2N1KA 4H26A 5HY9A 5CJ5A 2BHYA 2RFXB 5L8LB 1U0QA 5J06A 1E3FA 2OW6A 4A7UA 2IDFA 3MACH 5B21A 3KNBB 4HAGA 1JNLH 5FWRA 2X88A 3NQKA 4X99B 4ZO8A 2B77A 3G08A 3OKMB 1RZIB 1Z0NA 3QC5X 2C3VB 4FZEL 4X6CF 3VI4F 4DP5X 1WA0X 3IFPB 3LPPA 4HHAA 4PYHA 1U8KA 4WV1A 2GIXA 3CUPA 1INQB 3FCBA 3VMOA 4MDJB 3PFQA 2AF2A 3RWCA 3NCWA 2PF6A 4TPRL 2Z93B 1JRHI 3ZE0E 4Z8FH 1UCTA 3RAJL 3UACA 3ZUNC 1JXDA 1KACB 4PJGA 4U1HA 2OYMA 4YC2B 1KBPA 3A0OA 1ZMYA 1YEDB 1HCFX 1EGJL 3K6IA 4I18C 2APBA 1YAZA 2P7TA 4IJTA 3GK8L 1B0WA 1IBBA 3KWTA 3X12B 2FR4A 3CU7A 2K8QA 3BFWA 5FKAA 2IQ9L 3ML9A 4ZAKB 3MJ8A 5HHNB 3J27A 2B0SL 2XV0A 1ZAGA 1BQKA 5FO2A 2VDKL 2YO3A 1S3RA 3E1F1 3L3DB 3NTCH 2F54B 1I9IL 5E1IA 3OWEA 3US0A 3IPEA 4OCLC 1DANT 3PP3K 1SJHA 4RETB 1FV1A 1EPFA 1X6LA 2PO6B 2XIDA 4QRRE 1AD9B 1G4MA 1BIHA 1SHWA 3IFLL 5GHWL 4BH8B 1MI5D 2Y25A 3T4AA 4BZYA 4PV9B 1AHWA 2IPKA 2Z9TA 1C08B 3EH3B 3VXSB 5HHVH 5DLML 3NJLA 3SZ6A 4F8QA 3ULVC 3DOSB 2TSBA 3OKKA 1CE1L 2NNAA 3V6OE 1YEGL 1T03H 1NC2D 3WD5L 1DJGA 4ODTH 1XFPA 4JB9H 4HS8L 1TZHA 5F7AA 3K6FA 1QLRB 1MCSA 1T04A 1GZHC 4UQ9A 1BVLB 1NFIB 3KG5A 4X7DC 1TQWA 3LN4A 3OV6A 3ESMA 3IRZA 3SDDB 4GB9A 3MXVH 1RLWA 4AMKH 3SQOH 1EEYB 1I8KA 3S8GB 1MFEH 3MRCB 3ARWA 2Y2WA 3ARQA 2FT7A 4J39A 4ICXA 4DEPB 5EB9A 5F3HA 2DTML 4O2EB 4PRBB 1K4DB 4ZUVA 1Z5LB 3HE7D 4OF0A 4FP8