4GIOA

Crystal structure of campylobacter jejuni cj0090
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
QNTVILGSNLPKSLVKQFQKRINSNGYLEFEVILRSTFAKDVIYKVDWLDKDGFVLRDVLNEDYQALRIPAGQEVILRKLASDTRANDFRLEIKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Campylobacter jejuni Cj0090 protein reveals a novel variant of the immunoglobulin fold among bacterial lipoproteins.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Unknown function
molecule keywords Putative lipoprotein
total genus 15
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07233 DUF1425 Protein of unknown function (DUF1425)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gioA00
4GIOA 3O0LA
chains in the Genus database with same CATH superfamily
3WCYA 5GS0C 3ARQA 2HG0A 2UV3A 1KLGB 4X4YB 3FJTA 3VWJD 4EZJA 1A7QH 3ABMB 1G43A 5CJ8A 3ZE0B 3RZCA 2LAAA 1B0RA 4GSUA 2XWCA 3B7YA 3UTTA 5IB1B 5DRZA 3ZL4L 3MTRA 2EABA 4M7LH 3O6KH 1U36A 3CFKB 4D7BA 2PWDA 2M83A 1JCKA 1C08A 1FUNA 3C60B 2ADFL 3FU9A 2BVTA 1NLDL 1P84J 1CQKA 3FZUD 2DY2A 2O6PA 3RVWC 2BPBA 1KULA 1Q94A 4E0RA 4JZJC 2DOCA 4TVPE 1AJ7L 2HX9A 3DSFH 4MJHA 2PPCA 2YRPA 2C1PA 3ZDYF 2OA9A 5LBSA 3ES6B 5CAYB 2BDNH 5EH1A 1PG7W 2P47B 1Y0LA 1UACH 5JXEA 1S5HB 4WEBH 1HL5A 1IM9B 5H35B 1S46A 2ZWYA 3F04A 5FHAL 1E28A 4X0KA 5DEGB 3TEYA 2BS71 1J8HB 3VXNB 1XGQA 5D70L 3PHQB 1FNFA 3ARGC 2F54B 3DOSA 2PO6C 5DRNA 3Q8EA 5JIHA 2EDDA 3ARGA 2IH1B 1BZ9B 4P9HH 4M7LT 4XP6H 3SE4A 5F7EL 4ODWA 4CVUA 4YGAB 1BAFH 4UM8B 1ZS2A 3KPRE 1DQDH 4QHUA 5D7IB 2H26B 2YAPA 3L3JA 1A65A 5ESVB 2JJTC 4NRXA 3W11C 1DDHB 1PZDA 2XV0A 1AFVL 4QHKJ 3RFZC 2FQGA 3VTMA 1SVZA 1II4E 3CFQA 1RSFA 5EUKA 4AVHA 2JTDA 2BVQA 2O6EA 5MENA 2IGTA 2NYKA 3B7RL 1JDDA 2X2HA 3VW3L 4WV1B 4KMQA 4XC1L 4LSQL 1WA1X 4GQ9L 2QR0A 2Z91B 2EO7A 2BNRA 2PTTB 2FJFA 5HY9B 4ZFFA 2HVJA 1NCJA 1EH9A 5GS0H 2QFPA 3BXNB 5E56A 1E0OB 3MRGB 4XT1C 2ADIA 1R3LB 2DQDL 1YUHA 2PWHA 1AS8A 5MP6H 2FRGP 1E9PB 1YEJL 2C3HA 5I18H 4UQ2B 4RRPM 3K2IA 1OEZW 3CSPA 2FQDA 3DGGA 2ZNXA 3K2KA 1GGCL 1P7KA 4IJ3C 5GGRB 2AXFA 4P5SA 4JPKH 4K2UH 1GJIA 1XFPA 5BJTB 1RUAL 3QC6X 1IM9A 3GXNA 5EBWB 4EVNB 3FB6A 2H2SC 4WGKA 4E41E 2YRZA 3TA3D 4U1GC 5FB8B 1TMCB 4IMLB 4X7SL 3BWUC 3C5JB 4DGIL 2AQRA 3WNMA 3QDME 3TOPA 4B5ZA 3LIZH 5I0VA 2WN2A 1IZKA 2DMBA 1EMTL 4YAQA 4L2LA 1VRSA 1AE6L 3FU3A 5GGUA 2I32A 4G9DA 3QCUH 4R7VA 3WEMA 4HPYH 2JJTA 3ECBB 4A6YB 4FQJL 4K94C 1W80A 5ETUA 4DHLA 1TO5A 4DGYL 1UKQA 5IV2A 4X5PA 5HJ3B 3TP4A 1K72A 1ZVHA 3FFCD 1PW3A 1BXVA 2D4FA 4NJ9L 5KYXA 3LQZA 1ZHLA 1Z66A 3AY4A 4U6XB 2E0PA 1MVUB 4WV1A 4KROC 2XG4A 1FFTB 4NM4L 5MI0B 3NIFE 5MEND 2BNRB 2OJEA 1EUTA 1IVLA 3CLEH 4FYQA 3TEUA 4HUVA 5KYWB 1B3JA 4YZFE 2XA8L 4E5XA 3PGDA 4NT6B 1HE8A 1SXSA 2VZUA 3O4OB 2Y69B 3P77A 1D5XA 1OSZB 3G5ZA 1OF2A 5B1JA 3VGAB 1BX2A 3QH3B 3H3PL 4WHYG 3N04A 4L1TA 5KSBA 1ADQL 2X4PA 1OGAA 1V3LA 1V54B 2WUCL 2NY6D 3DJSA 2O5XL 1N64L 3FUKA 5JXAH 1HOEA 3VFNB 5E24E 1AS7A 3C9NB 4HBCL 5I16B 3U7WH 4XR8C 4F9LC 3F7LA 4Y2OA 3TF7C 4LK4A 4EVNA 4QRPE 2P24B 3BVUA 4HPYL 4TNVK 3H1ZA 4NXSA 5AZUA 1OE1A 1D7BA 1CYWA 4J3OH 5TF1H 4U7KA 3IDIA 2Y7QA 1KXTB 1NEZB 3V6OE 5CGYC 3QXWA 4HCRL 4KKQA 1PEZA 1DQLL 3CHRA 3HVDA 2EYSB 4KUCF 4QD2E 1ZT1B 2HT2C 1VLXA 5HHQA 3RI5K 4N6RA 2RH0A 3T3PE 3T4AB 1QVOA 1UADC 2VLLB 1AY1H 4BZ1L 3GSRA 3MRIB 2A9NH 1KGUA 3GSNB 4CADA 1MCOL 3ULVF 2W60B 2P5EE 1KBGL 2J1XA 1XR8A 4CBPA 4QI3A 2VXTH 3NIDE 1NFIB 4Y5VA 3CHSA 3SPVA 2OR7A 5MP6L 3KW7A 3C08L 1IGYA 4H2CA 2YIHA 4W6XB 2IANA 3AROA 3ZW3A 1J11A 4Y89A 1JPEA 1L4IA 4DO5A 5F6IC 3G08A 2WVSA 1AZZC 3H2WA 3QDHA 2B39A 1FZJB 4GQ9H 5HGBB 2J8UB 1EIBA 2WSKA 2X4QA 1CGUA 1BVNT 1AD9A 5H37G 4ABVA 3BIKB 2EDOA 3SCMD 2EKJA 3PIQB 4TN9A 1S9KC 5SWQB 1BSIA 5C0AA 1R17A 1GCYA 1IQWL 5GRZA 1VFBA 5FA3A 4DEPB 2VR7A 5HGGS 5INCB 1EAPA 5T5NG 4QRRA 3CQQA 2YD7A 4J1UB 3L7EA 5E0FA 1U8CA 4JFUA 4MQ7A 2NX5B 5E94B 5TK2A 1H8SA 4F33A 2ZG1A 3N0PB 1R33A 1A6VH 3F7KA 1JTOA 5BUPA 3QIUD 3S2CA 3HPLA 5TF1L 3IN2A 2VC2B 4PJIF 5J12C 4WI8A 1ZGLP 1I7ZB 1XZ0B 3L4XA 8CGTA 4DKEH 3B2VH 4LDLB 2YPVA 1Y1UA 2EIKB 1U3YA 3IDNB 4JG0H 5F1IA 1I8LA 1SY6L 2X1XR 1UACL 4PY8J 3NJFA 5HDBE 5KJRL 1SMDA 1P0SE 3SBPA 1S9YB 1BG1A 1PFCA 3VH8G 3VXUD 3CDYA 1EO7A 1U8PA 1HHGB 5E5MB 4JVUA 3RVUD 4O5LL 4X6CF 2GTWA 5FYKE 4NI3A 5BOZG 3QHTC 5IR1B 4LSRL 2C3WA 4F7TB 2YXVA 5J13B 3FO2B 4Q9RH 3HZYA 2VDRB 4LARH 4WTQA 1U2HA 5BQ7A 2ZCKH 3HFML 3R06B 3ZYZA 2ITDB 5MERA 4PJ5A 3PWLA 4QOKD 4A38A 4AJYV 5J12B 4BV1A 1CT8A 4G5AA 2WOBA 4TUJA 5H4YA 3CLEL 2V17L 4FI8A 3POHA 1IAOA 4QRPB 4O5LH 3H8NA 2Q76B 3EOAA 3UCQA 3V9EA 3I74A 5AUMB 1KY7A 4X8GA 1JP5A 1BV8A 1TQTA 4F15B 5FM5O 3OKKA 3VX1A 3VTAA 1NINA 4XGZA 1PBYA 1IV8A 4OQTL 1YEGL 3WEOA 2UVFA 1YEHL 1I4FA 1R3HB 2X7LB 3CIQA 4QRSA 2UWEA 4ABUA 1SN2A 3DURB 1OY3B 1W91A 1CS6A 5EN2A 3LKOA 1OE2A 3VU1A 1UWXH 1AYOA 2W95A 3LQAC 4DGIH 2YR3A 1BJ1H 2DJMA 5E8PB 4QXTB 4KPHH 1MQKL 3ZE2F 1UTDA 4HH9A 2Y1VA 1E5AA 1MFMA 3LH8A 3OHXC 4X5XA 5FO9A 3V6FB 4NEHB 4PJEF 1HIML 4LASH 1COBA 4P5KB 5IW1A 2QQNH 2RB8A 3GHPA 1DBKL 1E5BA 1Q0YL 3WDHA 1IAIH 3KH4A 1KFAH 2WXRA 3QFJA 4HK3N 1YEJH 1V10A 5I18L 1SXBA 2G75A 3WO3B 4XMTA 1S7QA 4I0PC 5FOJA 1NFDA 1XCWA 3W9DB 5EMYA 3D25B 4W70A 3QJHB 4KOCA 4HFWB 2E6QA 4NC1C 5IOPA 1A25A 4K5MA 4NQEB 4AH2A 1PJ9A 4Y4FB 2ZUTA 4ERSL 2NY5H 5CJQL 3L5XH 5JORB 2X9ZA 4X4XB 4X80L 1IEBA 1C5CL 2BP0B 2Y2WA 2DM2A 2FECI 4AUUA 6TAAA 2WAHA 3O3EB 3LNGA 1DVFB 2JK5A 2Y4SA 4PTUA 3B6SB 4TUKL 2A1WH 5GHWH 5GRVL 2CKBB 4GIOA 1VFOA 3EBAA 4E9RA 1R1CA 5C0JA 1KF9B 3FYEB 3UBXI 2HTLD 4LSTH 3LQMA 3V4LA 7PAZA 2XICA 3ZDYB 4C4BA 3NN8B 3O11A 4BK8A 4PBDA 5AYUL 3MNZA 4Z76B 3BP7B 5HDBB 1WFNA 4AQ8C 4BJLA 1XSKA 3MV8B 3RPIB 2CR3A 4M5ZH 4V2BA 4KGJA 3LNIA 3P9WB 3PHOA 2H45A 2VRQA 5EPMA 1U3HA 4JLRA 4KI5F 3F65A 4KROB 1GMIA 4OLXH 1TTUA 3ZY7A 4ZMYA 3VSQA 5GJSL 1ZS8A 5AVYB 5JPMA 2HJLB 2Q5BA 1GSMA 1N64H 5JXAL 1NGPL 4L8CA 1AIZA 4AQ8A 4M93C 3TJPA 1PG7H 1GAFL 1TR7A 3OJDB 2PUQT 1BVKA 3MC0A 1KWKA 2FK9A 3GJEA 4BQ6A 3O3UN 4B9CA 1O6TA 5HJGA 4CSTA 1NCWL 5CZXC 4L3ED 3HVNA 4HJSA 4A7UA 4GRLC 2CJ3A 5HDOA 1EEQA 4GUPA 1BWMA 4Y7OC 1WISA 4X4XA 3MU3A 3RGBA 3B6SA 2HRHA 1CCZA 1KC5H 1P5VA 2P5WA 4JFVA 5FW7A 3U25A 5JW5A 3C6LD 3MRPA 1DQJB 3WIIH 1DUYA 5I73C 3EO1A 4PVNA 4MQTB 5D72H 4W4OC 3ARDD 3GXFA 1I9EA 4JKWA 3FQUB 4OCWL 3VB9A 3MXVL 5A1AA 2FIRT 3HNSH 4YHOH 2J72A 2E5EA 3K71B 4R2GC 2VL4A 4A66A 1KB5B 3P2BA 1JPST 4XNXL 1T6VN 4AT6B 1KYOJ 3BGMA 4LNVA 5T33L 1X5GA 4IRSD 4L0ZA 3SO5A 1I1AD 3EUUA 1IC7H 3GPSA 5E9AA 4X6EA 2OV0A 3U6XS 4GW4A 3QEQD 1MI5E 1RH8A 2FBOJ 2GAZA 3JZ7A 4MJIA 1DJGA 2BVEA 1SXZA 2NSXA 2EDHA 2C34A 5T3XL 4R84A 1OZTG 4Y1AB 4K9JA 3H4HA 3BKYL 4KX7A 5I8EB 1AXSB 3GLZA 3L95A 3D4GA 5DZAA 1WH0A 4X6DF 1TEGA 3UAFA 2MTPA 4DFHA 3ZSTA 2AV7A 2FO4A 4JRYB 4NQEE 3NJHA 1LM8V 2EZ0D 8FABA 2DLEA 1QLRB 2PTUA 4UT9L 5AD0B 2OBGA 1JMZA 5C0AD 3RL1A 4N5ED 1KLFA 1O75A 1FYHB 2DKMA 5F7NC 2D3NA 1WFMA 4WW2C 1QHPA 3IDYB 3SKNB 5IQ7H 2Y06L 3KH3A 1SRDA 3GLAA 1CIDA 3OF6A 4RETB 3Q48A 4F5CA 1E27A 1ZVNA 2YD0A 4NUGL 3L81A 1UASA 2M26A 4WWNA 4Y4HD 2ZE0A 2JLLA 1HSBB 2X0VA 2YEQA 3AXHA 3S4SA 3ULUH 3VW3H 1IIKA 2VITB 5DURD 1MI5D 1R3KA 5AB2A 2QVTA 3LOWA 2HPOA 3KPSE 1CTNA 1KIQA 5F1NA 5DDHB 5DSCB 2XVLA 5CR8A 1XGQB 3DXAD 4EIGB 3E8UL 3EIFA 2HLEB 4Q0XL 1ZLVK 1EEZB 4JPIB 3DX6B 4JBSA 5T5FA 1FHNA 2NNRA 2Y36L 3LB6C 4IM8A 4WUUD 1BQHG 2HFEB 5HGDA 3A6CH 2CUMA 1Z0MA 4K07A 3C6SB 3HKZA 2OYPA 2MOVA 4RQQA 5D1ZB 5KBPA 1CUOA 2F8OA 3WNJA 3ZQWA 5HHPB 1E90A 1EFXA 3RVVD 1BM3H 3RJOA 3B1TA 1X5FA 2LW3A 3HNTH 5DJCA 3P0GB 1FVCA 3U48A 4MCYB 1SJHA 2FQEA 3CUPA 2W92A 2XV3A 4O02A 2OI9B 3EG9B 3LB6D 3DSFL 1EO8H 1X4YA 2FEJA 4G80A 3TCXA 3OAZH 2RQ8A 2AEPH 3I6GB 4AL8H 5LWYH 4MDIB 3UG4A 4P3CL 5IMKA 1LQBC 3SQBB 4DAGH 3LPPA 1J0JA 4MA8H 1WVZA 2Q0ZX 3SPHA 1CD8A 5I1LB 2ZX9A 5EORH 1XXDC 3DC0A 3MV8D 4LKCB 4BFEA 3BZ4B 2DL2A 4LRNL 5TDNB 2NXYD 2E7HA 4X9YA 4WWKA 1PTZA 3BVWA 3ROLA 2WHVA 3B1UA 1OSPL 2WZPA 4E9LA 4ZZKA 2BJMH 1NKOA 3A6BH 1OAXL 2DYPA 4J4PC 3ZR5A 5FM5M 2J44A 3VXOA 1IC4L 2IXQB 1MI5A 4MRBA 4JFDD 3Q8BA 1YNKL 1KPUA 3E9TA 3B9KC 2X40A 1ZT4A 4LBEB 4B9KC 1B4RA 2PW1B 4NQCE 2WWMD 4XWGL 1ZDQA 3C5JA 4R26H 5D1XC 3OMAB 2V2WB 2CO7B 1RJYA 4GY4A 4HSCX 5K9JL 4GKNA 1BF5A 2DQHL 3PDOA 4HIEB 1XF3B 4XP5H 3DHUA 3ECBA 2V9TA 3DUSA 1KLGA 2R4RL 4G6KL 1JPFB 2JB5H 1HHKB 3NCMA 2A6IB 4BELD 3NP3A 4AEIL 3WHXA 4HWBH 4G82A 4LPCA 4OB5L 4O02B 4RFEA 2IDUA 2R2HB 2BRRL 5J9PB 3V0EA 1AQ8A 5D7JA 2J57A 1JN6A 4ZOAA 2BHFA 3VRJB 4ZUUA 1N12A 1FNSL 3H9SA 4WHDA 4JFFB 1VGKA 5D6CA 4XBEH 1UWYA 4MHHG 5B21A 3Q13A 5I24A 2OULB 1WFIA 4F9PA 1ZJBA 5AAWC 1A6PA 3Q9PA 1WIOA 4OW6A 1P6AB 3EJYC 1JNJA 2BIQA 4GW5A 5A6IA 2XWJB 5IFJA 1Q1JH 4EF3A 4YHPB 1AGBA 3FN0H 3TGXA 3FO1A 2YD4A 2WQSA 4OFDA 5DZLA 2D7NA 4XMKL 5LN4A 4Z7WA 2OZ4H 4KDVA 1MFCL 1UZ6F 4CVXA 4U1NB 1NFKA 1A7NH 3WDIA 2IXQA 3I6KB 5I74B 1XEUA 3VFMA 7FABL 3RGHA 5KBMA 2PN5A 1HEZA 2X6MA 4QXGL 3FQTB 3N9GL 4MBOA 3SKMA 4Z5RB 3HE7C 3HUJB 1LE5A 4LQFL 2XKNA 4IS6B 1O7DE 4JE4B 4LPWA 4KVCH 2GYSA 4TM9A 5EBLA 3RWEB 2XI9A 2D7MA 4WRLA 1NCAH 2H3KA 2HZHA 4G6ML 2JH2A 2KQMA 3U46B 4DJMA 4EDXA 5G4OA 1OHZA 1AGCA 1CC3A 1R3IL 4XPFH 2EP6A 3QARA 1RZFL 1MWOA 5I1IH 1G9NH 3EYFB 1O5DT 3U9PL 3ATDA 2ERJC 2CO2A 1J8HE 3VXME 5KYUB 5D7HA 3I50H 5EEYA 1FH2A 4HKZB 4PB0L 4LIQL 1WFTA 2IALA 4M1DL 4AOFA 3H9SB 4HG4K 2DQUH 1IGYB 3TT3L 4MXVE 2AXGB 5CILL 2WXLA 1KEGH 4XAKE 3DI3B 4R96B 4X7EC 2XV2A 3GNMH 3TX4A 4AITA 5IVZA 2BVOB 3DECA 3BCDA 2IDSA 5LCVA 1S7VA 2ADGA 3BP6B 3V5HB 3GI8H 3T2LA 5M7QA 3WFEH 4NLHA 5BV7H 5B7MA 2PCPA 3BD4A 4RMQA 3QHFL 3RFRA 4EAEA 4QRQB 1RJLA 5KN5A 5JHLH 5A3IC 2X89D 4X99A 2W9LA 4QRRB 4ZUSB 5INCA 4HUXA 2R2EA 1Q0EA 3RU8L 3F3HA 4AE0A 4KQ4L 3VFRB 2EDNA 1N10A 1BOGA 2FDBP 4NO0B 3TC9A 4JFZH 2FE0A 4YAQB 2NSQA 4EPSA 2IVFC 3RZCB 5KBNC 1W6LA 1GS8A 1HHJA 5I17A 4TNWF 3N85L 5C86A 4XOCA 1QBMH 5EOQL 4ONFL 1ZA3B 3HE6B 4DPBX 1SEQL 2DB8A 1MRFL 4GSDL 1FVEB 4Z23A 1EVTC 4QO1B 5JR1L 4HLZG 4R83A 5C0CA 3NEXA 3ILQC 3U1SL 4HU8A 3BGFB 2IALB 3L9BA 5GRYA 4P04A 1PY0A 1WCBB 5L7XH 1AKPA 5TFSL 4FQHB 4E5XB 4JFQB 4UV4H 1KYOK 12E8L 3U7YH 4UTAH 4OD1L 3AM8C 2H0JA 4IRJA 2HAZA 4JM4L 4PRID 1BX2B 1S5HA 5H35A 3DI2B 2WJ7A 3DBSA 5GSVA 5BQDA 4AUJA 2H9GB 4Q9QL 2ZTBA 3Q8FA 3VFWB 4PJAE 2EIJB 5KVGL 1Q90A 5JIPA 5F71A 1KWGA 2EDJA 2FVNA 1N2RA 2MKWA 2OYMA 1G1YA 1NCDH 4L4TD 3S8FB 4U6VL 1F0LA 2AJYH 2JTYA 4W9IC 1BZ9A 4MZRA 5KN5B 3KPPB 4KNQA 3L48A 4NPYB 3OKEA 2E86A 4X99B 3OQRA 2Y5EA 3ZR6A 2UY6A 1EO5A 4LL9A 1WEJL 1ACYH 4HAFA 1MIML 1AGFA 4BH7B 4H4NA 2JCCA 4W9DC 1WT5C 3U2SA 1B9KA 4YVNA 3KWWA 3U9WA 1T4KB 2NY6B 2UYLA 3EJSA 2A77L 1EDYA 3LRGA 4K7PH 4IBTA 1LLAA 5F21B 5T3ZD 3IDUA 4N5EC 4QXUH 2WYHA 4K8RD 4CL7A 3VD0A 2DLTA 3ZZQA 5KSVA 4N9GB 4HT1L 4JHVA 2XX0A 1YC7A 3B7SA 1I1CA 1DSFL 2OTUA 4XH2B 3MPCA 3EJJX 4G8EB 4HETA 1U8MA 4I85A 4Z7OB 2BMKB 2OZ4L 1DBBH 3X11A 4X7TB 4IMKA 3WN5C 1W2KT 1KPVA 2DRUA 3BFQG 4FQ1H 2ATKA 2BHUA 2IIJA 5ELIA 4WFFD 4NC1E 3O9WA 1F42A 2EDTA 4I1RA 4YFLF 1UCBL 4NFCA 3IBOA 3IFPA 3TA4D 3CPLB 4I77H 5IW3A 3IE4A 1E9QA 4UTAL 3V4UL 4I0PD 1MCDA 4GMSL 3FQYA 4HFWA 4NZJA 1WAEA 2NQDA 4R5VA 1MSPA 3SKOA 4P2RB 2ZX7A 3ZZSA 1R5IA 2J12B 3C09B 5CU5A 2CO6B 4HWZB 2RAMA 2WBJC 1QFOA 2AEWA 4WSJA 5ERWA 4ZS7L 4U49A 5C0ND 3S96B 5SWZB 3D6GA 3WNIA 2WB1A 1CL7L 1A3LL 2X1WL 4YHYB 1MRFH 2XQYG 3LKPB 2W0FB 4X8JB 5TK4A 4KAQL 4NBZB 5HHXL 1UURA 2CM5A 3QDMD 4UNTA 4HIJB 5HPMB 1SQ2N 4IBZA 5HDLA 3HPLB 4J8RA 4PQXA 4Z76A 3VWKC 4XCCL 4PJAF 3V4VA 1E4HA 4ODSL 3LSOA 1DJSA 3QXDB 4LHUG 5IFAL 3Q0HA 2N7SA 3ASOB 1HDMB 2DMHA 1XF5A 3PWPB 2M2DA 4TQPA 3VXPA 1LO4H 4KJQD 1OAXH 3RI5F 4ECNA 3W81A 2JXMA 3R0NA 4IKKA 1GJWA 3KLDA 4LDOB 1RMFH 1YMMA 1DVUA 1A6ZA 1EEUA 3MNMA 4Y4FD 5FM8A 3GI8L 5JZ7D 1N8ZB 5ALBL 4HIIA 3V4VH 5KUMA 3RDTC 5EORL 4CDGC 1T1YA 3WL9B 1MY5A 3GJEB 3QJOA 5HXMA 5ITFA 4AKQA 2Y07H 4F1SA 3GNML 4MNGB 2ZOKB 4ZO9A 3N2JA 1GW6A 1ZLEA 4ODHL 1UA3A 4YDJA 4B0MM 4P2RA 1BQUA 3L2MA 2QHRH 1KUMA 3WLBA 2BWQA 3D3VB 5HVWA 2Z7YA 1DN2A 2YFNA 32C2A 4M00A 4X5RA 4WNQB 1B6DA 5CHNA 4PJXB 4ZTPH 3AQDA 1PEWA 2MIZA 1FVDA 2LFEA 1D2PA 3NFSH 4ODTH 3QDJD 2YUXA 4MAYB 1BD2D 2Q8AH 3NIFB 3UO1L 5K9OB 4TF4A 1JWUA 1OKEA 4XPFL 2FGWL 4UNVA 3BPNC 2YBRA 2WNKA 3KAAA 1KN4H 1QFUH 3WNPA 4EI5B 1LK3L 3O8XC 1J5OH 1JNHB 3BUYB 4F5CE 1BBJA 2J1YA 2UXGA 4PJGB 2F8VA 3FRUA 5KW9H 1IMHC 5DLMH 3QDMA 2ICWJ 4ZQKB 2EIZA 4IGBA 3GI9H 1AO7E 4FFZH 2QBWA 2ZWKA 4DW2H 5KZCB 1HQ4A 3L3OA 3T2QA 1HEJC 2HLFD 1XGZA 1QQDB 5HHOA 4OGYL 2YC1A 1TYRA 2DF3A 4HS3B 5E08H 4PRHE 2K78A 3P4MA 2WUBH 3ZE2E 2YZ8A 2H5UA 1ZY9A 1HN1A 3DVNA 1LWHA 2E27H 3MUGA 5HHVL 3MJ8B 4A6YH 5DD6A 3B83A 2FH6A 4OZFB 3ULUL 4WI0A 5I6PA 2JIXA 4X6DA 4NQXB 3EZJB 4OV6F 2FO4B 4AEHH 4OF5A 5IQ7L 1BMWA 5KS9A 2G0KA 1AD9B 2WSPA 1NFDB 1PF3A 1R46A 4H40A 4JQIH 4L9LC 4W9CC 3H9YA 3VFVB 4L1HA 5ES4B 1CD1B 2DM4A 3DIFA 4FKHA 1BFOB 2CALA 5AW9B 4Y9EA 4NNYA 3T8XA 1CDBA 4GAJL 1SLXA 25C8H 2VLKA 4LLWB 4OD3L 4FKEA 3BKYH 1BHGA 1GHFL 1QFPA 1ZSDB 3IJHA 5IT2H 3FT3B 1H0DB 4HUMB 4OZIB 1JZ7A 3KHOA 3NIDB 3H9ZA 1I8KB 5FYKH 1JZ2A 4GAFB 1MH5A 5FYJD 1DHKA 3U7AA 3S36H 5DGQA 3PABA 1CVSC 1XIWB 3FRUB 5T33H 1FZOA 1ETB1 4NFBA 5C08D 4NO2A 1YYML 4I2XB 2XDHA 4XNXH 1S7TB 3QK0A 2EVJA 3AT9A 4YHZL 2ZX8A 5DO2C 1JI2A 1CVRA 3HS0C 1ZLUK 1JNNL 3F85A 4XVJH 3TYGH 1AMYA 5D72L 4JANA 3QFGA 3NJMA 3FQWA 4O58H 4BGLA 3PNRB 5HP5A 3IAGC 1HE7A 4B9JA 5JPMB 3ZMRA 3VCLA 2PKDA 1KCRH 2K0RA 4J4PA 4MCYA 3IXAB 5K1NA 3OJVC 4WFHD 4JY4B 5GGRY 5TE7L 5KWYC 5KS9B 3C5ZA 5EB9A 3L3IB 3ALPA 1U95A 2B59A 3AREC 4HS6B 3ARGD 1CDJA 4PV9B 2HJFB 4YMPA 4JM0A 2ICEB 3SDXE 3ZT7A 2OMWB 4HP5A 5F2FA 3WHE1 5F9WC 2ZICA 4UT6H 3SIKA 2V9RA 3N0AA 5DZPA 1H3PH 1PX4A 1JGVL 3HRPA 2ZKMX 1R3HA 1P1ZA 3CU1A 3AQYA 1EO8L 3BZ5A 4HCRA 3EO9H 1VKXA 4HUWB 2CUHA 1MNUL 1EJ8A 4NUJB 3IDXL 2WXNA 5EG6C 1S78C 2QV2A 2BXYA 2VO5A 4ZAKB 2WO2B 4YNYA 1DUYB 5B39A 4BZ1A 1MLCA 3RIAF 1XL6A 4HK0A 3TNMB 2TSBA 5KSVB 3T0EA 1ET5A 2PPAA 2OZNA 4OIFA 3CZFA 5I6XC 4M6AA 2ZYHA 2ZSWA 4X4ME 1KCWA 2MH4A 1K8IA 5GGSB 1AAJA 4PD4J 1NGWA 1OGAD 1PX3A 5J5EA 2A73B 4WI4A 1D7FA 4BH8A 4WF7A 4MJ6A 1MZYA 1RXLA 2DWDB 1S5IL 4JFED 5IF0B 5GIRB 1LEIB 3WE6B 3ZYJA 3SDCC 1BMGA 3BPOB 5HYQA 1ZJAA 3SO3C 2DWSA 3FUIA 5ISZD 3BI9X 2CNZA 4RA3A 3W9DA 4HJ0D 3D69A 3IXTB 2ZUVA 4U6HB 3IDMB 5J11C 1NAKL 1UJ3A 5D6DC 1HQRB 5BMFH 2FO8A 1AOZA 2FUQA 4JY4A 1K2DB 1TDQA 3DSNB 3FU5A 4S11A 3WEXA 1QWUA 1NJ9B 5H2BB 4H0LC 4A39A 3QWQB 3IFLL 2ARWA 1T1ZB 4IOIA 3K80A 1MHCA 1EXUA 1CF8L 1PMYA 2C5DC 3FB7B 3HZVA 4TQIA 5KZCD 3IGKA 1CB4A 2YXMA 3DIVA 1MW0A 2DIAA 1GGIL 4GW5B 5KBLA 4FQXA 4JM2B 3NN8A 3I6SA 4ZO8A 1AGBB 1KCSH 2QQNL 3LXAA 1JPSH 3DO7B 4FJYA 1SY6A 2VITA 4LLDA 5DJ2B 3K6SB 4H1LG 4N0UA 2OCFD 4R6UA 2AJZA 2WINA 4MA7L 3SJVE 1DBML 1JF5A 1UB5A 2BNRD 3KPNA 4W6WB 1NIEA 3O8XA 3UDWA 5EC1B 4K71C 2ZSWB 3IDGA 3LPFA 3ARRA 4HJJL 5DVLA 4Q74A 3THMH 2A73A 3KBHE 3L8QA 4WWPA 3S3SA 5I5MA 4CMHB 4R7LA 5HGDB 2F1BA 1C16B 5ABAA 3D4YA 4I3SL 5FLUA 3REWB 4Z3FA 4QF1B 5ILTL 5E23A 4HBQA 3EYQD 1F2QA 2CHNA 1F58H 5KBKA 3CDFA 2OFQA 2Q10A 4LAQL 4YDIL 1DJWA 2P80D 4KDWA 3C5SA 5DJAA 2VDNB 3QUYB 1AD0B 1XB8A 4Z3TA 5DVOA 1ZWIB 5FHBL 3UZVB 4FC3E 2XX1A 2V17H 3BWSA 1HHHB 4W9KC 2ALWA 5L2KA 5MHSE 3UFIA 4JJHA 5E1AA 2DH3A 2P5WB 1EAOA 3AADB 2BOBB 5JXED 3CFMA 4Q9RL 2HFGH 1INDL 4RWHA 4B9IA 1I8AA 5HI4C 2GKIA 3N40F 1A1MB 1BLNA 4M4PA 4ENED 1OOAA 4K15A 3VWJC 1C5BL 1U8OA 2XBZA 4KY2A 1A66A 4DO6A 3KXFD 5JNYB 2CJUL 5I1JH 1A9VA 4N2MA 1C1EH 1F97A 4N2KA 4O2CB 3TYGL 2X3BA 2V8LA 3CHQA 5EC1A 1EFXD 2WTPA 5AAMA 1AZUA 4J3OF 3FAWA 3IDGB 4M5ZL 3PHQA 1HZHL 2XWBB 3UC0H 3KYOB 1A3RH 4NO3B 2MQ3A 3N06B 4DZBA 2HA1A 3ARGB 5EOTA 3BPOC 2OTWB 1K4DA 1QRNA 3EJTA 3B9KD 4QHPA 5F9JB 1AC0A 4UV7L 1IM9D 1MRDL 1FYTA 4RBPK 4ANWA 2H32B 1T7VA 4HYTB 2OCJA 3EFFA 1JV2A 3GRGA 3OXRA 1ZIAA 3VA2C 3VI4A 1E8ZA 5PAZA 5FDWA 3K91A 2ATPB 2J6EH 4K3JH 1TITA 3EOBA 2AJVH 3ZHDA 2CDGB 3SJVD 1ZV2A 2Z91A 5EU6B 3IF1B 1BVLB 1V27A 5D7JB 2DQGL 1RK7A 1KGIA 3A47A 1K85A 4Z8FH 1XGRB 5F0PB 3VDCA 1TCRB 4ADIA 4RGNC 1USZA 4IRJB 3GZQA 3UAJC 1U8KA 2A74C 2BSED 4H20H 4TQEH 3SJVB 4HU2A 4B9YA 5SX5K 4LSSL 3ALXA 3ET9F 3EJPA 4J3OG 3WEBA 3RTQB 4XHJD 2A9ML 1WWWX 1JHKH 2WQRA 4G5ZL 4PUBH 4JDTH 1QA9B 5LDUA 2ITEA 4PVLA 1MRDH 4JB9H 3LD8B 1WFUA 2AEQL 1UOWA 3QO1B 1QSFE 1N59A 4NBXB 2AI0H 1AGEB 3SY6A 4B50A 4D0DB 3L9RB 1JYWA 2DQIL 2VDKH 3GTVA 3QORB 4OGAC 4UINH 1MHPH 1T89C 2C7UB 2V0AA 5AG9A 1YNTF 1TJIH 1ES0B 1KGXA 3PWJA 4Y16B 3CUPB 1MELA 2D7PA 3X14A 2KPNA 2OMTB 1W16A 4NYLA 3U46A 4WIQA 2H47C 2VUKA 3HR6A 1FYTD 4YWGL 4I5BB 3QAQA 2G3MA 1F4XH 4PEEA 1DBJL 1XIWC 4MJ5A 3MLRL 4OCRL 2D3VA 2GIMA 4UZGA 4LU5H 3T0BA 1F8TL 1HH9B 1HESA 3PFUA 3QUGA 2UZYA 4HC1A 4YO0B 5JYMA 1MCSA 4L29A 2YA0A 2Y22A 1CR9H 3N44F 2HFGL 2Y1YA 4OJAA 2QQLL 3EAKA 1X5KA 1FAIL 4NNPH 1SFDA 1RPKA 3P73A 1SYSB 3OB0K 1PDKA 1RI8A 5D8JH 2G2RA 1L7TL 4N20A 2EZ0C 4LARL 4OI9A 4P9ML 4OFYD 3OG6B 2NY3D 1B2WL 4XMPL 1TCMA 3REVA 5E4AA 2NW3A 4ZDHB 3TPUB 3CSBA 2OL3B 3QUMA 2GTZA 2JELL 3VXMB 3GTTA 4PRNB 4Y5YC 4MD5A 3RTQA 4B96A 1TQCC 1A02N 2EE0A 1EDHA 4IOFD 1A5FH 4WFHE 4OT1H 1XGTB 3L5IA 5DMKA 2HRPL 1BIIA 3FUMA 1CBVL 1SY6H 1YJDL 3MQIA 1NFDF 3QRGH 3FH8A 4M62H 4G6FD 2WIIB 3MV9D 1AE6H 3OAWA 1BOGB 4UIMA 5A3ID 2NRDA 3PJSA 4KKBD 5I6KA 5LXVA 2Z7WA 1UOVA 5F0MB 4KU1A 4U1KA 4UT9A 4DKFL 2J55A 3APNA 2VDQB 4HUKB 2R69L 3EH2A 3GQFA 4NYLB 4WZ9A 2VLJB 4ODXB 1A4AA 2I5YL 2NZ1A 2WWMC 2RIKA 5EU6E 4LZKA 1K8DB 3TIEB 2B8OT 4AENB 5F6IB 1G87A 2WXOA 3BQVA 1D7DA 4N8PA 5DZVA 4Z7OF 4RZCB 1GS7A 1GGCH 2BNUA 4P46D 3FONA 1ZIBA 4KK9D 4OI7A 3QP3A 4ZMWA 2V9QA 5SWSD 1HHIB 1I31A 5FDYA 5JW4N 4NPJA 1AP2A 2KMWA 4H20L 3O6FB 4JRXA 3ARVA 3CN2A 1KNOB 4PJCB 4YGVA 5ACZA 4YXHH 4OUUA 2FUTA 5LNGA 3ILEA 4N8CL 2NUPA 3FN9A 1BBDL 4ENEC 5IIEB 2X2JA 3CZNA 4KK9C 3K1KC 2X2YA 2C4FT 2J8UA 2AQ2A 1X6LA 2VXTL 2YRLA 4NP9A 3O41B 4WGWB 4PJDF 5BPPA 4OZHF 2DIJA 3BMWA 4FFTA 3UYOD 4Z3GA 2K9UA 1MLBA 1GIGH 1MFBL 4XBPA 3KBPA 4ELMF 5IESL 2OMXB 1UM4H 5D7LD 5D71L 3J2PA 5DC0A 1RP8A 3MLSL 1JZEA 3QFJD 4LGSB 1U2YA 2YBRB 4GXFA 4ES9A 1QSEB 2VAAB 5BZDA 1MAMH 4O02L 4Y9BA 2JCCB 2FIKA 5FW6A 5E1QA 5IB5A 1TUPA 3RWFB 7TAAA 1BBJB 2KLTA 3EZ8A 1RHFA 1RV6X 2BS8A 3QFJE 2I9TA 1NA8A 2G4GA 3LRMA 5T1DH 2CCLA 2XLLA 3LEVH 1I7ZA 1ZHLB 5K9KB 3OSVA 4EIBA 2PYFA 1ERNA 3HG5A 3R4RA 5FHAH 2WKOA 2OMZA 1T80A 2KQNA 3MRBB 3TVMB 4P4RB 3RWIB 4IRJD 2D3JA 3NGBC 2BDNL 4OFKA 3SGKC 3DX7A 2AXGA 3HR5A 1DE4B 1Y6MR 1U93A 2R1YB 3OZ9L 1JGUL 5CEZD 2PYEE 1LO2H 4M61B 2YMXL 1N0LA 3QA3B 4PJAA 5DD3H 5I6OA 4LPXA 5DZNA 4AZUA 1CN4A 4NIKB 5IB4A 2P8MA 3QEGL 5MI0C 5D55A 3HZYB 2DQCH 3STZA 3ESNA 1U3ZA 1E9QB 3VFNA 1E6JH 1NGXB 4LPVA 4J8QA 3VRLF 4M8UA 5GGVL 4NKDB 2SEBB 4TUJB 2WXQA 3PV6A 4FFVD 5IVXF 2KDGA 4Z7OE 4P2QD 4LOFA 3CCHA 1P9MC 5KVEL 1MREL 4MA1B 4RRPA 4PJXF 1O7VA 4OCSH 4ILDA 4ZO7A 4MVBD 3TZVB 1SGKA 2MQ0A 3AY4C 3QPXL 1FG2A 3GBEA 4XBMA 5DWPA 3ZHFA 2K3TA 2X1QA 1F58L 5I17B 4PBWD 4LLVA 5GRVK 4TOYH 1KTDA 5E7BA 4HIJA 4W9JC 2E7DA 4N6RB 1XCTA 5CD5D 2E9BA 3B4NA 3GXDA 3QIUC 5KSUA 3MRIA 4XRCB 2EEXA 5CJBA 4ZMQA 2F7PA 1DL7L 1FN4A 3PYCA 5FUCE 3CZSA 1R47A 1U8IB 3ZGIA 3ULSA 4AK1A 4H25A 5E6IB 3ZJAA 3WMSA 2OMZB 1JRHI 3LKSB 3BKMH 4Y4HB 4BM7A 3LZQA 5AALA 4IIQC 4BWUA 2YS4A 5GRJL 1FNAA 1KCBA 3QQDB 4JPKL 1H15B 3ARBB 1NDMA 3F7PC 4JPVH 3PAUA 5EF1A 4RFNB 3WXVH 5K39A 1U8LB 2H9GA 5GS2H 2X1PA 2EJ1A 4WWID 3BDYH 1P53A 4Z18A 1U4EA 3I85A 2R51A 3OGOE 3DXAB 1IB5A 2FWUA 1NCBL 2PLTA 3UIYA 1UUNA 1DLFH 3MO1B 2OW6A 3ZZ1A 1GW0A 5IROC 3QWRA 1GZPA 3FTVA 3ILQD 5ACMA 2Z8WC 2SEBA 1OO2A 3OKEB 5EO0B 1JGLH 1XVSA 1PKOA 2WZ0A 2Q3XA 5FX3A 2E8ZA 4PRPE 2Q2LA 3VAEA 1NAKH 2FTAA 2I9LA 2UYLB 3FHQA 1GZHA 2CMRH 4C56E 5KG9B 3UTZA 2PO6B 4N85A 3VGHA 3WKPA 1MW1A 1ZOXA 1AFVH 4U4BA 1OTUC 3MUHL 2YK1H 2YPLA 4W4OA 1RIHH 1UH4A 1XR9B 1A6UL 4IRZH 4JRXE 2OJZL 4FQIL 5LAXB 3SHSA 4K7FA 3GI9L 4FFZL 4PU2A 1VEMA 5DLML 4P9HL 1TZAA 1QW8A 1WTGT 1JDCA 5DT1L 1IBDA 1Q9WA 4JM2C 4QY8B 2IJ0C 1BQLH 5T3ZE 2BH0A 1OSYA 5BS0B 2IGFL 1YZZA 4DEUA 1OHQA 3A21A 5HYQB 1KJVB 4HIXH 1H8OA 5LCVL 1BGXL 3QXVA 3B3IB 4FF9A 4Y4KB 1W0VA 1I9IH 4QT5A 4AVKA 5AKSA 4YHIA 5JOPE 3P54A 1GY2A 4L4VD 1BZDA 1T1WA 1TNMA 4JFDB 5IW6A 3DMMD 3UX9B 1DFXA 5BNXD 3CSFA 3QNXB 5F3BB 2D9QB 3BAWA 5DHYA 1IT9L 3TVMC 3ZL2A 1Z5HA 3VNYA 3L45A 4CDHA 2E4FA 3NPSB 3PNWA 3FUJA 5CWSA 1ZSHA 4WTXA 4F57H 3CDCA 3B9KB 4TL5A 3ZE2B 1SN0A 2O6DA 4FG4A 2Z0UA 4I18A 1I9RH 3D9AL 3RHWK 3U6XA 1FE8H 1X7TA 2XQYK 4PWHA 2OS7A 3HN5A 4ACTA 3UEQA 5T1JA 1CTOA 3IFOB 1J05B 2CXKA 2WTRA 4YPGB 4HKBB 3K72A 2NZ9D 4U3HA 1JXDA 4F80A 1BVNP 1U92A 4KXCA 3QULB 2VLME 4OZIA 1G7HB 5FYJH 5BW7C 3QR0A 3UJTL 5I6XB 1DQQB 5MEQB 1U8JA 2AAVA 4NHCH 1I8IB 1H8NA 3CXHK 2FT6A 4AT6A 3HBZA 4P2CG 5BVPH 3OKDA 3NCEB 1YYMH 3IWVA 2I60L 3OKLB 4X98B 4CSZA 3ARZA 3LS4L 4X5QA 6FABH 4I88A 4AYBA 1G1OA 4KAQH 5HVGB 5EIQA 5HHXH 3HPJB 4DIXA 5DJ0A 8PAZA 1I53A 5EU4A 1JPTL 2QMKA 1OW0A 5T1MA 1A3LH 2J2ZA 1YN6B 4KV5E 1SYVA 3DNKA 3LRHA 1LO0L 1FO0H 4EN3D 5I0YA 2WXJA 4FZEL 1IILE 2RALA 1P7HL 4ZS7H 1M7DB 1FL3B 4WI7A 4AKOA 1ZEAL 1TJGL 3JWNG 3L17A 1FNLA 5IK3A 3GZPA 5F89B 1KJ2B 3TJHD 2APVA 4JG1L 1VENA 2R7EA 1QEWA 5FCUH 2E59A 4PRPB 3IMSA 3GSQA 2FT7A 2BHYA 2HPTA 5CD3B 5J4MA 2C9UA 1G7IA 2FSEA 2TAAA 5AW2B 5FPIA 4PBVC 5FWRA 1DN0B 2YSSB 2NW2A 1RK0A 5AKRA 3ULUF 5TH2A 1CL7I 3AREA 4V1DD 3QJVB 4ZW7A 3FB8A 2P26A 4HHAB 2WXIA 4O9HL 3UTOA 5B3JE 5LDSA 2MJWA 3GMLA 4LEXL 4L05A 4V33A 4WU7A 4YBHA 1B4JH 2R0LH 2YKLH 3MAWA 3P3RA 4JCLA 4RVBA 4C55A 1T2QL 5E08L 3DX1A 5E99L 5AOZA 1QRKA 3KYOA 3NPSC 4KJPC 3UYRL 2BNRE 1RZ8A 1WZ1H 3UZQB 1ED3A 3CHOA 4GRWB 5CEXB 1ZS8B 4AGPA 3FOMA 4DWHA 1KEMH 4AYFB 4UTAA 3OR7B 3GDCA 3WIHA 4NBYB 2VJ8A 3DV4A 4YQXL 2Q7YA 4FYTA 5BV7C 3QUKA 2FGWH 3TBCA 2QQKL 3VFVA 3T0EE 2NMSA 2X09A 4IIZA 3TN0B 3VG9B 3QIWA 2JKTM 1UJ3B 3S3BB 1CD1A 3DIFB 1L7IL 3SDCA 3B9AA 4L9LB 1WO2A 4HZLB 3DSNA 5BRQA 3ZTJG 5DHDA 3CSYB 3ULVL 1ZLVH 2WCSA 4MKTA 4XVTL 3SE3A 1TCRA 4GRLA 4Q2ZA 3P0YL 3QUHA 2W0KA 2VRAA 3V4VL 3AWFA 4S0TD 1RZKH 4M48H 1UWFA 4LLYA 3Q2WA 3ZN6A 4GSDH 1QKZL 3Q1SL 1Q9LA 1M71B 3K6SA 1JZ5A 1S7UB 3L9YA 5EBMB 2L8AA 3GMLB 4WU7B 4H7VA 4ONFH 4MJIE 2UY7B 1WP6A 2V2XB 3N43B 4UDUB 3VXUE 2FHFA 4NENA 4LBEA 4A1RA 4PS7A 4R3SA 5CO1A 3ZO9A 4Z3EA 3DTDA 1G7PA 3TURA 3VD1A 4GRMB 3ZKXC 4D0BB 4YX2L 2VJXA 4GKLA 2C7UA 4HZAA 5I66A 4EUPB 1ADWA 3K5RA 1CF1A 2Z65C 5D9SB 1MQ8A 2EIDA 3FSVA 2E7LA 3O4LA 3C5ZB 2OJ1A 3MODL 2VC2L 3WG7B 1URIA 1T03H 4GT7A 4KO9A 3IKKA 3POCA 35C8L 3VUAA 4Y4HC 5HYJD 4BHUA 3NZHL 4ZNCD 3ASWA 2XVBA 4DZ8B 1H3GA 3CDGA 3DRTB 1QABA 4OLYH 3SKUD 1S9VB 4J2QA 5J9PA 4N0RA 4QMEA 1FNEA 2G30A 3NCJH 3QDGA 4G9FA 4LF3B 3OZKA 4JFFA 4BK4A 5DC9B 4HLEA 1O9ZA 3V8CA 1RK1A 3LIUA 4GG6F 3GJFH 3OF6D 4ZX5A 4JUTA 3NDYE 2ZQKA 4KNTA 3SDDD 2IV8A 2A6JB 1MFEL 2NX5E 2O5YL 4G8IB 1SOQA 2FBJL 1V7ML 3NJJA 1L9OA 1KTKE 1SBSL 4J3OD 1WZKA 4PWGA 4G7YL 4MB3A 4EXPX 2QEJA 3MLZL 3RY6A 1TVBB 4BUQA 4YFEA 1M9SA 4KKNA 4HG4J 3UEZA 1YPZA 1AGDA 3M8OH 3GMNB 2J4WL 1ZA6B 2OMNA 4BXSV 1DQTA 1XZWA 5IF0A 1LEIA 5BO1H 3CSGA 3JV5A 4U1JB 2YN3A 2H41A 1GR7A 1RLWA 1C5DB 3QCVH 4PLJC 1MAJA 1GRWA 1TFPA 5A43C 1URZA 4U6HA 1FRGL 1FWXA 2Q87A 4Q4EA 5JO5B 1B0RB 5JHDE 1R0AH 3JUZA 4NRXB 5H37A 3MBWB 1IU1A 5BVJA 2A6KA 4ZD3H 1JBJA 3KG5A 4EOWH 3EGSB 5D5MB 4G11A 4S1DD 1QPXA 2ZKHL 4S2SB 2NCEA 3HS8A 4MDIA 2WIMA 1A7OH 3GSXA 3D05A 5EIVA 3PLYA 3MLZH 1G7LA 1CG9B 3V52L 2E47A 3WMPA 3E3QC 4JEGB 5I1LA 2HLFC 1Q94B 4PRHA 3SE8L 1A3QA 4HPHA 3MCKB 4EEEA 1Q9KA 5DURB 2X4NA 2C1PB 4JZOA 4OD1H 4MWFA 2VERN 1W8NA 3ES6A 4PJBE 3OTTA 2DYPB 5FS5A 5C0DB 4OFIA 1QP1A 4FXGA 2UUDK 3D39E 3KVPA 3BUDA 2HH0H 2XWXA 4UZSA 2PCPB 3DO3A 4H88H 4JAMB 5F7WC 4F58L 2F68X 3Q6FA 2KZKA 2OMXA 3BX7C 4Z7VE 4BRVA 1KIPA 2PR9A 3FFDA 2CD0A 2CA3A 1CK0L 2GSGB 4L4VE 4L23A 1LMIA 5ESVA 3ARYA 4AM0Q 2LVEA 2GITA 2CRIA 5E2TL 4H0HB 5GZNC 4OLUL 4MQXD 3WMQA 4JFZL 4F9LA 1BFVL 3QUYA 5EUKB 1UA6H 2J5WA 2MPAH 4Q56A 4PRAB 1VHPA 4RFEB 2Z93B 1DQIA 4R5TA 5AL0A 1OP4A 3WS6A 4D94A 1ZA3A 2XG5B 2VTFA 1DTUA 1F2XK 1N4XH 2P5WD 1JGEA 3HE6A 3RAJL 3UTPE 4G6AD 2QPDB 5DRWB 4O4YL 3P9LA 1H6FA 1NSNH 2G9HA 3CGTA 2VZTA 3MRLB 3O6FD 1C12A 3VSTA 3AUWB 1DQML 1ETZA 2PETA 4KO6A 2D7TL 2E9IA 3IGFA 4Y9FA 5K1JA 4GRLD 4Z7WF 3DWTA 4GXVL 5E2WH 2CPUA 1VA9A 3MYZA 3JTSA 4QRAA 1OGSA 1B88A 2JJSC 2DQUL 5HHOD 4CVXB 3LH2H 3K3QA 3FQNB 3IJ8A 2VUYA 4KITB 1EZUA 3VI4F 4KH2A 3U36A 2Z1KA 1QYGH 3MN8A 2YMOA 1GKOA 1YNLL 3NEOA 4ZUVA 3NIDF 5AQ0A 1QASA 4F2MA 5I76B 4I4WA 2W9DL 1CFSB 1XGUB 1L9MA 1A4JB 1B2YA 1RZFH 4JJ5A 1OXYA 2B08A 4M1CC 1ZK9A 3L3KB 5CJOH 3C2AH 5C0EB 2YQ2A 1N0XH 2AQ1A 2NY3B 4LOEA 4TULL 5FV2A 3APDA 1K5WA 1U41A 4L3EB 3NSJA 3VXTA 4EXKA 5KVFH 4MS8D 4BE5A 2XWEA 2RCSH 3OAUL 4RDBA 1QEXA 1J1OH 3GYRA 4G8EA 4NHUB 1KGCD 2JVUA 4CSSA 1CGTA 2VSMB 2KC0A 3OSKA 3V0VA 4YFDB 2A7BA 3OPZH 4Y5XC 4OVVA 2BCKA 1A0QL 1NC2B 5HHOE 3O3BA 4XMKH 3WUWA 3FO9B 1NFIA 4OM0H 3SPVB 1IZJA 2YOCA 5J1AA 1SBSH 2XFGB 1HYSC 4OZFG 3O2VL 5C0CD 2OK0L 5IMLA 3V5HA 2ZNWA 4J7RA 1KB5H 4TVPD 1NUGA 3O45A 1IGTA 1HX0A 3E6HA 1M57B 2ODHA 2ICWI 1XWVA 4Y2OB 3DYPA 3LN4B 4AZ8A 3U36B 3HC0B 2N56A 1NMBL 3EGDB 4YDVA 5I28A 1HYSD 4F2MB 5I76A 4ZS6C 3UTPD 3LNDA 4QYOB 2P49B 4OLYL 3D51A 3CBRA 1I7RB 1MLBB 4GBXC 2QKSA 2DQ6A 4HKJA 3X1NA 2KT6A 5E6SB 4ELKB 4WW2F 4ELME 3F58L 4PJ9C 1AHWC 4J23A 3DX2A 1CLOH 4PJCE 3ZZLA 2PYED 3S88H 1KPRA 4N2OA 4N86A 3HBPA 4R0LB 1JWMB 2EAEA 2M1KA 4ZUWB 3BVTA 3KNBA 4KMLB 1CFNB 4N2EA 3AWEA 1E4XH 2ZCLL 4FE9A 2ZF8A 3VXTB 4ES8A 4YX2H 5DS8A 3UIZA 4TQ8A 4LFHD 1YUKB 2IBBA 2NNAA 3US0A 5F7HA 4HHGA 3FQRA 3BO8A 3NVQA 4OCWH 5EUOE 2Y3AA 3SPGA 3T0XA 1S9YA 3FH5A 4KHXH 1IC4H 5F96L 1LHZA 3NCBB 3ECWA 3QG7H 4LL4A 3VXSD 3EOTL 1RFDL 3BP4A 3G08B 1YEKH 3HTLX 5F3FA 5IR1A 5INDA 4APQC 3P4NA 2HFTA 5FF6B 3QFDA 2JKNA 1MNNA 2GB2A 4CNIA 2WXPA 5BOJA 5J89A 2DTSA 3CQPA 1JZHA 1XSJA 2WNXA 1G7QA 1X7SA 3ZTNH 1ZGLA 3KPPA 3D3VA 4AZ8B 1BIHA 1RJCA 1SXNA 3HLKA 4R5XA 2B3IA 3FT0A 1KBBA 1RERA 4FMFA 4PJBA 5ENWA 1EBPA 4HGWB 4IIQA 4P5MB 4WUUB 1JK8B 1FVDB 2WIIA 4MX7B 2GW5A 2VZ3A 5JHDD 2MNJB 2YOAA 1MF2L 5D1XB 4ZX6A 4RESB 2BSBA 3RVXC 3ULVC 2R56H 1JNHA 3G3LA 4CBZA 1CFNA 4Y2DC 4B7LA 2XUWA 5DT1H 4KY1H 1D5IL 4PFEA 5IBUG 1FCCA 3W3BA 1GKEA 4OLEA 5DK2A 5LGKA 1LO3L 1T22A 3QYMA 2E56A 3EH5B 4FQXD 4IBQA 4FD0A 4B3EA 5HHOB 3HPJA 4HH9B 4LE8A 3RDTB 1U8NA 3GSOA 1MCFA 4ZZFA 2CBPA 2FLRT 5KSAA 4UMSA 2V5MA 4BYHA 4PBXA 2J1WA 4YHNA 3WN5A 3D33A 3HG3A 4ZMPA 1P6FA 5DA4A 1JHTA 2QHLA 4GQPH 4Y88A 2LLLA 5IBTH 2IQAB 3FT1A 1MWAB 2B14A 2ENYA 3ZDZB 4GEIA 1KY6A 4QRTB 1RZKC 2IPUG 2GHWB 1BQHA 1DLFL 2F74B 4ORGA 4NZUL 4MDJB 3SCMB 1FIEA 1J8HD 5C8JA 3S3DB 4PJEB 3OHMB 2EDBA 1AMXA 4A2EA 4IDJL 3ZKQD 2YSSA 4RGNB 2IMNA 3KPLA 3CZJA 3II1A 3STLA 3GSVB 2OR9L 2BWDA 2B9BA 1XH3A 2AJSH 1TZGH 2FJUB 3L1EA 1HL9A 4QR7A 4AQAA 4AGNA 4UTBH 4XVUC 1VF5C 4NKMB 3QNZA 2V5SA 2OL3H 3BKML 4PRDA 1YECL 1ROWA 1JPTH 1VEPA 3EYSL 1KT2B 2UZXB 1XF5B 2UUDH 4HC1L 4UM9A 2WBJB 4DFIA 2K7QA 5IVOA 1A14H 4YSSA 2IDTA 5AW4B 4KK8C 4XN1A 4F8LA 1L5GB 2R1YA 4HPOL 1PZ2A 3QI9A 2HUEA 4NN6B 3SQRA 2EXWD 1A2YB 3RURA 3L3GB 2YAHA 1U8NB 1BQKA 5IB4B 4AKPA 3U6RB 4FA7B 2Q7YB 2V5TA 1RZJH 3ZE0F 2QVMA 4Z7VA 5ICXA 4IBUA 3QUML 1IX2A 4L8CB 2GUOB 3FPYA 4DKDC 4HJEA 1TEFA 3IGAA 4J28A 2NTSP 3WLBB 4QDGA 3CN4A 3IU4H 1KG0A 4P49A 4WNQA 3D85A 3IETB 1UUSA 3DMMC 2PXYA 3LKNA 1MCWM 4IU2A 2HJFA 5CP7B 2F74A 2IWEA 2V5RA 4LSVL 5HGHA 4F57L 2MHAB 3MBED 2VDLH 2IC2A 4KTYA 4F2FA 3BQUA 1QPPA 3MLUL 1E5UI 1PLAA 2R69A 3VXSE 1NGPH 2DMCA 5AVZB 3RUGE 1CPUA 3CVIL 4DP8X 4GKSB 4UNUA 4O51A 5IVNA 5KANI 1NC4A 3VD5A 3SOBH 3WIFA 3ZKXB 4P05A 1IC0A 3B2MA 5J0BA 4S1QL 1G0DA 1VSCA 2LGNA 4NKOA 2F53E 1XMWA 3QHZL 2FB4H 3BYTA 2D03H 3MV11 4GRMA 2VXSH 3G6JB 3LKQA 4FQIH 3DROA 4KJWD 3SQOL 2VN5A 5DJ0B 1WWBX 3ZTJH 3MJWA 5DHEA 3MXWH 4GOSA 3O6ML 2J2ZB 3BZEB 3TLRA 2UWEF 2YUZA 1SZNA 2XZZA 1CGSH 1MHEB 3GXUB 4PJHB 1FG9C 5E95B 3FZUC 4YDKH 1ZHNA 3QCTL 3KXFE 5DS1A 3ZYIA 1FPTH 1M1SA 1NCHA 4XE0A 5ITBL 5C2BL 5JHMA 1HSAA 4FFWC 2BIHA 2LU3A 1IGIL 2DEXX 4IYKA 4K3HA 1ZLWK 1FIGL 1P5VB 1JZGA 1RUKH 4CAGA 1DEDA 3JQOB 3C12A 1F18A 1TNNA 3IKCB 3WKNA 3TYFB 2Q2EB 4FA6A 4LCCA 2NW2B 3QDGE 3BDYL 4B9FA 2AXHA 1NMCC 1MCPL 4R7NA 3UTTB 4PSPA 2PMZA 2DICA 2JJSA 4OAWA 4GRWH 1SDDA 4WHTB 1BEYL 5LAXA 1B9ZA 2ZX5A 2D7QA 4MMZA 3WI9A 1FL5A 4JO3H 1N6QH 1UB5B 3T6ZA 1ZA6A 3U4KA 1I82A 1MEXL 3DXAE 2ITCA 1UXSB 4C54A 4HULB 4P2QA 5LBVA 3U2JA 3NIGF 4U31A 3LQAL 1EJFA 3LX9A 1ED3B 1TTBA 3WU1A 4GSXA 4FNQA 3WELA 2VLMD 4QRFA 4Z7UF 3BVNB 2NR6A 2FT8A 5BRZA 1YJDH 1QACA 5T1KA 5F3BA 1L0PA 1U21A 4AJVA 1E28B 1T04A 4ZPVB 1T0PB 4PV9A 4ANVA 2HVKA 2NYYC 1GS6X 5IB1A 1GGUA 2VDLB 3UBHA 1S78D 1PLBA 3PWUA 4KQ0A 1XTMA 3CU7A 3I6GA 3X1FA 1F5WA 3V55A 3ARFB 3L7FB 1USQA 3CWGA 3CVDA 5LXGL 3SQBA 4D8PA 1QBLH 3GHBH 4XWOD 4CC4A 1MXDA 5F97E 1D6EA 2Y7NA 3HFMH 4FMVA 4JFYA 2ZPKL 4LKCA 4E5XG 4URKA 2B20A 2DQCL 3BPNB 4TVPH 4LLQB 3T0EB 5DSCA 1MY7A 5I1KH 5DD3L 4MAYC 4OJCA 5BW7A 4Z6AT 2F53B 1GVIA 4TUOA 4XN7A 5KJ7E 3MLPA 3QG6A 1IC1A 4X6CA 4OCYL 1MG3C 4IW4C 4MCZB 5DRNB 4BQBA 4N8VA 4LT7A 5B8CC 1Z5LB 1E8WA 1J7VR 1TJIL 5HHPA 3IE9A 1BXUA 3KPQB 4JRWA 1MHPL 2WD0A 1E2VA 4NSKB 4FQCL 4Z9KB 5L4IA 1NQBA 3FO0H 4FNLL 3UPAA 5EIIB 3T77A 2RACA 5DU7A 1F4YL 4ODBD 2NY4C 3KBFA 1SJHB 1M7DA 4ISVB 3OV6A 1PZBA 4MLIA 1EZLA 2DBJA 3MFFA 4PJHE 5IM7A 4PRPD 2XG5A 5HDQL 2MMXA 4JY6A 4JDTL 1WS8A 2GEQA 5IJVB 1D9KB 1UM4L 3M46A 2K6YA 4OLZL 1I1YA 1UJ3C 3MRLA 1KACB 1OAQL 1KGWA 2QR0B 2N3JA 4M9OA 1SJXA 4P48A 3HHSA 2FJFB 2Z31B 3NJNA 4F9PC 5IREA 1IBBA 4BKLB 1FNEB 3EFDH 3QDGB 3NQIA 1NUNB 3TO4B 3R19A 4FAAB 1DSWA 3AABA 2KERA 2ZWZA 4M5YL 4MMXB 1J5IA 3NZUA 3RA7L 2A6JA 2CBMA 4FFZA 3M45A 1WJ3A 2B77A 4LVEA 3U9UA 3G5VB 3QCTH 5L8LB 1NMCB 4KRMB 2BP8A 3HHRB 1OW0C 2E46A 1P7KB 2J5LB 4N6QA 1D5MA 2I24N 5F8QC 3ZL1A 1GZHC 4KK5C 3NOIA 3FRPB 4C4UA 1J9CT 1RJYB 2EO1A 4FZ8H 4OVUA 3O6MH 2XJKA 3TNNB 1CJYA 3A24A 1DQDL 3S35H 1WC7B 2I5YH 2QLYA 1AGEA 1RL1A 4W9LC 1R24B 2R2BB 2HLAA 4PR5B 4OF6A 3BWAB 3PRZA 3GIVA 1UWEH 5C09B 1UXWA 4GH7B 1H6UA 3MFGB 4DKFH 4KV5F 3RTQD 4Z3IA 5C3TA 3V6BR 3L1FA 2ZUQC 3UAEA 2WO4A 2FSDA 1AGCB 2N7BA 3ZQ9A 3VA6A 1RIVL 5J1TC 2PTTA 4LP5A 4AIXA 5F9AC 2NSMA 4I9WE 3Q2NA 4OT1L 4CMHC 3BVXA 3KLAA 1DFBL 3P40A 4IEFB 3SYQA 1U42A 4HAGA 4WJ5B 3HBGA 4GRLB 4PJXE 2AQNA 4J3UA 3D48R 3EJRA 4DPRA 1AS6A 5FYLE 1X5AA 1FO0B 5GGTL 2DLHA 1BLIA 2XXCB 1IEAA 3Q3GB 1QI4A 4QCIB 3LZNA 3HMXA 5IMLB 3VMPA 3QUXA 1D3CA 2ZONA 2DTML 5GS1C 2JQAA 4MWFB 2WXGA 3V0JA 4B97A 3W37A 3Q8AA 2VJ0A 1OE3A 2MSPA 4IGBC 5D5ME 2G9KA 5C0DA 5CLYA 2VQ4A 4K7PX 4PGEB 3IWUA 3PU7A 5EBWA 4YLCA 1CR9L 5B4MC 2CBTA 3KWXA 1MCKA 2V33A 3OAYH 1REIA 1TLKA 3SPJA 2IADB 4LLMB 4R4BB 1A6AB 1KV3A 4NO3A 4P07A 3IPEA 4NQSA 4LU5L 3VJ6A 4HQQH 4IBLT 1HC1A 2OTWA 3NFPB 4P3DB 2IPUK 4ZJ9A 1PNDA 1G4MA 2ZWLT 2VZVA 1KPRB 3UJJH 3FN3A 2JLPA 4H0IA 3JV6A 5FGCE 5IMOA 2YSTA 2XZAL 4EDXB 3M86A 4HUUA 5EDSA 5HJ3A 2VDPL 3J8F7 1NEZA 2XPYA 3N44B 5AKVA 3CFDA 2VDKL 3PGFH 1JRHL 5T5NF 4OIIL 2YXFA 4MCNA 4BK5A 1PD0A 2CDGA 3EKCA 4IMKC 2N0MA 4JFFD 3GMPA 4JFXB 3VE0B 5L0QC 2IPTH 4EZLA 1KCUL 1TVHB 2VISA 3MR9A 4TSCL 3A6OA 4K2UL 1Y1DA 4OLWL 4OBSA 4W68A 5EFIA 3VXUB 5C0CB 3P77B 1CICD 1RVFH 2Q6WB 3PHSA 2BZ7A 1WCBA 5LB1A 5C3LD 2BVOA 5DK3A 1S7XA 4ICWA 5AAMC 1QFWI 4I0PB 2J20A 3BCFA 4FLRA 4UMGA 5DJZB 5ACZB 3ARDB 5L2JB 1CF8H 4NZUH 4XWOC 2QLVB 4FQLL 5FGBC 3V8OA 4M7KL 5HDBF 5B3SB 1I1FB 5DCCA 1FIGH 1ZMYA 4KQ3H 4PGEA 5I1DA 3RVUC 2D0HA 2P43B 2WWOA 3CXHJ 5CFHA 3KYKL 2TSAA 4LSQH 4BBWA 2IADA 3KWUA 4N0FB 3WIHL 2N7AA 4FG2A 1KBPA 2CO3A 4NO0A 4GT0A 4K7PY 1VFAA 1KJ2L 3ZDXB 1J86A 5B3NA 4PGJA 3L7EB 5E8DH 1RUPL 4UZUA 4KRPD 2P42B 1QNIA 3CC1A 1K3ZA 4WEMB 2WLYA 4CKVX 5AL8A 3V6OC 3MRHB 5F7EH 4FX5A 4TYUA 3QQXA 3GSNA 2IDCA 2K70A 3BAIA 5GZND 3ABLB 5C0GA 3HS0B 4AEFA 3S7GA 4U0QB 4D9RD 1UQSA 3NJVA 5FW8A 4Y5VB 1TVHA 4P4RA 4WEBL 4FQHA 4BEIA 4B3VA 3QDAA 4UF7C 2IANB 2DW5A 3VGEA 1WBXB 4XCYB 4XE5B 3V95A 5I8KH 2GK0A 1YLBB 3C8DA 1DJXA 1LWJA 4F7TA 3VI3A 5CP3H 4PJ7F 2WO3B 3LS5L 5E2JA 1PSKH 4F37F 4PWIA 3TESA 2VABB 3N42B 1M6UA 1QAWA 4KX9A 4LP4A 5JHDB 1NKRA 2A9BA 2WLJA 4P3WA 3A4AA 4G43A 1CLVA 3VGFA 5AAWA 3HFFA 4OM1L 4Z0XA 5KBDA 1HS6A 2H3XC 4I3GA 2VDNL 4KX8A 2ID5A 4QRPA 4S1SH 3NP4A 4P5TA 5DFTA 3WAKA 3ZL4H 3CPUA 4JFEB 2GITB 2KUTA 1S7QB 4JDEA 3NAAH 2J1KA 1A7QL 2N1TE 3I75B 5F96H 1I9JL 1CDYA 1RZJL 1OAZH 1QATA 4LEOB 1DSYA 4H2AA 4FHKA 2I7SA 4APQB 1KELL 4CGTA 4YUEH 2YBGA 4FFYH 1FFPA 1ULVA 1SHSA 1WQVT 1ESOA 3KEHA 4NDMB 3PGCA 5FO7A 3EO0B 1E4XL 2ZCLH 1AYRA 3AXIA 15C8L 4P23A 1UFUA 3L4CA 3D87B 2J21A 3I02B 3U1QA 1E50A 5C0BE 4MJJA 4DQOH 3DV6A 4YVUA 1S7RB 5E8OB 3T0WA 3UTTD 3L3GA 3B34A 2FJSA 1LO5A 2C1OB 3IDJB 1GA2A 4OD2A 2DDQL 2WMPB 3HJ0A 3QNYB 4X5XB 3UZEC 2JIXD 2IOMA 4NJAH 2YAMA 1JZ6A 4MA7H 4Z7VB 1SXAA 2E6PA 3CPLA 5L9DH 3PJLA 3TBWB 2DBLH 1LTXA 2NYZA 2ZOLB 3O3DA 3FQNA 3TXAA 2ED8A 1NCIA 3MUUA 4GPVA 4PJ7E 5GQBA 4GJTB 3T0EC 2VL5B 1JL8A 1OM3L 2X1OA 1E42A 1BECA 4POYA 1V7NL 5LG6A 4XC3H 2PCYA 3KGRA 2W38A 1A4JA 4JJ5B 4ANUA 3IFLH 3CFBB 5JORA 1MPAH 4TS6A 4RFOH 3T4AC 4OM0L 4HLJA 1L9NA 1OOWA 1TU2B 1NPNA 4XXWC 1HKLL 1GTFA 4JPWH 1OAUL 4A2LA 5CZXD 3CQFA 5I71C 2HMIC 3LKOB 3PQYB 5IHUH 3BZFA 1WAAF 5C0BD 3FU6A 3OAUH 2XIBA 2RCSL 1HOCA 4L8BB 1M05A 4RRPG 3LY6A 4QXTA 2I27N 4MMZC 2P52A 4FP8H 5LGJB 1O6VA 3UTSD 1MJUH 1AQDB 3OZLA 1R9FA 4PWKA 1OSEA 3O81A 1A9EA 1D5IH 1YMHA 2G5UA 3GBNH 2V9UA 4UB0H 3WO4B 4C4KO 4DNLA 3DHJA 1DQJA 5J56B 1WK0A 3BLBA 4P9HC 4GI8A 2V37A 4JO2H 4G1EA 1KJVA 1R19A 3C2AL 4NWTH 3VQLA 1F6AA 3HB3D 4HF5L 5EF3A 3EDKA 1MCHA 2GEEA 4WI0B 3EJZD 3RB7A 3R18A 1MCRA 3NYKA 4KXBA 1XB3A 4K3DH 4PIBA 1UD5A 1JHTB 3IRZA 3CX5J 3INOA 4CSPA 5JXEC 1XAKA 4HCFA 3WJMB 2E3VA 1VDGA 4R4FH 5TDPB 1T3FB 2KZWA 4Z3JA 1MCIA 4GQRA 5TJWK 1T5WB 4JCMA 4GXVH 2IDQA 4OZGB 4UBDD 5C0JB 4ELKA 5F1KC 5C6TL 5HPOA 3FUHA 1DO5A 2GJZA 5DVPA 3RL2A 4U3SB 5ID0B 1N19A 4ZUWA 1U6AL 1IM3D 2H32H 1HZLA 1NSNL 1NAML 3EOTH 3CXDL 4H8HA 1OP5K 1N7MH 2ZZUT 5IHLB 1YVLA 1INEH 4OZGF 3UJIL 1FL6B 4RX4A 4YDZA 4A2MA 3U0PA 3NIFF 3K71A 4D3CH 1GYVA 1HOCB 2ZG2A 3FKUS 3AUVA 4YXLL 3I9IA 2ITCB 2IAND 1ETJA 1HNYA 1I8IA 2CCWA 2RR3A 3M1BB 5IFAH 2MPAL 4HMDA 1O0VA 4YSQA 2CO4A 4XNBA 5HYSB 5GZNA 1EHLH 4QTIL 2G0LA 1CLCA 2A83A 1IC5H 3VNZA 3D1MC 3SDDC 1FGNL 1A7RH 1H3XA 3W2DL 2E7BA 4FQPA 1O9WA 3TBYA 5INDB 1IE5A 3FQWB 3RNKB 4FERA 4L1BA 4YSTA 2B16A 2B4CH 4NQCB 3T2PA 2MWCA 2VDRL 1S9WB 4UQ9A 2V5YA 1Z3GL 3GGWB 1M9WA 3IXAA 3TBTB 3L5WB 3T5WA 2D0GA 3IGAB 2PR4L 4Y9GA 4ZMXA 1FL3A 3HI5H 4BHUI 4PJHF 5DQDH 5EHFA 3X1GA 3PP4L 4ZW3A 3WJMA 3QQ3A 4ZW8A 1HZKA 1DEEB 4HJTA 4IIQB 1GC1C 1S8DA 1I7UA 1N5YH 5HGHB 5CD3A 1ZSDA 1RULL 4MB1A 5EZLB 2NT0A 1GPOH 4PVBA 4APQD 2BNQE 3TH2T 3PQYE 3WN6A 4QHLA 1NFAA 1FAKT 1YC8A 3DX9B 3WDJA 3ULUE 5A2AA 3TCLB 1HXYB 5E1IA 3FB8B 3R0MA 5B39B 3RUGF 3D34A 2Q1EA 4D9QE 2MOGA 1KIQB 1YEFL 3N41F 4H8WC 3V5KB 4S0SD 2OI9C 2ZX6A 1MXGA 2C3VB 2EICA 3GMQA 3AQXA 3ROOA 1JHLL 2Z9TA 4X6EB 3F7QA 4BQ8A 1NBQA 5FWQA 4MYWB 1O7DC 2IBZX 2VDML 3GSOB 1YEDB 1OB0A 2KYIA 4PJ9D 1QRNE 4N3UA 3SDDA 1M2VA 2WKLA 2HFEA 2XRAL 2VDMH 5IWLC 5KSAB 2WOYA 3T77B 5EIIA 5AOKA 1VADA 1D5BA 5KW9L 3PG2A 4GAGH 3ZK0A 3KLHC 2BSDA 1ACYL 5BO1L 3MFFB 3UH8A 4DP5X 1NLBH 1EHXA 5CLXA 2J88L 3H42L 1N0XL 2L7JA 3EHBD 3ISWA 4X7FC 3UTSE 3D2UA 4U6VH 4ZTEA 3TN0A 3L5WA 3UO1H 2LU7A 1ZKAA 2F54A 2XVGA 1CFQA 3MNWB 3EG9A 4N2HA 3NK3A 3RRQA 3LNEA 5KVGH 5EU5B 3TFKD 5D7KE 3WV0A 3GHEH 3IU3B 4JKPH 3G6JE 3I9AA 5CUSH 4QHNB 1C08B 3PHAA 3GSVA 4NUJA 1RULH 3HBQA 2W81C 3DTXA 3E0GA 4Y5YA 3VH8B 1XH1A 4YNYB 2BOLA 4KZDH 3UABA 4K5LA 2APFA 4OY9A 3S34L 1WAAA 3QNZB 5TFSH 4CW1A 3EF7A 3PP4H 4JM2A 2BY0A 2VDQH 5AWNL 3WIAA 3SDXA 2X4RB 1KCVH 4AC4A 3FUFA 4DN4H 2PR4H 2Z92A 4UQCA 4BFOA 1DBAL 1JN6B 5F3HB 3VRJA 3R1GH 1OT4A 3JT2A 4ZFFB 1G9MC 3MRCA 1X9RA 3Q05A 3OKOA 3K2UH 3OKLA 3TH3T 3SE3C 1LO4L 3FQXB 2V2XA 1ZT4B 1I1AC 2DMGA 1YUHB 2FX8L 2EC9U 1SOKA 2XWJA 3HE7A 4L48A 5IFJB 5G2NA 4UAOB 1FLTX 4N87A 4ODWB 3GIVB 4HOXA 4H8PA 2AZUA 4Z7AA 3UTTE 5E2TH 2LU5A 4KQ4H 5DI8B 1IARB 5BRZB 3UG3A 5IMMA 4JHWH 4QTFA 4OTXH 1CFTA 1CK0H 2FWOB 3NCXA 1OAYL 4L3AA 3ME0A 3IETA 3VYOA 1T89A 3HN8A 1XCQB 3F12A 3F2LA 4P2YA 2Z31D 4UYPA 1NAMH 4Z5RA 1IL1A 4H88L 2Q8BL 4Y0GA 5LNEA 1RP9A 4HFUH 1KB9K 3QUYC 3TV3L 1RZKL 2CRYA 4LHUB 2XNAA 1KN2L 3DLQR 3KPSD 2VN6A 1KCVL 4JN2B 5IJDC 2VDQL 4C57C 3VYPA 4BFIA 1IE4A 1IEAB 3Q3GA 5E1AB 2BSRA 5TDNA 4PGBA 1YDPB 1HU8A 4XI5C 3I2CH 2R8SL 3UYPB 4U1LB 1RZPA 1KIUA 2YXWA 4N5UA 4XP4L 3A3YB 4FRWA 4JRLA 1LP9E 3AVEA 3FUDA 4BWWA 2YD3A 4K3DL 5KTEL 3GJFK 4Y7MA 2OJEB 3P3TA 4AQ1C 1YQ2A 3CBJB 2XWZA 2X4UA 5I1IL 2VDMB 1RZ8B 3ELAT 1A7OL 4NQED 4BINA 5D4HA 2LQRA 3HA0A 3S35X 2I26N 4N25A 2EH7H 4F27A 3SKMB 3MJ6A 4QRRD 3K6OA 3ATEA 5CCKL 2CUAA 3N42F 4N8VB 4IRSC 5B1BB 3O3AA 1OAKL 5CBEB 5LN8A 2A6IA 3VG9C 2PCFA 4JQIA 2X2IA 2EDFA 5F9JA 1M7IB 1FLRH 1JG9A 4R90L 5GPRA 3SB3A 3TM6A 2OYLA 5E99H 3VQ2C 5I16A 3FYIB 3BSZA 4PJ8A 4L9LA 3QDJE 3T1WA 4FEIA 3FMGH 2DWTA 4K4KA 5EU3A 4PJGE 4JO1H 4P2OB 4AI7A 4QOKB 3D3VD 1WPCA 1RJZB 3ATBA 3CIAA 3GSXB 2C9VA 3M8OL 1PZAA 2OMUB 1NBVH 3MREA 1H5BC 3VO0A 1MKFA 5HDRA 4G7YH 4PRHB 1VB9A 2DM3A 1HH6B 5JW3H 2LAGB 2E74C 3DJTA 3L3HA 1I3GH 4YIQA 5B8CA 4R7NB 1MRCL 3VG0H 3W57A 2BSRB 2ED7A 3WO4C 4KROD 4XNYH 5D7SH 4PI0A 1SDDB 4WHTA 4MMXA 1Q9LB 4XP4H 4ANXA 3HRZA 2BCMA 2Y7OA 1QVOB 2VLLA 4MMZB 5D7IE 4AV5A 2DLIA 2QSTA 2VE6B 4NWUH 3QC5X 4DCQB 1UM6L 2ED9A 2UY7A 1QLFB 2ITFA 3K6IA 3E2HC 3ZLQC 4R3SB 1A6TA 4J5VA 3QXTA 5HVHB 1CD0A 3PAZA 3ML9A 2G5BB 3TV3H 4J3VA 1NIFA 5I8CA 4JK0D 4G6AC 1KCKA 1GGBH 1E5YA 1KB3A 2I7OA 3HE7D 3DJZA 4LVHC 3DA0A 3LKRB 5JPNB 5SX4I 1WC7A 4JGUA 1T21A 4XPAL 3FSAA 1PKQB 4CMMA 5EU7C 2VXVL 5EC2B 5IQ9A 1R24A 2E9GA 4JHWL 3LS4H 3VFWA 3K6DA 1W0WA 2EDRA 4JUSA 2CLVB 3MJ7A 1J0KA 3UMTA 2WLIB 4RCAA 4IQHA 1MCCA 3QUYD 3IJSB 1FF5A 1BREA 4HKZA 5EO1B 1UQSB 2K9FB 1MHHB 2BSTB 2X6BA 1MCJA 2NUTA 4UOW1 2HUHA 3VRIA 4KK6C 1ORQA 2BJML 2XWTA 1UH3A 3KWWB 1NWOA 1C12B 1QKZH 3Q1SH 3JWOL 3QUXD 3AS0A 4HD9A 3ABKB 4JREC 2R0WL 4POUB 3AQZA 1VZHA 2X6AA 4B60A 2YFOA 4DN4L 4WQOA 1U91B 4OM1H 4DK3A 4N9GA 2ARJQ 1LDPL 3UBXG 4YLQT 1PDKB 3PAVA 1NGZB 4ORZC 5KVMC 5IBLD 3IYLW 1Y7VA 2NXYC 2VE6A 1QA9A 1T2XA 2FEEL 1QLFA 5KS9E 1UD2A 5SWZD 1F02I 3PJNA 3T65B 4FDWA 3VD4A 4R7DB 3VFUB 2DH2A 4JKKA 2FYYB 3O9WB 4GINA 4WJKB 3DYOA 1U3JA 4C47A 5C70A 1IO4C 3APCA 1EAPB 3PWJB 5ANMA 4D9LH 5JO5A 4J1UA 2GJ6D 5DK0A 1ORSA 1U8CB 4MQ7B 5EWIH 3L3DB 4HWEL 2DLFH 1CT8B 1J9RA 4OKDA 4UIMB 2JSFA 3UG5A 2XA3A 2QGBA 4XNZB 4JKLA 5FFOA 1FFPB 5DWUL 3GBNL 1KTRL 3MJ7B 2EIMB 3Q1EA 1A6UH 3E1ZA 4AQ1A 2YEVB 2R29A 4ZO6A 4U6YB 4PAZA 5DS2A 5D4QA 2VWEC 2VDOB 5MEPB 1U8MB 4LSPL 4ZG1A 2C1OA 3IDJA 5EU7E 1IVTA 3BYYA 2F2HA 3WD5H 4RMTA 1U8PB 2CAKA 3ETBF 4JZOB 2BOCB 2CLRB 2GTWB 3TBWA 4XCFH 2G2RB 4P57A 1AP2B 1JD9A 3V4VB 2IOOA 3O6FA 5A2LH 3REVB 4AIZB 1AZNA 2DIBA 2ICWB 2JKIS 2WBJD 4ONOA 4XPBH 3V0IA 5DMYA 5I26A 1RHHB 4LHJB 4M7KH 4P46A 3CFEB 3IVKB 1V8HA 3QQ9D 2FCBA 3UAAA 1KYAA 1IAOB 4EE2A 4IK7A 2O61B 4U33A 5SWZA 2XV6B 3K0WA 2OQJA 2J6WA 4JPVL 4ATTA 2HLAB 1AKJA 3QZWG 2HX8A 1C8QA 2G75B 4OLWH 3EHBC 3LNFA 2P5EB 1F45A 1OT1A 1VFAB 2BSCA 1CXFA 1KBWA 1LP9A 3C6LA 3QAZC 4B27A 1YEEL 5A2FA 4DTGL 2FIKB 5IB5B 4Y16D 2P44B 3BVDB 1KBVA 4M93B 1JWMA 1QOKA 1NC4D 3ABGA 1J8SA 5I0XA 1KGJA 5AKTA 1N67A 5HJBA 3QZLA 5D6DA 1Z2KA 3L13A 1IC5L 4M5TA 5BVPL 2CKBA 2ZSVB 3HS0A 2OPCA 1JWUB 4F8QA 3H54A 1OP3K 1OB1A 1FO0A 2WYTA 3MRJB 1NMAL 4KTDH 1GH7A 5K33A 2E9WA 1DVSA 1Z9SA 2UX6A 3UO8B 1KNOA 4PJCA 4YR6A 3VM7A 2EC8A 4F3FA 4RAHA 5IW1B 1ACXA 4M8VA 3GKWH 2B1AL 2IH3A 2EIZB 2OSLB 3BP7A 2HTKD 5CBAA 1NBYA 2P8MB 4Z95H 4Z7NF 3ML8A 3PPEA 4YL9A 4UOZA 1SJEA 1QFHA 2R27A 5F1SA 3O9WC 4DUVA 3F5WA 4KOBA 2H8PB 1OCWL 5D1QD 2B0SL 3BAEL 1RHHA 2X10A 1G6RA 3KL0A 3CHPA 1F1DA 2CH8A 4RGND 4GAAA 3X1EA 4BE6A 1T83A 1ZLSL 1JFQH 5ALCH 4P3CH 4J3WA 4RA0C 5DD6B 2BVYA 5GGTH 1PSKL 3SKJL 2ZKYA 5CHNB 3SYPA 1PG7L 1X7QA 4R4ND 3KDMA 2WVUA 4XX5A 4M7ZC 1L9SA 3ZE1B 3EDFA 1ACCA 2R9HD 1H3UA 3WE1A 1JUFA 2YJQA 3I3EA 2ESVE 4ONGH 1SM3L 1DANU 1NIDA 1Y6KR 3QISA 4ALAC 1AZVA 1HDMA 2ZAHA 1HEHC 5DJXB 1F13A 1P7QA 3DYMA 2W59A 1BAGA 2FEDC 1ZHBA 2NQCA 1UWEL 4GEJA 4MLSA 1NM4A 3EOYG 3UXFA 3JVGC 3VXQA 1ASPA 4I48A 5JW5B 5DQ9A 5EEVA 3S35L 4FP8L 4XO3A 5F9WB 1XF2A 4EQ2A 3CFJB 1AG6A 2BSSB 3MYJA 4LCWA 3SE9L 3QQDA 4LVNB 1MFBH 1P84K 5AZ2L 1OCRB 4JRFA 1TQSA 2CMRL 5IFHL 2A1WL 2OSLA 1W15A 3H4FA 4YDJB 3B2PA 3LVTA 3B2UC 3OC5A 3GK8H 5IB2B 3KVQA 3WXWL 1TT6A 3AFLA 2R39A 4NKIH 4QWWD 1FNGB 5DJDB 1XBRA 4ETQB 2GAZB 4L1DA 4MJIB 4Q52A 1N6UA 1V05A 3GS7A 3IS1X 4FEMA 4YXHL 4EIUA 2IFFL 2BWIA 5BRZD 1I85A 2WJ5A 5CEYA 5A2IH 1QG3A 2DI8A 1ZVYA 1KFAL 3ZPDA 1EAQA 1K4CB 1G9MH 1TU2A 3H9SD 1KTLA 1KTDB 2MKLC 3TCLA 5C0CE 4GG6E 1PG7X 5IQMA 1Q0XH 1Y6NR 3QDMB 2DBLL 1FDLL 1I8KA 4BFRA 5GRJH 3PQYA 1SXCA 4IOFC 3TN0C 2G60L 4U1IA 3JWNE 4KDTA 1L0QA 2NCMA 4PMFA 1UOKA 3PL6D 3MLTA 3WY2A 4L18A 4YZFF 4H26B 2VXQL 3FO0L 3GJFA 4FNLH 4MXVF 3DVNB 2ZXBA 4MMXC 1F11B 5GGTA 3TH4T 3QXAA 1XBDA 3MLYH 1HSBA 3HMXL 3SDDB 4KMTL 1NDMB 4U2YA 3QRGL 1D5BB 2YN5A 4NO5B 2N4IA 1MJ7L 4K0OA 2FJHA 4OQTH 3QYNA 1A5FL 1F6AB 1NDTA 5HGAB 5HVFB 1V3MA 4YHIB 2F53D 3CFIC 3EYOA 2FD6L 5B1JC 1LEGB 4GLRI 1M6OB 4G42A 1VGEH 1G7QB 3HLAB 1TETL 4JRYA 4OCSL 4Y8AA 1IGCH 4BCYA 3SDCD 5KVEH 3NA4A 4TNEA 1O9VA 4E9TA 4YEEA 3EDJA 2QGCA 1CLYH 1TFHA 4KNSA 4XTRC 3ECVA 3CDZA 4TVUA 5DD5H 1GCFA 4KI5C 4QRUB 4UUJA 1XF4B 5FCSH 5BRPA 3FQ2A 3QJXA 1OQOA 1FAIH 1TPXB 3A4EA 4CILA 5IJBC 4Y5YB 2FH8A 4I18B 3I75A 1IM3A 1QLEL 1UYWL 2GIYA 4LSRH 1OP9A 4U3XA 3RL2B 2X4RA 1IIIA 2W0PA 2VR8A 3FL7A 3EBHA 2Z4QA 3S4SB 5C1MB 3C60C 1R75A 1TIUA 2CE6A 2R0ZH 3LRKA 3MGTB