4GIOA

Crystal structure of campylobacter jejuni cj0090
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
QNTVILGSNLPKSLVKQFQKRINSNGYLEFEVILRSTFAKDVIYKVDWLDKDGFVLRDVLNEDYQALRIPAGQEVILRKLASDTRANDFRLEIKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of the Campylobacter jejuni Cj0090 protein reveals a novel variant of the immunoglobulin fold among bacterial lipoproteins.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Unknown function
total genus 15
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07233 DUF1425 Protein of unknown function (DUF1425)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gioA00
3O0LA 4GIOA
chains in the Genus database with same CATH superfamily
1SFHA 4JJHA 1KLGB 4Y16B 4TSBL 4KK5C 3SDCB 1WZLA 3W11C 1MQKH 4TXVB 2PYED 3BKML 3P40A 1UGKA 4H88H 1WC7A 4QRFA 2ZUTA 4K8RC 2Y3NA 3HJEA 4ZQTA 5ITBH 4N28A 2K78A 5FK9A 3IJ9A 4NKMB 3VXTB 2ATAA 4LSPH 1RLBA 5AW9B 5EULV 3IKCA 1HE8A 2D0HA 3KJ6H 1IE4A 1MXGA 1X5MA 1AS6A 1ZGLM 3JV5A 4HD5A 2OMXB 3HZYB 3EBAA 2XQBH 1L0PA 1TCMA 1DQQB 1NCNA 3JUYA 4JR9H 5MERA 2K70A 1GGBH 2P45B 4HMCA 4FQJL 5FW7A 4PRNA 1DDHA 1CD8A 2ZOLA 5F70A 3T3PF 3NFNA 4PB9L 1VFUA 2C3HA 2GFBA 3L5WB 5HDBB 3MI6A 4HXBL 3QUGA 1XF3A 1DBJL 1RUKL 4AYBA 3D1MC 3RWIA 1IBDA 5IT2L 4G7VH 3AG4B 2AITA 5AB9A 2KDYA 1EZVX 5C0DA 2PWHA 2FE0A 1YEHH 3S36H 4S1SH 3MRBB 5DRNA 4XPBL 5AOJA 3WIFB 2OJEA 4RAUB 4KZDL 5AYUL 1K5NB 4BSVB 4C56B 1FSKB 2TSAA 3D85A 4MXVF 3U83A 4FG0A 3UBGA 1UXSA 4PG2A 3BUBA 4ONOA 3S4SG 4ZUWA 4LHUB 1A7NL 3FO0L 5D2NC 4ELMA 3T9WA 5GS2H 2CR6A 2H2SC 5KSBB 3RFZB 4OCRH 2O6DA 4GG6E 5F21B 1AYOA 4MJIB 5DUML 1F8TH 5C09D 3OGCB 3UOAB 3D52A 4MAYB 3HAEG 1RZJH 5EIIB 2X6CA 1WBZA 1CE6A 3CLEH 3CZFB 1HYRC 1VENA 1UJ3C 2A74B 4OW6A 1PLAA 3BQUD 5CEYB 5SV4A 5IFAL 2ICEB 2BY3A 4QLWA 2Z31D 1M3IA 5F7DB 4P2RB 4WHYG 3HS8A 3GPEA 4ZAKA 2ZE0A 2FYYA 1BX2A 1GMEA 3P73B 3VD1A 4P9HL 5KVMC 4LEXL 1B2WL 1F4WL 1UURA 2F6AA 4AENB 1UJ3B 4GXUM 3NABL 5JIPA 3KLHD 2OTUA 4G82A 3QCVL 5K1NA 4WW2F 2CK0H 3T0WA 1F4YH 5EH1A 4JPIA 4EXPX 3DUUA 4M7ZC 3NIDE 1QSVA 2BOBA 1DQLL 2WYTA 3G5XA 3QPXH 3DECA 5IW1B 1JK9A 4WAFA 5FO9A 2VIRA 3TBVA 1KJVA 3ULVC 5KYNA 2J57A 1BWMA 1I4FB 1K2DB 43C9B 2R69L 1H5BB 1N70A 3MGTB 1TZGH 4O4YL 4XWGH 4ZFZB 4EUPA 3VQ1C 5T33L 3DTUB 4PV9A 1ZXQA 3EF7A 4UQ3A 3FB5A 4TL4A 3WLBA 4LARH 1QWNA 4R4ND 1WHPA 5L6YL 1LQBC 5IG7A 1GIGH 4HS8L 4QPEA 5KBNC 3SDDD 5E70A 1XGRB 3OKEB 5H8DA 5JXAL 4PRPD 2RFXB 4OSUL 2XWBB 3R0NA 4TQEL 2GG1A 4FKHA 1XGUA 4GUOA 4GUPA 1Y6NR 5AYTA 1ACYL 3PHOA 5I8OH 5D1ZC 3VXOA 5J6HB 5EF1A 1ZRUA 1VAHA 3ZJAA 2FBOJ 3L7EA 3L4VA 5FGSA 3QRGH 2Y07H 3D2TA 2G2NA 4JPKH 2FIRT 3ABGA 2CO1A 3AWGA 3D2UA 2ZOTA 5E00A 5EZJA 3CX5J 2QQLH 3OKDB 2GW5A 1I7ZB 4GEJA 3QG7L 1JP5A 4JFYA 4KMTH 4UAHA 4XN1A 3DGDA 5D7EA 4BFNA 4CDGC 3TPKA 3K6SA 3FZUD 1T0MB 4YLBA 1TLMA 1U3ZA 2HRGA 2WCPA 2OZ4A 3T0AA 4ACPA 4DOHB 5CBAA 2OXGA 1WBXB 3TTSA 2V9TA 1P1ZA 2XQYG 4QRUA 1QBLL 1E2VA 3TF4A 3INUL 2XBZA 2NYYD 1SY6L 2OMTA 1HHGB 4FLHA 2PWDA 4EI0A 2AK1L 4Y1AD 4EN3D 2X5PA 3NSFA 8PAZA 3T77B 2VLKE 2N1TE 2F19H 1UA6L 4LVNC 1NUNB 5FF6B 3HKFA 2LVCA 1G7IA 4K5MA 2P5WD 2YRLA 2X4QB 4G8GE 5H37A 3N85H 1OZUA 3UBXA 2YAOA 3HUJF 1VJSA 3QPKA 3VXTA 5D96C 4JHUA 3CFMA 4OVVA 1JYWA 1MCEA 4QXTA 5LAXB 4Y1SA 1MIMH 2CNYA 2JJUA 1YYCA 2UWEE 5FKAB 2PR4H 2BMKB 1RZIB 2A9CA 2OMXA 3HZYA 3U30C 4LSRH 1XHHA 3MFGB 4HULB 4P59L 3B43A 5LQBL 5BPPA 1LDPL 2W0FB 1WFJA 4DP5X 3WSQL 3AU1B 3IDYC 2VLJD 1ULVA 5D7JD 3VWKC 3SYOA 3L45A 2H26B 2I32A 4CJ0A 1X5ZA 4CC1A 5JW3H 1TPXC 5DK3A 1I75A 3EOBA 4HOMA 3LRHA 1PTZA 3LAFA 2OSXA 4WWID 1XMWA 1BAGA 1FYTE 4P04A 4UDUB 2YXMA 3ABKB 5DWUL 1AMYA 4E9YA 3KGSA 3HC3L 3E9TA 3B2PA 1MAML 2IGFH 1IGJA 1C5DA 5C2BL 3WFEL 4AYMC 1CXFA 2A9BA 4K5OA 4X9BA 5A6LA 4YSDA 3WNIA 1MCKA 5FC9A 2J72A 3T2PA 3LIZL 5AOMA 1E9QB 4JPWL 4KK6D 5IEHA 1JIBA 1OK0A 1XGYH 2FT8A 2YUWA 3BDBA 3M7FB 5IHWA 1K85A 1RVFL 3BW9B 1I8IB 1M6OA 2ZKWA 2YBRB 4L48A 2UX7A 5CSBA 5KSBA 3MO1B 4GQZA 3JWOH 4JFXB 5IHLB 2R2HB 1ZANL 2NX5E 2WQVA 1QLRB 1EWHA 4IBQA 1HJCA 1NCCL 4DKDC 5BRZD 3DV6B 5ANMB 3H2PA 1Z2KA 4GW4B 3T8XA 3DHUA 3TV3H 3SKJL 2COQA 3C5JA 5IMLB 4FYTA 4ZPTA 3MVSA 5D2NA 4NP9A 1C8PA 1YN7B 2Q6WA 5DS8A 3RTQD 1DQTA 1OSYA 3BAIA 1TU2A 3DO3A 4UDTA 2V33A 5C86A 3CLFL 1JGVH 3MBWB 2V2TB 1E28A 3U46B 1LGVA 3E0GA 4AT6A 4MA1C 3B56A 1NGWB 1UJ3A 5CGYD 2FGWL 1I8MB 3NN8A 5GISL 1JGUH 1S7WA 1U8IA 3DUHA 5TDPB 3HC0A 3LEYH 4G9FB 2H45A 1GGCH 5D7IF 2CO7B 4P9ML 2WY3B 4JPVH 1JHLL 4B96A 2FIKA 4IMKC 2WINB 3VRLF 1QFUL 3BMVA 4HBCH 1I4FA 1JZDC 1OTTC 3BCDA 1SEBB 5D70H 3WFBH 2EDOA 1NPUA 4Z7QF 4I9XA 4YFLI 3EBGA 3NZHL 3W9EA 1ZWIA 3Q6GL 2XJLA 3QI9C 2XG5B 3DI2B 5H2BB 1T03H 2WLZA 3W39B 4U4BA 5C2UB 5CU9A 2N0MA 2FZ3B 3PUCA 4NWUH 4HVBA 4PJFB 1SYVB 1M2VA 2V2XB 3LVTA 4ABUA 1SJMA 4KAQL 2BNUB 1KB3A 3KCWA 4X50A 5EN2A 5T3ZL 2XWBA 1KIRA 2AERT 3ENEA 5BZWA 2ADJA 3HE7B 4NZJA 1WIUA 3VD2A 3A24A 1XIWB 5E7BA 5C0BA 1OOAA 5F1KC 3QUZC 5D4QA 3RWJB 2DM3A 3IPEA 4HLEA 4JFDB 2VLRA 3EJTA 1IAIL 5I66A 5DS1A 1NJ9B 5E51A 5DQ9B 1R33A 2O1AA 4PRAB 1I1AB 1MFAH 3PAYA 3V6OE 4U1JA 2NXYB 3UGEA 4ZD3H 3FTGA 1I7UA 3IMSA 5D1ZA 3TP4A 1A0QH 1U3HB 2QADB 1ZT7A 5E7FA 2GY5A 1E0OB 1SBBA 3JT0A 4IBSA 4QRAA 4XO3A 3IAPA 3SE3C 3L5HA 4BE6A 5LKNA 4TSBH 3X3GL 2BIHA 5BNXD 2VR6A 3CFKA 3S7GA 4XAWH 2CDGB 1HHGA 3NEXA 1KCKA 1KYOK 3FT0A 2Y4SA 1X44A 3L3OC 5I6XC 4Z7UA 4PP1D 5FF6A 3JWNE 3KWWB 1SXNA 5JHDB 1X4XA 3L1EA 5DURD 4B0MB 4M56A 5ACLA 1LTXA 5LGJA 2V2WB 1XGQB 1RL1A 3MBXH 4G6AD 3ECUA 2SEBA 4JO4L 5I1JL 5AOIA 2QBWA 2JH2A 1RZIA 3KVPA 4XVOA 5D4IA 1CT8A 3QWRD 3O8XC 4E0RA 1BLNB 1FNLA 1X6NA 4HSQA 4MA3B 3CHSA 1GS8A 2RH0A 1Q9KA 3DJRA 3Q2VA 4FQJH 4ODSL 4ALAC 2FVNA 1URLA 2C7UA 2QFRA 3BD4A 4QJ5B 3L95B 2G5BB 2J55A 3RVTD 4N85A 4PB0H 3C5SB 1A02N 1PLCA 4JUTA 1QRND 1MY5A 5DHXB 1NCDL 3I6GA 4HXBH 1DBJH 1RUKH 1BW8A 4PVMA 3OKOB 4E5XG 1H6EA 4J3OC 5CLZA 5IT2H 3PNRB 2MIZA 2RIKA 1T7ZA 4DQAA 1U92B 3K2UL 4UDUA 4R3SB 2NPLX 4BUGA 5GGSY 4Y5XC 2OMVB 3VWKA 3DBXB 4KZDH 3N40P 5AYUH 2WLKA 4XNQB 1U8KB 5EO0A 4S11A 4ZMWA 1OWWA 1XB8A 2DQIL 3L4WA 5C0BE 2VN4A 3VFUB 5EZIL 3PE9A 2VLRE 4MBOA 4I3RL 1A7NH 3FO0H 4QRSA 4V2BA 5DDHA 3GZKA 2BSED 2RD0A 3MJ9H 1I8IA 4Q7DA 4KKCD 1DJSA 2CNZA 2GQHA 4AYFA 4NQCE 4B9ZA 1QLRA 5EA0L 3SE4C 2D2OA 2V6HA 1N6UA 4M7JL 5HHPB 1X7SA 5ANMA 4LSTH 5K5YA 1H19A 2X2HA 3MRNA 5HYSG 2EUWA 3ZE1F 3DHPA 2PPEA 3D39E 1BEYL 2CCLA 2AF2A 2G2RB 4KXZI 4CVXB 1CI5A 5HY9B 3AC0A 4DFHA 1NINA 4KU1A 3ZW3A 4L3EB 5CHNA 4BBWA 2OMZB 1ASQA 5AW2B 4OV5A 4KO5A 5DHVH 4P9HH 4LEXH 1B2WH 1F4WH 2VB5A 2HAZA 3NRFA 4Y4FB 5LGHH 2YD7A 3QCVH 1P53A 4NQVB 1NMBH 3I9AA 1X5YA 3TBTA 3RB7A 4EZJA 4X7TB 3C6EA 5TQ0L 1OW0C 2WNWA 5IMMB 1OB0A 2OXHB 3IJEA 4V33A 4UIMA 5A16B 2EE2A 4JRYD 3ZK0A 3D0LB 3T4YA 1KGJA 2R69H 3CU1A 4JREC 3MRLB 3TU6A 4IK6A 4MQSB 3MRKA 3CFQA 4P23C 5T33H 1BAWA 3GMOA 4CKVX 4DEUA 2NNRA 3LKNB 5CNHA 5HJ3B 1VERA 3VFOA 1JL8A 1T1YA 5FOBB 4RLDA 4N8VA 1PKQE 2AEPL 2QT6A 5L6YH 5H2BA 4H8QA 4HS8H 3FMGL 4OZFG 3RKPA 1CBVL 4IMKA 4KV5F 1O6SA 2XC8A 1R24B 3P9WB 5K1VA 5JXAH 2EC9T 2CGRH 4BQ8A 1KGWA 3JTTB 3MLPA 2QVKA 2OYLA 4AIZB 4OB5H 3LN9A 2PP7A 3QI9A 4XZUB 3SGEH 4JM4L 1ACYH 3SKNB 1YEEL 4KHXL 4F7CA 3MV9B 3FU8A 2DBLL 2DM2A 2GHZA 1JDDA 4WSGA 5T5FA 2A38A 3GSNL 5CZXC 1UD8A 4L4VA 3X13B 1KYFA 3HI5L 2NY4B 3EO0A 4A7GA 4ZMAT 3PYCA 2F54D 4IBVA 2BIQA 3K4ZA 3IYLW 3OKNA 2VR8A 1E5UI 2UZYA 3TBBA 4HUWA 5HYIA 3QUZA 1SUHA 1XAKA 4PRIA 5F9WC 4I48B 4KKAD 1I9JL 1Z0NA 2YLKA 3RUGA 4JB9H 1UATA 1Z3GL 2XA8L 3CV5A 4FG4A 4UTAA 1QBLH 5J13B 3INUH 4R97B 4CNIA 1HYSD 1SY6H 1JZ5A 2MNUA 4X83A 4L8BB 2UY6A 3FHEA 2NCMA 2CDGA 3QEQA 2K9FB 1CYXA 5CBEA 5I1KL 5J1SC 4FQIH 3SQBA 4LCIL 3RI5K 1UENA 1IJ9A 1X5LA 4URKA 4GRWE 3SE3A 2XLLA 1CN4A 2GSIB 3RWFB 5FGCB 1W0VA 2XZCH 4OBRA 4C4KO 4JCWA 3KJ4C 4XNBA 5DMIL 3L3OA 2Z8VC 3ZHDA 5G2NA 1E2WA 3QUYB 4P59H 3TNMB 4F37K 3L4XA 4GKZB 1FL6B 3QJHB 1UASA 4XB3A 3WSQH 1TJIH 4M3HA 3ARXA 2G5BA 4GAYB 1S78C 2N7BA 4LVEA 3KJ4B 3ZHNA 4Z7NE 1XO8A 2NDFA 4E9TA 2OSLA 5ISZD 3B3BA 3O8XA 4LT7A 4BK5C 3NP3A 3H7BB 1NICA 3HNVL 1VDGA 5E6SB 3SE9L 3QJFB 3G6JF 1OGSA 2IALA 4M6NL 5DWUH 5SWZD 5E6IC 1JI1A 1O7SA 1JPGA 5E1IA 4AH2B 1PX8A 3L1GA 3QIBC 4WWPA 3ZHFA 5C2BH 4AUUA 3U2SB 4XNQA 3FB6B 2H6PB 5GRZA 4ECNA 3QVAA 3LIZH 5HD8C 5C0EA 1CICD 1CLYH 4Z7IA 1H3GA 4ZUTA 3VFUA 4CU7A 3GSWB 3F6JA 1RVFH 4OFVA 4O00A 2BWIA 5E0QA 3V0EA 3K8MA 3ZZQA 2FH6A 4Y5XA 1KXTA 3GZPA 1I53A 3C2AL 1IIIA 2B3RA 4G43A 1NCCH 1HL4A 4CN4A 5JOPE 4H8VA 4GRMA 2FUTA 4OCWL 2NY5L 1S9VB 2ZUYA 2A6DB 4R0LB 3SKJH 5HHPA 2YC1A 4JNXA 4JFFB 4QRPD 1BGXL 4DTGL 4ZFOL 5JXED 3ARUA 1AC6A 3VD3A 3TF7C 3D06A 5EIQA 4PFEA 4HUUA 3CLFH 4J7RA 5HY9A 3TH2T 4DAGL 5IMKB 2F8XC 3SE4A 1SBSH 3FT9A 4QNPE 4H25B 2OMZA 3I3EA 4HEMA 4IOFD 5FM5M 5BJTA 4IRSC 5AVWB 1OP3K 5KS9F 3IVKA 2CBQA 2OW6A 4NQVA 4DK6A 2VQ1A 1JYXA 3DNKA 5FCUL 5GISH 4N2LA 1KYUA 3FT3A 1YNTA 3OC5A 5AUMA 4X9FA 1BQ5A 1XF2A 5DVOA 4EQ2A 4P9MH 3MRFA 3O2DL 3VNYA 4BH7B 2JF1A 3OR7B 3QE5A 2BVOB 2OQJB 3CQQA 3FFOA 3Q7JA 5F1SA 2B4CL 2HUHA 3FQTA 3S2CA 1RULH 5ICYA 4ZMXA 1G9MH 2FJSA 2FO8A 5GZNC 1YHPA 4YSOA 3NZHH 3QDJB 3QNFA 5HJ3A 4YXKL 3STZA 3Q6GH 3BQVA 3V79C 3N6YA 1OW0A 3QDMB 3KLSA 3UX9B 1KPRA 8FABA 1JHKL 5T8IA 2WKLA 4MDRA 1JV5B 4MMYB 4AE0A 1C7TA 1PY9A 4AE1A 1KY7A 4KRPC 3EGXB 4Q8BA 3K71B 4AOFA 4P23A 2BIPA 5F0JB 2VDOL 5LBGA 1HXYB 3RVWC 4LF3B 4NIYE 1KG0A 2EH8L 1LE5A 2JCCB 3GDCA 4XBGB 5T3ZH 1KWKA 4ZNEE 4Y9FA 2MCPL 2YEZB 2C9SA 4TYUA 1YEDB 3GO1H 3FU7B 1G4MA 3MV9A 4KRPB 4NN6C 4MNGB 2E7HA 3Q2CA 1IAIH 3QB7C 4EOWL 1KEMH 2W0PA 2IANA 1YPZF 4F80A 1CGTA 1U8JA 1MELA 2PYEE 1MCOL 2X89A 2KZ1B 1WWBX 4LCYA 4LCWB 4NN6B 4Q9BA 4WKZB 5I6LA 1KBGL 5KANI 2UYLB 1EXGA 3LQZB 1BJMA 4NQXB 4KJWC 3SSGA 4TVPL 2NY6D 4DVBA 2ZWZA 4I48A 1P4LB 1VEOA 4FL4B 4YL9A 3TCLB 4CC4C 3HLAA 3X3GH 3E8VA 3ZL1A 4PWFA 3ZE0B 4X4KA 1RCYA 5DZ9A 3U36B 5F7WC 4L8BA 2LR4A 1MJJB 4OLUH 2FWUA 5CN2A 4KROC 3ARFB 3BJLA 3SZ6A 3FSZA 3RIKA 3RGVB 1G6VK 4P48A 4D8OA 1CE1L 3NEEA 1WGVA 5EO1B 5FDYA 4ERSL 3SJVB 3AS1A 3M7OA 2VISB 2FB4L 3FN0L 3OV6A 4UQBA 5JMRA 1NPNA 2AJXL 3DRTB 3N1QC 4LLDB 4DKEH 5I1JH 1QA9B 1MEXL 2EVHA 4P4RB 4B3EA 5BCAA 1NANI 4KKLC 2GPZA 5F1IB 3A6BL 4ODSH 4XGZA 2X4NA 1FL6A 5DQJB 4H1LG 3KD4A 4FFVD 1P7QB 4U1SB 2JI1A 1WITA 4GYBA 1A4BA 3M07A 3FULA 5GJSH 2Z1KA 4LGPB 1NCDH 1IEBB 3CCHA 4UIKL 2FBRA 4LLUB 5I6NA 1DBAH 3ULUF 1USZA 4HU8A 4PLJD 3CDZB 3EIFA 1MRFL 2P3YA 1CTNA 5C09E 4MXWL 2GITA 4XN4A 5CO1A 4PJIB 2QKSA 5IB4A 5FA3B 1M71B 4NO3A 3DUSB 1X5KA 4X6DE 3U2SA 2DQIH 5L2JA 5KYWA 3PU7A 2H6PA 4TNWK 5EZIH 4XODA 1MCFA 2BSTB 1FRGL 2ZP0T 4I3RH 4JY4A 3REVA 4BK5A 1FO0A 5F96L 2ZSWA 1FJ1B 3IJSB 4BM7A 1SMOA 1OALA 1U3YA 2CM5A 2IANE 2YK1L 5E6IA 4KZEL 3KAAA 3O2VH 4AQ1B 4CGTA 1TENA 3V6BR 3GC3A 4UT9H 3WGVB 3GBNH 2NNXA 1GZPB 3OQRA 1QQDA 4PM1A 3S5YA 4M7JH 4J2XA 1T1XB 3BVDB 4DUVA 2YA1A 3EH5B 3UTSE 2WNKA 1U91B 3QIWD 4L2LA 5T1KB 4JFFA 4ELKB 3BP4A 5MENB 1UJTA 2LABA 4P2QB 1NCOA 2ZYHA 1P1VA 2YPKB 4HZLB 3IETA 5ALCL 5I30H 4G42B 3GBLA 3SN6N 1U6AL 4MA8L 2WXJA 1NC2D 3EFOB 3KBPA 5FDWA 3SGDI 4O02L 4A7UA 2BSSB 3MROA 3VH8B 4V1DA 2DH3A 1ETJA 3FQUB 1PMYA 4EDWH 2WAQA 5HDBF 5TQ0H 2PTUA 4AC2A 1QSFB 1AZCA 4R4BA 4UILL 4JRLA 1BFOB 2WSDA 4XNAA 4UM8A 2R83A 4PRPE 5L8LB 4IRSA 1SVBA 5GIRA 5I76B 1KTRL 3UTQB 1GGTA 3NCCB 1D7BA 2Q8AH 4B97A 3N55A 1KIPB 3CUPB 3FB8B 4PW3A 4GKSA 4BJLA 1NBVL 4LSSL 3QDJA 2B39A 3IWVA 4EE2A 1E43A 4LZKA 1CBVH 4P2OB 3IJYA 4Y9CA 3ZT6A 1NIEA 3UG5A 5JOEA 4P4KC 1F1GA 2PKDA 2ATKB 1KT2A 5GZNA 1HXYA 3BWAA 4FTVD 3RI5F 1LMKA 1S9YB 4R84A 5SWSB 5CEZE 2GBVA 1E9PA 4MHHG 4JM4H 5KANG 3PHAA 5JR1L 1VRSA 1YEEH 5EORL 4JZJC 4KHXH 5JQ6L 3O6KL 5AW8B 3F00A 4BWTA 4JO8A 3F7VA 2ZCZA 2YOCA 3DVFA 3H3KA 4PREB 1LP9B 3GSNH 4KJQC 4EZMA 3QG6A 3DJZA 1R3HA 2CRZA 5D93C 1G5GA 1XR9B 4K3DH 3KS0H 4PGCB 2CKBL 2BSDA 5F6HI 4P99A 2MPAL 3LB6D 4A2HA 1CU4L 4JKLA 4F37F 4KNSA 2H3NA 4K4KA 2P5WE 5M95B 4YE4H 1FGNH 2D3LA 3GMLB 4LCWA 4RGMC 1I9JH 3V4UL 3SPHA 3SEPA 1Z3GH 2HJKB 3SKMB 3V5HA 4Q89A 1LWRA 4R2GD 3J7HA 3FT2B 2XWZA 5C08A 1Y18B 2KI6A 4M62L 2P8MA 3ZKNC 1KB9K 3KHOA 4OM1L 5I1KH 1AMXA 2BNQB 2EE9A 2QPFA 4KI5C 5F7MC 4LCIH 1K4DA 3MLYL 2E9WA 3NA4A 1E3FA 2VUKA 5DJXB 1K9TA 1BVLB 4HOZA 4CC4A 1SEQL 1FVCB 4V1DE 1WDAA 5FO2A 1P4IL 5GSRB 2JK5A 3SJVA 3D12B 5DMIH 4M8QA 1RUML 3I6SA 4LLDA 5DT1L 1JNLL 1MWAH 1GOGA 4UF7C 3ARBD 4OQTH 4P4RA 3QULB 2OBGA 2E4TA 3CHXA 4PVNA 4AEIL 5TDOB 5I8CB 4QRBA 4M7KL 5F1IA 2R0LL 2FWSA 1JN6B 1CDCA 3O3EA 4PV8B 1O5DT 2MPVA 1CTOA 4GS7B 1BVZA 2ZJSL 1MQ8A 5BMFL 1OT1A 4IKJA 1TVDA 4I0PD 32C2A 5MEPB 2AP2A 5FXCH 3ZYIA 4B41A 4I4WB 1S6NA 4PRHD 2KQMA 1N18A 3F01A 3HNVH 3SE9H 4H0HB 4M6NH 3SDXA 3DETD 4F7PA 1XGTA 4YL4A 2WXGA 4OR1A 1MCPH 1BZOA 1NFIB 4AW4A 1OTSC 5BRZE 4JHAL 1I8UA 4KKPA 3HBPA 5DMYA 1CXEA 3L5XL 4WSKA 5DJDB 3F85A 4N2KA 2LW3A 4JVPA 4TL5A 1HH6A 1NBZB 1MHCA 4Q4IA 4OCYL 2NY1C 5HVWA 3V6ZB 1GOFA 2BRRL 1EXUA 2NQ3A 4LXFA 1NCJA 2HT3D 4K3JH 2QGBA 4NUJB 4OZHF 5AQ0A 2UY7B 4OCWH 3PWLA 1MCLA 3RWHB 2NY5H 1QPKA 1NLDL 2E74C 3EKCA 2F74B 4FQQA 4GW1B 4PGBB 2X6MA 1I8LC 1O7DC 1S7RA 2XETA 3F7QA 3FB7B 1ODUA 2JKIS 3MRPB 4G80A 1NIDA 1BGXH 4DTGH 3GM0A 4CBPA 4HJJL 5T1KA 1IT9L 2OFQA 3P9LA 5IROC 1ZLUH 4X0NA 4XP9H 4JO2L 3NSCA 1GSMA 2MEJB 4P2QA 2YPKA 3P69A 4HZLA 5KSUA 4JDZB 4K15A 1CXKA 1IC7L 5I5MA 5IREA 4L8CA 1PL3A 2A83B 3H7LA 3JXAA 2EUXA 2VSMB 1TQBB 2ADIA 2LHAA 3NIDB 4Q56A 3U4AA 1KTCA 1THAA 4ZTOH 4YHLL 1SMAA 4S1DC 3BEVA 3WUWG 5FCUH 1CLZL 2BSSA 3D69A 3DIDA 4WWKC 1WH0A 1L7TL 3VTTA 4NOFA 3FCSB 3X2QB 3O2DH 2GTWB 2BOLA 2W81C 3LRLA 3ZMRA 3QQ3A 4P0DA 4RGND 1G84A 1S5HA 1JPTH 5D1XD 5LO7A 1OTUD 4JANB 4HS6B 3KGRA 3UYOD 3FCTA 1NH6A 1ZA6B 2LFEA 3V5KA 4ZW8A 4N5UA 1G7PB 4TPRL 4Z8FH 1JHKH 2YA0A 1KLUA 2L04A 1KLFA 3MRHB 2Z92A 3B2VH 4JKMA 4L3AA 1T22B 3VFWA 2J2ZA 4PY8J 2IEPA 2EECA 2VDOH 4JG5A 3BPCB 3DX4A 3HBQA 3K74B 4M3JA 3SDXE 1SLVA 4R90L 4Z7OE 2EP6A 1KCRL 2E9GA 1S9YA 1AE6H 3QUXC 1VPOL 3GSNB 4L8DB 4CL7A 1TSRA 3H4FA 4XBMA 1BQHA 1GY2A 1RSFA 4X7FC 4J3SA 4BXSV 4PREA 3ZRFC 4D7BA 2XTJC 4EOWH 1LK3L 4P4KA 2DMKA 3W9DB 2NUTB 3G5YA 1JUFA 3OX8B 3WJJC 1MCOH 4RSVA 5J9PA 1RZKC 4YHIA 4N0YL 1E42A 4JZJA 4X8JB 1AANA 5HI5C 1KBGH 1RZGB 2P26A 4NCDA 3ATBA 2J73A 2BLFA 2IMNA 5K9QI 3BIAX 4I2XB 1JAEA 1IIKA 3RWDB 4Z3EA 3N06B 1EZVY 2PW2B 1KELL 4NI6A 4UAOC 5HHXL 3HI6L 1A7RL 5F0MB 2VLKB 4UOZA 4BUHA 2G75A 1EAPB 4AGNA 4N20A 4PJ8C 3JWDL 4P57A 4XO5A 1ZS8A 5C3TA 4G8AC 5IBLC 5DRZB 2HTLC 3VJ6A 2PPFA 3HE6D 1AO7A 5JW4N 3MUZ1 4LB8A 3O3AB 3SCMD 1EANA 1KB5H 5IMOB 3JWNH 4NRXA 1OLZA 1OCOB 3DV4B 4D0BB 1WAAE 4TNWF 2O61A 3BN9D 3ZPDA 3SE6A 4ERSH 2UWEB 5A2AA 4CDHA 1UB6A 2FB4H 1FVCA 3AADB 3FN0H 4JLRB 1JPSL 1TJGH 1O7VA 4QIRA 4UM9D 5DC0A 4MDIA 3BE1L 2V7NA 4NO0A 3EYOA 4OF8A 3UZVB 4BRVA 4YHNB 4JGMA 1IMHC 3F04A 3OKKA 4HIEB 1U2CA 4QYAA 1KBKA 2DMGA 3NQIA 4AGQA 3L6FB 5D5MA 3FO1A 4V2CB 4MGXA 4PS8A 5B3JF 3EBIA 2MMXA 5E5LA 4Y7OC 3WENA 1MG2C 1RUQH 3UGUA 2HH0L 2VITA 4YZFE 3WKML 3RDJA 1H8SA 1CF1A 2ZX8A 1X7QB 4XPTL 5L2KA 1BMWA 2E59A 1S3RA 1U42A 4UQ9A 2IQ9L 2NT1A 1YEIH 3M17B 4BHUI 4MXWH 1EZSA 3GS7A 1XCQB 3I75A 4PGEB 2R8SL 3KW8A 3CVHA 4ISVB 1NKOA 1DVXA 1BIIA 3GXFA 3DDGA 4MXQD 1COBA 1DVFD 4TLKA 1CGWA 1FRGH 2OJZL 3OJ2C 3DHMA 5DJDA 4LBAA 1W91A 3UBHA 2NX5B 5DF0A 2YK1H 2XN0A 1NBZA 1OB1B 1ZHBA 4JKNA 2MNWA 3V6ZA 5IIEB 4X6BA 3HR5B 1G9EA 2DJSA 3RRQA 3LMJL 4ZFOB 4FQ1L 5A7BA 3BVWA 4LSVL 4J4PD 2M83A 3FO9B 1FC1A 3RWHA 1IQDA 3BD3A 4PGBA 4RMWA 1B4RA 5FHBL 1HL8A 5ACZA 2MSPA 1OARH 1AQMA 1JTPA 3K6OA 3QK0A 4Y4HC 3OWEA 4AV0A 4FS0A 3LZLA 3WNKA 4L3CB 4G3YH 4XO9A 5ALCH 2F1EA 1QR4A 1B4LA 2B4CC 4IRJC 3C08L 1U6AH 1L9TA 4MA8H 3TN0B 5ERWA 1J5HA 1I8LA 1HKFA 3OPZL 1XSIA 2R1WB 2NTSP 3KLKA 3QH3A 3STLB 2WB7A 2A83A 1IKFL 1BMGA 5DHMC 1M6UA 3C12A 5IROA 1DE4B 3K80A 3GBML 1CFVL 3MV8A 4OF0A 4BH8B 4F27A 3QHFH 3HJ0A 4UILH 2VR4A 3J07A 3FCSA 4XPFL 4U6XB 2AXFA 3FH7A 2YN3A 3TEWA 2Q76B 4KRMB 2WNXA 5FM8A 2I07B 2FSEB 1OGAB 2YD1A 4FP8L 5L7XL 5B1CA 1Z9LA 4I85A 4WWKA 1NBVH 4LSSH 1LVEA 4PJAE 3KG5A 4GO6B 1M53A 2JJTC 3GYRA 2VDOB 1Z9SA 2R4SL 3DX1A 5E56A 2ICWJ 3QPQC 1MUJB 5L2KE 3RPKA 4OCMC 4IMLB 1T22A 4NRYA 1OV8A 1BXUA 2ZOOA 4W9DC 4HKXB 3WBDA 1BFVL 2F54E 4FXGC 3WFZA 5FM5O 3MV7A 4S0HA 5DUBB 2YMTA 3BH9A 5EPMB 1F58H 3GJEB 3NPSB 2AEOA 3L9EA 2WN2A 4POZC 4ZX4A 3DDFA 3S34L 5EORH 4HPHA 4D8PB 2C9XA 3PDOA 3O6KH 4F15C 5K9QG 1CXLA 5SX5H 1QASA 5T5NF 1FIGL 4JHBA 4Y2OB 1N59B 3NCJL 4Z0XA 3I74A 1T7XA 3M1OA 2IMMA 3B9KB 4XCYB 3HB3C 1I3VA 3W9DA 2NUTA 4ZSOB 2HB0A 1A6TB 4DGWC 2MPAH 1HS6A 1CU4H 2D9CA 3QJUB 3TIEA 2NW2B 2R4RH 3QUXA 3VNZA 2FEDC 5FKPB 4P5TD 4MJJA 1UTDA 1EAOA 4BZ2L 3V4UH 1MPAL 1PAMA 3GMMA 4ODTL 4JL1A 5SWQA 4KK8C 4LAQL 4PJ5B 1H8LA 1YN6B 3WJMA 5IY5B 2PW2A 1HINL 4MSWB 3WJJA 1TYJA 1KB5B 3GK8L 4YO0A 3O45B 3EGDB 3ZQXA 4POYA 5I24A 4OM1H 5KJ7E 4WUUB 1M7DB 4AQOA 3C5XA 3DC0A 1AIFB 2DQMA 2VTFA 1OSZA 4NQDA 3MLYH 3EJZD 5ENWB 4UTBA 2CGZA 3WAKA 3EYUL 2BP0B 4X80L 5IB1A 1PEZA 2XVBA 1SEQH 1VZIA 4WTZA 1OGTA 3DROA 2OI9C 3BH8B 2VERA 4PJ8A 1LK2B 3HTLX 1QP1A 2K8QA 4OJYA 4WSJA 1MY7A 4ADIA 1RUMH 2JXMA 2EDMA 3D4ZA 4FXKB 3DWTA 1VCBC 5DT1H 3S96A 1PKOA 3HG1D 3QXAB 1NDMA 4Z78A 3I9PA 4AXWB 2UV3A 4MJ6B 2CSPA 2DLIA 4P46D 4AEIH 4BV1A 4M7KH 2R0LH 2YSTA 3SYPA 1JD7A 2OI9B 4Y1TA 4ETYA 8CGTA 1D3CA 2G9KA 2XV3A 2H8PA 4H40A 4LKXB 2TAAA 2WSPA 3VFTB 2JCWA 4NJAL 1AQ8A 2X09A 5BMFH 3BZ4A 5EHFA 3R8QA 5TE4H 4EMZA 1DJIA 1QFWL 3PWJA 4KK9C 1AHKA 2G4GA 2IADA 4U6YA 1XTMA 4ZMQA 3P4MB 1BZ7A 3P0GB 4OZGB 4JRWA 5KYYA 2NXZC 3WFCH 2ZX6A 4NT6A 5D4HA 1XCQA 4HK3J 2EZ0C 3C60B 1VACB 2YRZA 1NAMH 4D9RD 4KX9A 4JFEB 4M5TA 2CKNA 1NIFA 2IV9A 3EDJA 4ISVA 2EKJA 5IQLA 1UH3A 3PPSA 3L5XH 1KJ2H 4QRPE 2DEWX 2IVFC 5TD4A 3HVNA 3HG3A 2CLZA 3WFHA 1B0RB 1KYDA 5EOCJ 2VL4A 2X42A 3C8DA 4LCVA 3EH1A 3FRUB 4NQCB 3B2UD 4HW6A 2BRRH 4RA0C 1OB1A 3CXDL 3W82A 4O2FB 3KPLB 1TMQA 1TQWA 3VFPB 2CUHA 3T8MA 3D25A 2A1WL 3HR5A 2ZXQA 5L8JB 1NLDH 2HLFD 1IQWL 1P5VB 3S35H 4YEFA 4LO9A 2Q5BA 3FOMA 3DX6A 4B0MM 5EUOA 3UZQB 2EDXA 1AKJD 1IT9H 1C8QA 4XNMA 4WU7B 4ENED 4EIGB 3K91A 5KVEE 4G7RB 3QUKA 2OAAA 3NFPB 5F3BA 3QJSB 1TQUA 4G9DA 4L3CA 5JYMA 5I74B 1IFHL 3X11A 2A73B 4NNYA 1IC7H 1G0YR 1DANU 3ZHLA 1BQLL 4XCCL 3T0VA 5DZAA 1XD0A 3ZDZF 1PG7L 3MLRH 3VSVA 5EN3A 3CIAA 4YHLH 2NY3C 3STLA 1FH2A 4Y4HA 5GGVH 1CLZH 4M1CC 2W88A 3U9UB 4K5PA 1XAUA 3FSWA 3X14A 4KGLA 4IRJA 2FEEL 5CIPH 5CJXC 3QJXA 5BUPA 5DD1L 4U6XA 2H6OA 1U58B 5F88A 1IM9B 1OZTG 4NC1E 4QWWC 3L17A 2R29H 2GT9B 2FX9L 2VN3A 3RZCB 1WFIA 1K8DA 1PKQB 2ITCA 1OGAA 3V0VB 3RWEA 2H2PC 3UAJC 1ED3A 2VXUL 4H0IA 3VFSB 2QPSA 1TVHB 3PHSA 5PAZA 2DY2A 4F3FB 3U25A 1FA4A 1AQKL 1FL5A 3W2DL 2JE8A 2EXWD 2VC2L 4MQ7B 2APXA 3CPLB 3OMAB 1MJ8L 4Z23A 4GAGH 2BERA 1XR8B 5B39A 1RFDL 1HQRB 3NT0A 1J8SA 4MCMA 4ZDHB 1BQKA 1CIUA 4OZIA 3TO4B 3BZFA 4B9IA 4PJBF 5EEUA 2XXCB 1CO1A 1KCRH 3DX9A 3O6FB 3UTPD 1VPOH 3VUAA 3WNLA 2JJTA 1AZNA 3DYOA 3N3EA 2W60A 4M48L 2AJVL 2CKBB 1HIMH 3RIAK 2XPZA 5IJKC 2BVQA 1NMCC 2IPTH 4FXGA 4FCHA 2EO1A 4ZSOA 4ADJA 3KPNA 1FPTL 4RFNB 3FAWA 5E9DD 4FFYL 4DZBA 1ZV2A 3POCA 4N2OA 3LVEA 4WI8A 5EBLB 3VFVB 2BCMA 5JZ7C 3DX3A 3FFDA 4EKXA 3HI6H 1A7RH 1QVOA 3C09C 5CN3A 2ZWLT 4HC1H 2DPKA 4HKBB 2Q1EA 4MSWA 4Q6IB 2VDLL 3NVQA 3NZ8A 2CBTA 1EJ8A 5D8JL 3EGDA 4L29A 3THML 1ZVSA 4RRPA 4AX3A 5EU3A 3B7RL 4WUUA 1M7DA 5DYOB 2QELA 2F53A 4FNLL 1HNYA 3EZJB 2CRYA 2UZPA 5FYJD 2C3GA 2NYKA 5F9JA 1UGNA 3RU8L 4MJ4A 5T3XE 1P2CB 2OCFD 4Z7VE 3FBKA 3LCYA 4LEOB 1CUOA 3NSYA 3BE1H 5IW3A 2X6AA 4LPVA 3WO4C 4IS6A 3LN5B 1QO3B 2P5PA 5DMKB 4WFGD 2Y3AA 3U6RB 5F7KC 3P2TA 4ZUSB 4YDLB 1JCVA 2KLRA 2MJWA 3C9NB 3EOYG 5I2IA 3O4LB 3BKYL 1WO2A 4GXFA 2WYHA 3IWUA 5INCB 4AXWA 4MJ6A 5JUEL 3W81A 1V3KA 3GNML 1XZWA 3DGGB 3O41A 5D1QD 1NSNL 4PD4J 2NR6D 3V0DA 5AFAA 3WO4B 2VWEC 2HH0H 2WQWA 3MX0B 3VFTA 3ZUCA 1A9VA 4N6RA 4Q9RL 1PZDA 1LWJA 4XPTH 4FKKA 1EO8H 5ECGA 1ZSHA 1UD5A 2H0JA 4LASL 1EJ6A 1NAMB 3KPPA 4J27A 3GZQA 3GUFA 3ASNB 3PGCA 4OZGA 4OZIE 2AQPA 2ODIA 5A2FA 2R8SH 2K3TA 3H2QA 3VI3A 1T5KA 2XNAA 2DQHH 5K33A 5LHDA 5L0QC 5FOJA 2NNFA 3MAWA 1EAQA 1N8OE 4HZ1A 3DX7A 5LCVL 1DUYB 2OJZH 4AWJC 2ZZUT 3LNFA 3JSSA 1IBHA 4LOEA 1R5WB 5I75C 3NSDA 1B0RA 1YZZA 4LKCA 4L37B 3CVIH 3LQAL 4PTUA 4ODWA 2VXTL 2CLRB 2WKGA 1QHQA 3WEMA 1N8ZB 2DJMA 5L0QB 3KPLA 3LMJH 3VFPA 4HX1A 1BXXA 3RJOA 4Q0XL 5DGRA 2A9NH 4Y88A 4XO4A 4Q6YA 2WLIB 1PQZB 5FHBH 3ZGIA 3VU1A 1KTDB 3D8MA 3UZQA 3VGBA 5FUCE 3HKZA 3SBRA 1G9NL 2CALA 3TTYA 5AZ2L 5GRJH 4ODUA 5A1AA 1P6WA 3CFNA 1T66D 2X0VA 3CHOA 5B1KA 3BFQG 2APSA 3TZVC 1J5DA 5EOCL 2CO2A 3IJHB 4O02A 2F15A 2WNGA 5IOPB 1D6VH 2YPLB 1I9EA 1P5UB 2WO4A 3H4HA 2H3KA 1IKFH 2MHAB 3HMWL 1B0GB 4DN3H 1J5CA 1QX1A 5CIPB 3GBMH 1CFVH 5GS0D 4RIRA 4RISL 2WBJD 2ZCLL 4JFWA 5JA9A 3RNKB 4OV6F 4PJCF 4UUJB 2A7BA 4QRRB 1MCHA 3T1WA 3QCUL 4DGIL 3F6LA 3ZVVA 3ZHKA 4FTVE 4PJIF 1K4CB 3L3IB 5L7XH 4WW1A 1YG9A 4X5RA 2QSQA 4HPYH 5CLWA 3RZCA 4IJTA 2CXKA 2L4OA 3FH8A 5I6PA 1FZKA 4LLYB 3V0VA 1HCZA 4Q9QL 1D9KD 3PWPA 3WTWA 1DBMH 1M57B 5CJXA 1IVLA 5JIHA 1CIDA 1UT9A 1YUHB 1OVZA 4FYSA 1QATA 2V37A 4NIKB 1BFVH 3UYPB 4PJDF 5TE7L 1EMTH 4IHBA 1XL4A 2AQQA 2EO9A 5AVSB 5E6YA 3QUHA 3HI1A 1WZKA 1P4UA 4KZ0A 3UAJA 3GI8L 4YHKH 2PCXA 4G6JL 1DN0B 1RP9A 1AR2A 2Z3FA 4LDCA 2KPNA 4XC3L 4CADA 2Y7LA 4PU2A 1UADC 1FIGH 4JJ5A 4PJXA 3DSNB 2CKBA 3RWGA 3NCJH 3SDAC 4AZ8B 1FL3B 4QXGL 2PYEB 4DUWA 3ISYA 3RVVD 4MFHA 1KCVL 3JWDC 3KXFD 1AQHA 5C07A 1C7SA 1CZ8L 4K9EC 2GJ6A 1PZBA 1FVDB 3RKDD 2BVPA 3B7UX 3E1ZA 2KLTA 1DN2A 1Q0YL 4ZTPL 1CDGA 4BZ2H 5IJKA 5KTEL 3SDAB 1MPAH 1ZA3B 3PHQA 2AV7B 4FG6D 4ODTH 5F1NB 3VGAB 4LAQH 2R1YA 4G70B 3MOBL 1ACXA 4Z7WA 2N7AA 1AXSA 4JAMB 3Q6FA 2HVKB 4FZEL 3G6AA 3VCLB 3N91A 1NMAL 3RNQB 2WKOF 5D4JA 3R7QA 5DD5L 3E7JA 4FX5A 3VTAA 1J0JA 2OMYB 3WN5C 4AIXA 5HHQB 1BDYA 4O5LL 5K9OB 4HJIA 4BGLA 2MQ3A 3LH9A 1MNUL 3F7YB 3HAEH 2R1XB 5KVGL 3TURA 1F41A 4BFGA 5IFJA 2R7EB 4RZCA 1JNHA 4K94H 3TC9A 4Z1PA 2E6PA 3NBNA 2CHXA 4RAVA 4WI5A 3QSKB 2AK4A 3O4LA 1SJHA 1A1NB 3P3YA 4QAMB 4DKFL 4WHYH 1BVNP 2GTQA 3P0VL 3BSZL 4OIIH 5AKRA 1BF5A 2I9TA 3MA9L 1D2OA 1EK3A 4NJAH 1GTNA 2DWEB 1LP9F 2E7CA 1QSED 5F3HA 3W0WD 5AW1B 4NQEA 3GSRA 2Z31C 3WTYA 5C09B 2P24B 2GJZA 1QFWH 1AHWB 1CFQA 3KLLA 4FQXC 4DEPC 4Z77A 4HCGA 1FFNB 3PABB 2OTPA 4AMKL 2NTFA 1FNAA 2D7TH 4TULL 4X6DB 5EC1B 3EYFB 4GXUN 1FF5A 3BQUB 3M1BB 2W07A 3EJRA 5E95B 4Z18A 1RJYB 4CN6A 2Z31B 1FZMA 3MNZB 2YD3A 4PJXE 4FQXB 4BFIB 4J8RB 4Y7MA 2XZQL 2FT7A 4GRLD 3UYRH 3GMRA 4IHOA 5HI4D 1TITA 3BIKA 5B8CC 3BT2H 1OF2A 2ZPKL 2WJ7A 3CXDH 3ES6B 4M6OL 1CDHA 1MXDA 1WF5A 2GJ6E 4MTMA 4XOAA 2Z0BA 3TNNB 1UCBL 5GS1C 2QTVA 1M1XA 1N8ZA 2A1WH 2DKSA 4CU6A 4F2EA 1S8DA 1SF3A 5JIMA 2Q7YA 1IQWH 2C5DC 5ESAB 1E4XL 4N26A 2AAVA 4M29A 1XBDA 1A14H 3U1SL 1KFAL 3L3DB 4JVWA 1WSST 3MNMA 4LGRB 2X2UA 3LPPA 3C8KB 5KVEL 1KBPA 3W38A 3SDDC 2YD9A 2WPGA 1KDJA 4Z7WE 3KEHA 1G87A 5DJ6B 2WWKT 4HHWA 3RP1A 4FA8A 3VXRD 7PCYA 5D72L 3PL6C 5D1XE 1IGTB 2NY7L 2H1PL 2ZSVB 3DYPA 5IOPA 3CZGA 4X98B 1WK0A 3EDFA 1YQVL 1KGCE 2XBDA 2X4PA 3RIAF 3UP6A 3OB8A 3QIUC 2X4TA 3SDDB 1PIGA 2XDHA 1GHFH 3GLZA 3F2LA 1RJLB 3TZVA 3ME0B 4UUJA 2AEQH 5DD1H 4KFZC 4QRRA 1J12A 4ACTA 3C5ZC 2YO3A 3LD8C 5ETUB 4CGUB 1HJBC 5A2JH 1K4CA 2BP5M 4OJFH 3J2PA 4JG1L 5KN5A 1QLFB 5F9DC 1GGUA 2VXUH 5E1GA 4AQ8A 2R0WL 4GSXA 4YGAB 1GL4B 3DO7B 1EXHA 4GG6F 1AQKH 4W70A 3K2IA 2NY2D 1WFTA 2VC2H 4PV1C 3FRPG 1ET8A 2TRHA 2X28A 4HD9A 4NQEE 2EE6A 4FAAB 1TIUA 1DO5A 3TYFA 4JRXD 5E99H 5DJ2B 3UIYA 1HK6A 5J12B 2UXTA 4Q2ZB 2B59B 3D18B 4N90E 2CU9A 4XHJD 5HDWA 5EU4B 3WHXA 4HIPA 2R0ZL 2VWEE 1EHNA 1UFUA 1G6RH 2AI0L 2BS9A 5LBSL 4YMPA 4TUJB 3L2NA 4M48H 2AJVH 4XWOC 5CP7B 4EN3B 4Y1AB 4HJ0D 1OF0A 1OHQA 1H0DA 1QBBA 1BD2A 1ZLDA 4HFWA 2CJSA 2KS0A 2P5WB 5J0BA 3L3KB 4AGMA 1FPTH 1N0XL 3LN4A 3QO1B 1KIUB 4FFYH 1AC0A 5B3NA 2GBAA 4Z3FA 3NIDF 5JTWA 1T21B 4FHJA 5DWPA 2C1PB 3SDAA 3A4DA 2PABA 2FX7H 3N1GC 3QA3B 3S4SB 3ULSB 5DJCA 4PIBA 5HYQB 1IFRA 1M4KA 2VDLH 2YZ1A 5J3HD 5F7EL 2IH9A 3H9ZA 4G8EB 1M2OA 2B08A 5D8JH 2HVKA 3D4CA 3G04A 2YA2A 1LNUB 2VLJB 5AOLA 3FS9A 2FWOA 3CHPA 5D7JB 5J1TC 5JPMB 4FNLH 1MREL 2FX8L 3CD4A 1TEYA 3AZUA 1OWRM 2H32H 2WLHA 4GOSA 5HHOA 2ZAIA 2NRDA 3RU8H 3TYGL 5K9OA 1N5YH 4H2CA 2KLSA 1BFTA 2HPOA 2X70B 3PWUA 2CCWA 3LEVH 4R6UA 4H5SB 1JRHI 3HPLA 1OD9A 1V3LA 3GB7B 4APXB 3UADA 2Y06L 3NJVA 3D9AL 5CLYA 3WN5A 4H26A 5I0ZA 4IRZH 3DOSA 9PCYA 4YHML 1F6AB 5JUEH 4HCRA 3GNMH 3OMNB 4JGJA 3T8VA 3VGFA 1UM6L 1L9MA 3KPRD 5IM7B 5LWYL 4Q9RH 4GBXD 1RV6X 4F58H 2DWEA 2VAAB 5EO9A 3MHZA 1MJUL 5C0CA 4H8WL 5C0AD 3X1GA 2Y6SD 4LASH 4KJYB 5BRZB 1JK8B 5CMAB 2IXQA 1X9QA 5C9KA 1FFNA 1IEAB 1BREA 3CSTA 4Y4KD 4NC2B 3EYFA 4JG0H 4MAUL 3H9YA 2DI8A 1UD3A 2Z4TA 3EH2A 3RTQB 4TUOB 4C58B 2YQ2A 3EH4B 4S2SA 2Z31A 2DLTA 4HKJB 4G5ZL 4FQXA 2WVSA 4BFIA 2Y7NA 4J8RA 2O5XL 2BCKA 3BT0A 2OTWB 1X4YA 1B2YA 4ZW3A 1BD2E 3KPTA 1OLLA 4JVUA 3ES6A 1U93A 1VLXA 2GBTA 3TJEL 3GLDA 3P3TA 4LSDA 1A2YB 4ZFQA 4Q0XH 3I2CH 4FLOA 3UPRB 5SX5K 1WZAA 1JV2A 3CVDA 5ESAA 5CD3B 2UWEF 3LPGA 4HGMA 1RKRA 5DJZA 5H94B 2DYPA 4QT5B 1G9NH 5B8CA 5AZ2H 4EI5D 3IT8D 4E42A 3IAGC 5I19H 1TVBA 5GS1A 4LOUD 3QNXB 3QZMA 5EOCH 2A3TA 3QT2A 1M7UA 2JIXA 1JGLL 4UMSA 2P28B 3LS5H 3NP4A 4JFTA 4YFEA 3V5DB 3FSOA 2PMZA 4YK4C 5HHOE 4R7NA 3SDDA 1RU9L 4N0UB 4RISH 5E23A 5I5IA 1ZHNB 2AVGA 4HUVA 2Y6TE 3D6GA 4FNTA 4UOJA 3EYVB 4RMQA 1KCSL 1Q9LB 3PL6A 5FO8A 4NO2B 2R9HC 4PJEA 2XWTB 5CP3H 3QCUH 1YYMH 4WGVB 4DGIH 3U7WL 4Y2NA 2WO2B 3EOTL 4QHMB 4YK4B 3L7FA 5D7LD 4AQEB 3KYOA 4XNZB 2ZP8A 3QIUA 3LS4L 2VC2B 4FMKA 4JO3L 3V4PH 5J06A 4XX1G 3UJTL 2WXPA 1QLFA 5B22A 1YNLH 3L5IA 5I6KA 2AQTA 4C47A 1CD1A 1QFHA 4JQVC 1GYAA 2PYFA 4WGWB 1F4AA 3CK0L 1ZJAA 3IBEA 4FN0A 4KGJA 1JWMA 3TWCH 3VWJA 4KITB 1F18A 2R59A 3C5ZA 3H9HB 3FUEA 4WI3A 5D2LA 5TE7H 1ZAGA 1G6RB 5ICUA 4MJ5B 3GI8H 1I1YB 3NIFB 2V5RA 1QHPA 1MCDA 4XC3H 5C0ND 4JCMA 1T5XA 1N2RB 3NACL 2EDEA 5EOQL 5FYKU 5TQ2H 1AGEB 2Q86B 3IFPA 2Q3AA 4MMXB 4F8TA 2XWJB 1H3TA 3PQYA 4QXGH 4TQHA 4Y1AA 1KCVH 1T0NA 3MRCB 2HFFB 2WTOA 2CMRL 5DURB 1I1CA 3MMEB 5CZKA 4D0DB 2LU7A 2IWKA 2PXYC 1HVXA 4E36A 4MS8C 5FX3A 4HIHA 5G4MA 1GSKA 1Q0YH 1EZUA 4XP6L 4X4YB 3S8FB 4YZWA 5KTEH 2DLGA 3E1F1 1ZV5A 3FW6A 2VDLB 4IU3A 2ISDA 5JO5A 3Q05A 3MACH 2CJTA 4XPAL 2BNRD 2L7EA 3BKJL 4JQIH 1TTAA 3AXIA 4GSDL 5DRXA 3P77A 4L4TB 4I9WD 3R06A 1SYSA 4FZEH 4OUUA 5IGXH 1NMAH 2H32B 3U4BL 1NFKA 4J8QA 1IKNC 3FFCA 5DEGA 3AG2B 4OKVA 5DD5H 1LNUA 1PEWA 2IH8A 2IAMD 3MJ8B 1QRNB 1RAMA 4O5LH 3QDGA 2VZSA 2DAVA 4LLVB 4ZRGA 4LPXA 1B4TA 3Q13A 4AITA 4F8QA 4J12A 1MNUH 4PN6A 3ARED 1Z1WA 3WY3A 4H0GA 3ARTA 2VE6A 4HYTB 3ZKSD 1C16B 3QAZB 3QQ4B 3QZNA 3MOQA 4XVUC 5B4MD 4I77L 3RGBA 1FFTB 1OPGL 1PU0A 3N9GL 4H5SA 2AW2A 3K8KA 1NC4D 4HOXA 4IJ3C 2C1OA 3QJTB 3MNDA 1FHGA 1IBGH 3MA7B 2WC7A 5CU5A 3TA3D 4Z3IA 4XB7A 1DVQA 3CBKB 3L3GB 2DJUA 3NSJA 1ZGLB 1D5IL 1H8OA 2EYTB 3HA0A 4C57C 4DKFH 1A1MB 3AB0B 5E6RB 2GEQA 3OMZA 3GMQA 1O6VA 3GDBA 3P30L 1EVUA 2W91A 2PUQT 4GXVH 5EU7E 2OJ1A 3Q3GA 3T6QC 1IL1B 3RY6C 2VAAA 5DZPA 3OKLB 3MFFA 5D2LE 1CXIA 4XH2B 5IHUH 1SJVA 3DRQB 2HKFL 4AMKH 4KJYA 2HFEB 1AGCB 2K9UA 4TULH 4LDEB 3QO0A 1AQDA 1V8HA 5DJ0A 1E9OB 3UACA 1XGPB 3ARGC 2QVTA 3ECBB 2J8UE 5ABZA 1HEJC 1KACB 4ZUVB 1AYRA 3T6VA 1FLRL 4UQEA 3IMBA 5EFIB 5I0YA 2KT6A 4FA6A 2XZQH 2XN1A 5GGTH 5CEXB 5F7HA 1EHLL 1ZHLB 1YJDC 5CJOH 4FMVA 2WWNA 4A68A 4MKTA 5JOFA 4OUOA 7PAZA 2XKNA 3H1ZA 5T1LA 3S5ZA 4OZFH 1EJOL 3FU0A 4NX0A 4E41A 3CVCA 5ABAA 1MN4A 1RURH 1N67A 4TSAH 2DTSA 4M93B 2WUBL 4MRCA 4KDTC 1E4XH 4WI4A 1U8CA 3U1SH 1KFAH 4YC2B 1SHXA 4ZFFB 2Y23A 2JJWA 4KVCL 4JRYB 5IR1B 5KVEH 4QT5A 5G4NA 3P54A 4ANKA 2Z9TA 2QPEB 1FHNA 1TKWA 3G7TA 2IWEA 4PI0A 4J39A 3VYPA 2NY7H 3FFCE 4CN1A 1KULA 4YN3A 4XVJL 3QDGE 3RA7H 1TYEB 4PSPA 3V5DA 1D7FA 4P3DA 1KY6A 1QBAA 5E5RB 5GGRB 3QFJA 2WMPB 1BVKB 4WTXA 2NNAA 4BWUA 4N0UA 2V5TA 3HNTL 2OR8A 1RLWA 3T6XA 5C6PB 4NO5A 3KM2A 2WP3O 3V4PB 5B38A 1SQMA 4PJAB 4FULA 3EW3B 3JV4A 4LBEB 1PJ9A 2R0WH 3UTTD 1BSIA 1KYOJ 2XN9D 4XB8A 5EU6D 1R5VB 3GMNB 1UXWB 3IU4L 3P1VA 1D6EA 2H9GA 4JS7A 2UUDK 1TNNA 1QUNB 4N68A 3PXHA 3K46A 3KNBB 1NEZG 3HZMB 3DX8A 1QD0A 4XRCA 3FQXA 3EAKA 2Z93A 5LBSH 1RHHB 3PP4L 3D3VA 4JQVA 1Y0LA 4OD3H 1MVUA 3B3IB 3BAEH 3QORD 4Z3JA 4GQ9L 5I1CH 2GUOA 1EUUA 3O0RL 1AGEA 2W9EL 3Q43A 4E5XB 1ETB1 2NZ9C 2ICWA 2ZD0A 1CGYA 1NCBL 2YGOA 3GD1C 3EDDA 1KC5L 3MMEA 4D0DA 1AACA 4B5EA 1N0XH 4E41E 4TF4A 4B3VA 1D5MB 2NSQA 2JFCA 3TEYA 4B50A 3LDBC 3VD9A 2OCJA 3VXSA 3US1A 1KJMB 4J6RL 3V0GA 2K6YA 5LVEA 3DXAA 1MFEL 3GRBA 2CA3A 2YUVA 4L4TA 3QWRA 3Q8FA 3PJNA 1AZBA 2PXYA 3BUDA 4TVSa 4WFGE 5F7EH 1DVZA 3IGAB 1PDKA 2YMOA 2SODB 2J43A 1XFPA 4KXZH 3Q5TA 1TXKA 3DPDA 3MLSL 3QUMA 1HI6A 3ZDYE 2FX8H 4AL8L 1YNKL 1WTGT 2F5BL 4QOKD 1ADQH 1QRNA 5D1QE 1GA2A 3MSPA 3TYGH 1VFBB 5HYSB 2XFXA 3ILPB 4QXVA 4ZO8A 5T3XH 1MRCH 4YDJB 5ISZB 1AR1D 1MFBL 1Q90A 4HH9A 3VXMD 1DUZA 1IVTA 2YKLL 3MR9A 5SWZB 4XE0A 4LNVA 3VXQA 1IKNA 1A6ZA 2ZXDA 4NM4L 5KBLA 3SKOB 4YDNA 2AGJH 2EQDA 2VLMD 5BS0A 3GSUB 1TZIA 4R96A 1CGUA 1FIEA 3T3ME 3VX1A 1CICB 1UM6H 2XPGB 4EZKA 2EYTA 2DL9A 2X4UB 2E5EA 2WJ5A 1DJXA 3ESNA 1WBYB 5LWYH 3IDMB 4LVHC 2IBGA 1BM7A 4H8WH 1QBMH 1IL1A 1WCBB 4DGYL 1R3LA 2ESVD 1GPOL 2NLJB 2P42B 5DFVD 4YXHH 1FNGB 3OKLA 5FHAH 3T3PB 3TJHD 4ATTA 1CBJA 4M4RB 1AGBB 4OZ4B 4UQCA 4EJ1C 1U41A 3KW7A 4QRPB 4EDXA 4UQDA 5JNYA 4QF1A 4MAUH 5LCVA 3NCYP 4QY8B 1N4XL 2OV0A 3ECBA 4LVHB 2VXQL 3DIVA 2EINB 3HG2A 3JUZA 4J3XA 2HLEB 3RY6A 3L4TA 2ZUVA 5I82A 5EFIA 4I8DA 1ICTA 2X0UA 2BP8B 4QDGA 2O5XH 3GTNA 4KVNL 2YMXH 5FUZL 4YDKL 3OLDA 5BVJA 3TVMC 3OWRA 3LKRB 4KXBA 4PBWD 3ARGA 3OHXB 4GRWF 3DJSA 4GQRA 2WXRA 3TM6A 1W8EA 2PO6D 2QDVA 2I69A 3IDIB 1SM3L 4AEHH 3ZKMD 1NGYB 5IEKA 4J1UA 1AI1L 3I9GH 2ZCKH 4JRYA 2F68X 3UBXI 5KAQF 2EDJA 3R18A 2VMCA 3G08A 3S6CA 2VSDA 1QOKA 1JGDA 4M5ZL 1RK0A 1V05A 1Y7VA 2EACA 3HFFA 3CFJB 1AS7A 2ILLA 4KDTA 3IDGB 4YDZA 4Z5RB 1JZIA 1RZFL 4Z7NF 4WW2C 2XIDA 5I8KL 3HHSA 5GJTL 5B7MA 3ZKXC 2BS71 4QXWA 1RU9H 2DTML 2XG4A 1NM4A 4NOBA 2ZYSA 4OLXH 2VM3A 3QRBA 4C8XA 2B2XL 1KCSH 2VL5A 3LV3B 1J11A 3AJ7A 4QHLA 3R19A 1KIQA 3M88A 1WAEA 1J0KA 2ATPA 2HG0A 4FFTA 3ZUNC 3U7WH 3KPQB 2VSCA 4XP1H 2JJVA 3EOTH 3OKMB 4HAFA 4Y8AA 4DIXA 1Q1JL 4WO4D 1KXQE 4EBQL 3LS4H 4JO3H 2VN5A 3UJTH 1FFOB 3IS1X 4JJOA 4WQOA 4PJHA 1NOAA 4DZ8B 3UZEC 1IC4L 4ONGH 1ZV9A 4A7GF 3CK0H 1AD9B 3AS0A 1HE7A 4UV7L 1IC0A 3KXFE 5DLML 3RX7A 5ITFA 2Y25A 1T4KA 1H3XA 5CGTA 1XH3A 1ORSB 1YO4A 1F56A 1Z9MA 3CFBA 4P06A 3T4AC 4MNQA 1VF5C 3TPUA 4R4FL 4BSJA 2NY6B 1J9SA 2FNWA 4HHAA 4P05A 2ZT9C 1TTCA 3QS3A 1D5RA 1F3JB 3H55A 3ILQC 3NACH 5EOQH 1D2PA 3B3IA 3CH1A 3LKPB 4BZ1L 4NLAA 3F12B 3T65A 1JF1B 3MTRA 4H1LH 4QNPF 4WU5A 4Z9KB 1SXBA 1SXCA 3Q1SL 5I23A 3WUZA 2CMRH 2NW3B 5DD0L 5JHLH 4NZUH 3Q5YA 4RX4D 3T0BA 4BELD 3HCVA 3NYKA 4YBLC 4HG4K 1TUPA 4E2OA 4JUSA 3EDEA 3L4CA 1CG9B 4Q58C 4EAEA 5IQ9B 1IBBA 4OF6A 1HSAB 4NUGH 3KZ8A 4EUPG 3TGXA 5AYQA 4PHXA 2HLAB 4MD0B 5HPMB 1WUZA 2P80A 1XF4B 3BKJH 4XPAH 4GSDH 1UB5B 3ZDXE 4FF9A 5AL0A 4L9LC 3VFNA 3QQDA 5HYJA 4G2AA 5IB5A 4KHTL 4CVZB 3BP7B 5KBKA 1MFDL 3EFFA 3U4BH 3GJFA 2NYZA 4JBSA 4N0CC 4ZXBD 1GAFL 3TIDB 5IVXE 1A66A 2XBTA 4Z7VB 1H15B 1SN0A 3OB0H 4WK4B 3MUGB 3SPVB 1A7QL 1VFBA 1DQMH 3MRRA 4YHZL 1IAKA 3W0WE 3KPOA 4MX7B 4I77H 5DA0B 3KCPA 3CZSA 4YR6A 3WNJA 3N9GH 2AV1B 4F93B 4NPKA 5I5RA 1WZMA 3D0VB 4X4ZA 1INQB 3QGVA 1OANA 4ZUUB 2EVJA 4KDVA 3APFA 2LOEA 3BSZA 1M7IB 3HUJB 5EOTB 1AZVA 4HLZG 4Y2DC 1MHEB 1S4IA 2B5IC 3DIFB 1KPUA 4AKQA 4JFPA 5AB0A 3P30H 4PJHE 1FBIL 3U0PB 1DEEA 3FK3A 4X99B 2J8OA 1J18A 4HGWB 1FFPB 2ZCHL 4Z3GA 3G5VA 2ZOUA 4KKNA 2HN7B 3OXRA 1WFMA 1FG9C 4HK0B 1NL0L 3SE8L 3DVNB 3ROLA 4MNQE 1U8NB 1JBJA 4UQ2B 2Y36H 5DD3H 3CG8A 3FQYA 3QIWB 3E6FB 4I5BA 3VAEA 2X2JA 1D5XA 4PRDB 3RJQB 3AAZA 3H9SA 2AJSL 5I1HH 4C59B 4PP2A 3RQ3A 5D1ZI 5H37G 3TEXA 3ZQWA 1A47A 3GSQA 1OAKL 4OM0L 2X9YA 3UBXG 1AZRA 1RMFH 1HQ4A 3WS3A 1NC2B 5DK2B 2IH3A 1QI4A 3HRZB 4IEFB 3VXRE 1QMUA 1EJOH 1W0WB 3PDDA 4Q6KA 3D85D 4A66A 1AGFB 2M1KA 2X4SB 2ZOWA 3LHPL 3OHXA 5A2LH 3ZQ9A 4B7LA 4YSUA 5BXFB 2CDFA 2WUBH 3D50A 1RIHL 2BWQA 1G7LB 1DQDL 2J5LC 3K1KC 5I1EL 1YNTF 1WCQA 3DA0A 2J6EL 1S3KH 3CN1A 4HUMB 3H56A 4IU2A 1XEDA 5FO9B 4KVCH 3SPCA 1LEKA 2FJFA 5DJ8B 5B1JC 3S9DB 3EYSL 4IIQA 5IUSA 1F1AA 4DFIA 4PTTB 5D6CB 2EABA 4G7YL 3BEWB 3VM5A 1P7KB 2QZ5A 4MVBC 4AK1A 1HEZB 5KUKA 3T04D 1PZSA 4XVJH 2BRQA 4LCUB 4YIQA 5F9AC 4EO5A 1B6DA 5KYUB 1NFDE 4N2GA 4F7TB 4ZAKD 2P48B 5BV7H 2R51A 4OJEH 2YJLA 2X7LB 4BKTC 1CD9B 1Q0XL 4FTVB 4MZIA 4W9FC 1VADB 4JRXE 1J1XH 1UKQA 1GGYA 5IUCA 1PG7X 1GCFA 1HNGA 2HJFA 4WW2A 4X6DF 3FOLA 4X6CE 4WI0A 4QKTA 3I02A 1WA2X 2GJJA 4LEEA 1NANH 5D7IB 5LN8A 1NCGA 3NJHA 2HVJA 4IBWA 1YMMA 3N0AA 5JW4M 3IU4H 1GGIL 2FECI 4RDBA 4XNXL 3OSKA 4PJGB 5TJWK 1K3IA 3EHBC 2V9QA 5E4EB 2WLJA 3Q9QA 4Z7QB 1LO5A 1U30A 1NLBH 4M00A 1TQCC 1TCRB 3W5NA 1IAOA 3QZWA 3EGSA 3HS0C 3UZEA 4HJGB 3K3QA 4XVTH 4R2GB 5I26A 4A6YA 4GQ9H 1FYTD 5EZLB 2CR3A 4QXUL 3O0RH 4DKAA 1OD7A 1EGJL 1HSBA 2W9EH 3PNWA 9CGTA 4N4YB 4QTHA 4WJKB 3T4AA 1BMZA 2EIMB 3L9BA 1JF1A 1PSKL 1EAJA 1F3DH 4I1NB 5AW0B 1NCBH 3TFBA 4DHLA 3LEXB 4M8UA 5KSAC 1U8QB 1KC5H 3HS0B 2RGSA 4X6FB 2NW3A 2V8LA 3KYNA 4LLWA 1U8OB 3A6CL 1KBWA 2RALA 2UZXB 4KY1L 1PNDA 2IQAB 1R5IB 3H6AA 1TJMA 4U3SB 4PQXA 5D7KE 5FYJL 4F7EA 2A77H 2VJ0A 5E6UB 3D2UD 4WEMB 5C92A 1MFEH 3ARBB 1UB5A 2HRLA 3MRMA 3WI9A 2V17L 4K7PL 4ORGB 5FIEA 2VDQL 2VOTA 2DYSB 1VEMA 3WNOA 2BINA 5IP4A 5I8EA 1SVZA 1UVQA 1EFXA 3ROOA 2P7TB 3FQNB 4AL8H 2ARJA 1YNKH 2F5BH 3R0MA 4YJZL 1DFBH 1BXAA 4I0PB 2XUWA 4WDIA 4L9LA 2NZIA 1MFBH 3SGDH 4PRHB 2GAZA 5E4AA 1ZTXE 4U4IA 1LXMA 2ORBH 5EEVA 2YKLH 4K3EH 2Q0ZX 4HKZA 3QFDB 4I18C 4NM4H 4A7SA 1ZHKB 2AV1A 2JKNA 1G7QB 2IAAC 4ZUUA 4KK5D 3HUJA 5EOTA 4GG8A 4UCFA 3OZLA 1TTUA 1YLBB 3W11D 4X4XB 1DO6A 3LXAA 1T7VA 2F7QA 2CO4A 3O3BB 3RZWA 25C8L 1YMME 1ZT4A 4K71C 1EEYA 3U0PA 4K8RD 3ABLB 1M1SA 4YUEL 2OL3A 4MWFA 3CQPA 1GPOH 2HN7A 2OMWB 3GHPA 5E08H 4APQC 4Y2DA 1KGYE 2GC4C 5K39A 4B9GA 4Y5VC 2BPBA 4K9JA 2XQ0A 4X5WB 4YDIL 4ZFGL 2N56A 2X6UA 5EC2A 2AKRB 2VXQH 2EYRA 3WOVA 1CFSB 1S7TB 3H3PL 5I1LB 4OFYA 2AMGA 3IMUA 5FFGA 4KVNH 3EXJA 2P49B 4U2YA 1S5IL 4OD2B 1HWGB 5DK2A 2LQRA 3KPMB 4F5CA 3VB9A 4KH9A 2H41A 2X4SA 4MLIA 4A63A 1X7TA 5E1AA 1SM3H 5IKCB 1T3FB 3ZL4H 1G7LA 5LLIC 3OG4B 3UO1L 4XXDB 1HHIA 1AI1H 1P6AB 5GS0L 2O5YH 3BSGA 4RGNB 1MI5E 4PWHA 5D1XB 1L7IL 4IOIB 3GRGA 4LPUA 4R7DA 1E2ZA 1CJYA 5E4IA 4M5ZH 4LVOB 2JB6B 4L9DA 4PJ7E 4JL2A 5IF0A 2EXYC 3MRDB 1GC1C 5D7LE 2H2SD 5EWIL 5BV7B 3T0EC 1HEZA 1DANT 1PZ5B 4LCUA 2ZXAA 1P4BL 5GJTH 2JELL 3L9RB 4ICXA 2XQBL 4Q52A 4F91B 1Y6KR 2DTMH 5B1JA 5B21A 3RL1B 3WEXA 3BPNB 1P6FA 5J6SA 2B2XH 1T1ZB 4PLOB 4CJ1A 2K0RA 2WQRA 1GGBL 2WM0A 2AJ3A 4GP5B 1OY3B 3WAJA 3K7UA 4U49A 4XBPA 5IB2B 2E76C 1JGIA 1V3JA 5EBWB 2OP4L 1TJHH 1XDTT 1Q1JH 2EDBA 5J11B 3GSXA 1FZJA 1HC1A 3M8OL 5D7SL 3DTXA 4EBQH 3T0DA 3F5WB 4M02A 3MOAL 2VM4A 3FHQA 2V9UA 3VYOA 4A2LA 3O9WC 1IC4H 1YC8A 4G7VL 2J6WA 1NBCA 3BVNA 2VZUA 4G59C 3RDTC 1TZHB 5LGKA 4XMPH 3S36L 1JPFA 1LJMA 1TSHA 5DLMH 2CXGA 5AB1A 1M7XA 2VKXA 4F20A 4FHBD 3F84A 4X5XA 3HLKA 4L1DA 5CN1A 2WIMA 2B20A 1EPFA 4FYQA 4HIJB 3VG9B 4R4FH 5I6OA 2YKKA 5FECB 5HGDB 3BLKA 3ULVD 1YMHA 3KWVA 4LP4A 4ZS7L 1ZJBA 5F89B 1U0QA 2ZAGA 2FLMA 3OLGA 1ZLWK 1F8TL 2JKWA 3HE6B 4UBDC 1FH5H 1RZJL 3Q1SH 1ECYA 4AYEC 3SCMB 5DD0H 4ZMLA 1CGXA 3ARYA 3CLEL 3HS0A 4X6FA 5C0BD 4JX0A 4HWUA 4WJ5B 2VLRD 3CGTA 3BH4A 2CPUA 2Y24A 4FABH 3ARDC 4X2UA 4UM9B 3BZEB 2WZ0A 3ZZLA 4U3SA 2QFPA 4WZ9A 3CVBA 1KYAA 1I3RA 3VD4A 5DUJA 1E4WH 2Q3ZA 5KSAA 1EDQA 4UT6A 1FVEB 5JPNC 1R4XA 1FV1A 3NA9L 4N8VG 4KHTH 5IQ7L 5D1ZD 3VI4E 1OE3A 2R2BA 5KJRL 2BJML 4N1CA 4ZG1A 5MEQB 2YWZA 3C6SB 5TGBB 1F4XH 3U2JA 3QPXL 3IMTA 3OAYH 4JHWL 1MW0A 2LLLA 1JZ8A 1F11A 2AC0A 1A7QH 4YHZH 2HTKC 3GRWL 3HN8A 3LKSB 4NUMA 3SDXF 4KNQA 3Q44A 5CLTA 3GMPA 4GNKB 4Z7OF 1E8XA 3QFDA 2B3IA 5B1AB 5IHZA 1DVFB 1GIGL 2RTTA 1Z9OA 4PMFA 3E3QC 3GUTB 4YDVB 4X4XA 3WUWB 3O3BA 3B6SB 3FT4A 1WPCA 1G9HA 3EOAB 4I18A 2ZCHH 2AQSA 2EH7L 3C6LC 4NHUB 3PXLA 4M7LH 2LTQB 3CZKA 1I8KB 2D7NA 2WN3A 3MJ7A 4M8RA 5KOMC 5TTRA 5I8OL 2QGEA 1E27A 4UOQA 4XP5L 1IILE 2P5EA 4QRQB 2OCCB 4FGMA 3HC4L 2W1NA 5EBGA 5CFHA 3NJMA 4WK0B 1R0AL 4BFFA 5C9JB 3QWOA 3U7YL 1LO2L 2AJSH 3HOGA 1CL7L 5K9JL 5I17B 4QUOA 2F5AL 3S8GB 1FN4B 3AG3B 1OAKH 3G6JB 4OM0H 4KMTL 4XX1E 5KJ4A 2HFTA 2NUPB 3BZ5A 4APQA 3VWKD 2GCYA 1A8JH 1KZYA 4MD4B 3UTZB 3QEHB 5D9SB 4Y5VA 1WAAF 4XN8A 1CC3A 3LHPH 2WLLB 3S3SA 3P3UA 3PWNA 3COOA 4PG9B 1RIHH 5I1EH 3GGWA 2VLLA 4QCIB 1IGYA 1U8PA 3VWJC 3VE0A 3OAUH 2AQ3A 2CIKB 1MLBB 2VDPL 4KRLB 1R46A 2NY0C 4WFFD 3LQMA 2FD6L 3MNVA 1CGVA 3EYSH 2X4OA 3CFEB 3WXVH 1MOEA 3FN9A 4BA8A 4F2ME 4G6KL 4LCCB 3N85L 3HG4A 3PV6B 4PIRF 3WTSA 4YZFF 5I0DA 4X5QA 4D0CA 5DLLA 5C8JB 1PZ5A 2YXVA 4N2FA 2IDSA 5FLVA 3D07A 3HVDA 1KNOB 3L9RA 3QNYB 4Z3TA 2XN9E 3FONA 3I6LE 5EU6E 3AY2A 3R06B 43CAA 1ZLSH 1F42A 2GTZB 4YPGB 1T1ZA 4GKNA 4HIIB 2WIIB 3FF8A 4G11A 5DCCA 5KS9B 3N42B 4J3OG 2MNJB 3WV0A 2J1WA 3WNMA 5IB2A 3T0EA 5HDRA 5DVPA 1G7JA 3V0HA 1QR1B 2O72A 5ID0B 5JW3L 3FTZA 4LLMB 3GKWL 3KLAA 3O3DA 1KCUL 1BBJA 3AM8C 2QL1A 1RHFA 3VXPB 1AHMA 1AGDB 4PVLA 5LGYA 4L5FE 1GGIH 3E38A 1KXHA 4NDMB 4ZO9A 2A6KB 2XX0A 2IGFL 1WUNT 2A5UA 4P5TB 3D08A 1S7XB 1FFRA 3CDGA 1I9RH 5ESQB 4FFZH 4XCNA 5I1DB 1BLIA 3H0TA 3IS0X 1XGYL 2EE0A 3O9WA 4M3KB 3WN6A 4ANUA 2CZNA 2N01B 4HUXB 4UI2A 3RDTA 2AZUA 4QXUH 1J8HA 5F89A 1OTTD 1EGJH 5AKSA 3SBQA 4R8WL 3AQYA 2GSGB 4ONFL 4P2AA 1NGZB 3QI9D 4J3WA 1MCWW 1UZGA 3SHSA 3OJMB 2W9DH 1A21A 4MMZB 3TV3L 2DQFA 1MRDH 2PF6A 4A7QA 4G8FA 3A6CH 4RMVA 2MOGA 4QOKE 4G6FD 4L4VD 3AY4C 4MCYB 5FYJH 3U4EB 1MVYA 3N40F 2IH1A 5CGMA 1V10A 3NZSA 4DP6X 1GCYA 5JDSA 1OCCB 3HG1B 1ERNA 4X42A 3C8HA 5AZEL 3VXME 1FVEA 3HG0A 4P46B 3WKQA 2VDQH 3FO2A 2CBPA 5JYLA 1WISA 3QUZD 2CHNA 4PRID 1O6TA 3CE1A 1W72L 4PJAF 2KZBA 4MA7H 1JGUL 3ARDA 5DSCB 2EICA 2EIDA 3MREA 6PAZA 2QSTA 5TGBA 3KGTA 3NDYE 4MNHB 1ZIAA 3IFLL 1KTLA 5JPNA 4QRTB 4XOEA 1INDH 5JW5B 4JM2C 3QEQD 5HGAB 4YQXL 1R9FA 3WFBL 5D70L 2YQ3A 2LT9A 4ZW7A 4NZDA 2XVGA 2ESVE 4L4JA 4YWGL 5FFOA 3T0EE 2A6JA 3O4OC 4NZTL 1V7NL 4RA3A 4U1KB 1WZ1L 4S1QL 2O6EA 3BGFB 1FYHB 3CN4A 5AD0B 3PWVB 2O30A 25C8H 5L4MA 1DP0A 1S7UA 2XN2A 2X1QA 3KPSA 2DEXX 5JIIA 1IM3A 2C9PA 4RCAA 4AIEA 4EI6B 3ULUC 4WKXA 2ARJQ 2WXLA 3ARVA 4YAQA 5E8EB 5IVNA 4PW4A 1IGIL 2J8UB 4KUZL 4J4PA 2A6IA 4N0FB 1TJXA 1AOZA 3QYNA 2PCPB 3WIHA 1TTBA 4X6EB 2F8VA 1AKJB 2WW8A 3AGWA 3HW7A 1GH7A 2XTSA 1JERA 3O8XD 5DVNA 1VFAB 2BFVH 5BOZG 4HJEA 1MFAL 3C6LA 1J8HE 3H3PH 2OMUA 4Y16C 2F61A 2VMFA 4BKLA 3BWSA 1FN4A 3SDCC 3G6JA 3PPEA 4ZD3L 1DBKH 5G5DA 2NUPA 4MD4A 1X5AA 2GK2A 5FO7A 3VRJA 3IMVA 1GZQA 3OKYA 1CDJA 2VNCA 4PJ9C 2ADGA 3QXDB 5CKGA 1ZXKA 2VZ1A 3WG7B 4CW1B 5AOKA 5MI0B 3B9AA 3QZPA 4Z0BL 1KZQA 1R19A 3QFGA 5TK2A 3UO1H 3IDJB 3MCKB 5C3LD 5I71C 4XAWL 5GS0H 2Y9RT 5GRYA 2DF3A 4KXCA 1L7IH 4PJ9B 5IVOA 1WLHA 2KH2B 3PGDA 4GAFB 2P8PB 4K7FB 4G8IB 1G4RA 3VFRA 4GT0A 3KE0A 5I71B 2PP9A 1ACCA 1YVLA 3OXSA 3MBXL 2VDRL 4FQ2H 4RNRA 5EWIH 1A4AA 3GSVB 5I9QB 4OI8A 2R39A 1YA5A 3IFOA 2PTTB 3IGKA 1P4BH 1QW9A 2JELH 2RB8A 4UANA 5EU5A 2ZYRA 1SXZA 1T7WA 3QNYA 3VXUA 3TBYA 2HKHL 1QTPA 2ERJB 2YEQA 4TMPA 3PP3H 3V4VL 1KPVB 5KS9A 5E5UB 2IV8A 2OP4H 1X3DA 1SHWA 4PB0L 4ONHB 4XMTA 5C0JA 3S2AA 3OB0K 4J28A 3M8OH 4X9IA 5D7SH 3TONA 1EX0A 1L9QA 3UCRA 3MOAH 1OSPL 1FSKC 4OJCA 15C8H 4G1EB 1RERA 3FQWB 3IU3A 2ZKYA 3PJLA 3QNZB 2P46B 3KPSE 3RFZC 5E8PA 2GC7C 1DHKA 5E9DB 5HGHB 4P5MB 3V4LA 4MAYC 2L8AA 3D48R 2OX5A 3DMMC 2J5WA 4NPYA 4HWBH 3AM8A 2LFGA 4WUKH 3IXTB 1YAZA 4RFEA 4BZ1A 3KL0A 5I1DA 4I1PA 3O6LH 2JKJA 4KBPA 4ZS7H 2A74C 5I1HL 3MJ9L 4P23D 2ICEC 3V6FB 4GQQA 3IXAB 1VKXB 1ZSDA 3T1FA 1N26A 1UHVA 3EJJX 4WHTA 2R0KL 3DMMB 3CN0A 1NGZA 4GI8A 4LSTL 1EEZB 4FXLA 5L9DL 3MV9D 2DL2A 5KG9A 3NGBC 4XAKD 5AVTB 4PHZA 3ZSTA 3D51A 1EZLA 5E0FA 3ZYJA 2IAND 1M3JA 2VDQB 5TK4A 1YPZA 2B9AA 3ZX1A 4ZMOA 2X89D 1BZ9A 2COVD 2QJDA 3NA9H 4IKIA 3NAAH 4WTQA 5IQ7H 3FBQA 1I3GL 5LGHL 2WTRA 1J7VR 1TZAA 1H5BC 1NMBL 3NGBB 3CFTA 4RQQA 3X12A 2VW6A 5D1QB 1HHHB 3ZN6A 2BJMH 5KJRH 4WWOA 3UTSD 2J71A 3AQZA 3I3BA 5CZXD 3AY4A 4U6VH 1FI8C 5L88H 1SRDA 4JFZL 1PJWA 4JHWH 1UEMA 4GIPD 4U1HB 3GRWH 4TUUA 1JXDA 2VR7A 1I82A 2WWKO 4I0KA 3VXUE 5HGAA 3TEZA 2ADFL 1RJCA 4JN2A 1I7RA 4PS4H 3FH5A 1CD0A 1W9XA 4FQHB 2J1XA 3OF6A 3Q5OA 3T3MB 4Y0GA 4JFHD 4Y5YB 3P0YL 2Q7AA 4CSTA 2XWEA 3LSOB 5LUMA 4RETB 4B53A 3BPLB 1TQTA 3MLWH 4JM2A 3U2IA 3TXAA 4ZOEA 2H4EA 1UZ6E 2IWGA 3VD0A 3PWVA 3WY1A 3CHQA 2CGRL 5GSVA 2E7DA 2FO4B 1AZZC 2EH7H 3OR6A 4GMTL 4M7LT 1IAII 4OB5L 4W6WB 4PCTA 1IARB 1T66C 3OLIA 4PGDB 3POHA 3TX4A 4MQXC 4XP5H 4AKOA 4K23L 4KPHH 1KDIA 4EN2A 4X0KB 2AJZA 3HC4H 4KI1A 3S5LB 5CZRA 1S7SB 5IB3B 1R0AH 3U79A 4ELME 4PRBB 2H3XC 3U7YH 1LO2H 4A7VA 5FYLD 1CL7H 1G1CA 5K9JH 1BCIA 2F5AH 2D7MA 1M42A 1GZHC 1JWSA 4NGHL 5J56B 3CBRA 1HH9A 5CEZD 1WE5A 1S78D 4FA7B 5I5JA 5JHAA 3GTTA 4WFEE 2FO1A 1VZGA 3AS3A 1BZ8A 3LRGA 1ITCA 2J6EA 2AXHA 4G7QB 3RPBA 3BP6A 4JB9L 4HV8B 4LMQI 4IGBD 5DI8B 3BAJA 4Z7VF 2WAHA 3K72B 2WBJB 2NOYA 4F33A 5CCKL 2JB5L 1KLGA 3MZTA 4Y16A 3RJDA 4OIAA 3SDCA 5E6ID 2MQ0A 2VDPH 3IDJA 4AUYA 4UU9B 2BY0A 3QIBD 4OZHB 3WYRA 2FD6H 1RD6A 4FQIL 4FADA 1RK7A 4PJ9A 3F65A 4G6KH 3BN3B 5HD8D 3BFOA 3ZYZA 1Q38A 3MTXA 5HI3C 4XBEH 4NKMA 1D9KB 4BKSC 1A6VL 2H0EA 2X3AA 5IK3B 3RB5A 2XZCL 1ZEAL 4M1GL 4IDJL 1N0LB 1YRKA 2R23B 5I15H 1WFOA 1DQQA 4OZIF 3RVVC 1Z9PA 4JKPL 1LEIB 1TJIL 1UWFA 5DC2A 3S88H 1SZNA 1T6BX 3IK2A 3QJRB 2VR9A 1JFQL 1S9XB 2XY2A 4V1DD 5FFLA 2O6CA 4CA4A 3H53A 3L5WA 3GKWH 1KCUH 4JKWA 4RZKA 1EFQA 4GT7A 2J20A 2N59A 1KBBA