4GIUA

Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd).
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
346
structure length
346
Chain Sequence
b'VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Repurposing the Chemical Scaffold of the Anti-Arthritic Drug Lobenzarit to Target Tryptophan Biosynthesis in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transferase inhibitor
total genus 123
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4giuA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4giuA02
4YYYA 3R6CA 2BPQA 4GKMA 2WK6A 4IJ1A 1ZYKA 1ZXYA 1O17A 4X5BA 4MUOA 4HKMA 4GTNA 3QS8A 5EY3A 2TPTA 3UU1A 4N8QA 1GXBA 4YI7A 4LHMA 5BYTA 5C7SA 4GIUA 2J0FA 1V8GA 2DSJA 1ZVWA 3QQSA 4OWNA 3R88A 4OWQA 4XR5A 1KGZA 3GBRA 2WK5A 5C1RA 4X5CA 5C2LA 4ZOFA 1OTPA 4ZOKA 4ZOJA 3QSAA 3H5QA 4ZTVA 4X59A 4OWUA 1KHDA 4N5VA 4YEKA 4OWOA 4OWSA 4EAFA 2GVQA 4X46A 1BRWA 4GA4A 3TWPA 4OWVA 1UOUA 5BO2A 4N93A 4GA5A 1VQUA 5EP8A 4OWMA 4M0RA 4EADA 5BNEA 3QR9A 2ELCA 1AZYA 4GA6A 4X5AA 4X58A 5BO3A 4X5EA 4X5DA
chains in the Genus database with same CATH superfamily
4YYYA 3R6CA 2BPQA 4GKMA 2WK6A 4IJ1A 1ZYKA 1ZXYA 1O17A 4X5BA 4MUOA 4HKMA 4GTNA 3QS8A 5EY3A 2TPTA 3UU1A 4N8QA 1GXBA 4YI7A 4LHMA 5BYTA 5C7SA 4GIUA 2J0FA 1V8GA 2DSJA 1ZVWA 3QQSA 4OWNA 3R88A 4OWQA 4XR5A 1KGZA 3GBRA 4F3FC 2WK5A 1RF8B 5C1RA 4X5CA 5C2LA 1RRZA 4ZOFA 1OTPA 4ZOKA 4ZOJA 3QSAA 3H5QA 4ZTVA 4X59A 4OWUA 1KHDA 4N5VA 4YEKA 4OWOA 4OWSA 4EAFA 2GVQA 4X46A 1BRWA 4GA4A 3TWPA 4OWVA 1UOUA 5BO2A 4N93A 4GA5A 1VQUA 5EP8A 4OWMA 4M0RA 4EADA 5BNEA 3QR9A 2ELCA 1AZYA 4GA6A 4X5AA 4X58A 5BO3A 4X5EA 4X5DA
chains in the Genus database with same CATH topology
4YYYA 3R6CA 2BPQA 4GKMA 2WK6A 4IJ1A 1ZYKA 1ZXYA 1O17A 4X5BA 4MUOA 4HKMA 4GTNA 3QS8A 5EY3A 2TPTA 3UU1A 4N8QA 1GXBA 4YI7A 4LHMA 5BYTA 5C7SA 4GIUA 2J0FA 1V8GA 2DSJA 1ZVWA 3QQSA 4OWNA 3R88A 4OWQA 4XR5A 1KGZA 3GBRA 2WK5A 5C1RA 4X5CA 5C2LA 4ZOFA 1OTPA 4ZOKA 4ZOJA 3QSAA 3H5QA 4ZTVA 4X59A 4OWUA 1KHDA 4N5VA 4YEKA 4OWOA 4OWSA 4EAFA 2GVQA 4X46A 1BRWA 4GA4A 3TWPA 4OWVA 1UOUA 5BO2A 4N93A 4GA5A 1VQUA 5EP8A 4OWMA 4M0RA 4EADA 5BNEA 3QR9A 2ELCA 1AZYA 4GA6A 4X5AA 4X58A 5BO3A 4X5EA 4X5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYY A;  3R6C A;  2BPQ A;  4GKM A;  2WK6 A;  4IJ1 A;  1ZYK A;  1ZXY A;  1O17 A;  4X5B A;  4MUO A;  4HKM A;  4GTN A;  3QS8 A;  5EY3 A;  2TPT A;  3UU1 A;  4N8Q A;  1GXB A;  4YI7 A;  4LHM A;  5BYT A;  5C7S A;  4GIU A;  2J0F A;  1V8G A;  2DSJ A;  1ZVW A;  3QQS A;  4OWN A;  3R88 A;  4OWQ A;  4XR5 A;  1KGZ A;  3GBR A;  2WK5 A;  5C1R A;  4X5C A;  5C2L A;  4ZOF A;  1OTP A;  4ZOK A;  4ZOJ A;  3QSA A;  3H5Q A;  4ZTV A;  4X59 A;  4OWU A;  1KHD A;  4N5V A;  4YEK A;  4OWO A;  4OWS A;  4EAF A;  2GVQ A;  4X46 A;  1BRW A;  4GA4 A;  3TWP A;  4OWV A;  1UOU A;  5BO2 A;  4N93 A;  4GA5 A;  1VQU A;  5EP8 A;  4OWM A;  4M0R A;  4EAD A;  5BNE A;  3QR9 A;  2ELC A;  1AZY A;  4GA6 A;  4X5A A;  4X58 A;  5BO3 A;  4X5E A;  4X5D A; 
#chains in the Genus database with same CATH topology
 4YYY A;  3R6C A;  2BPQ A;  4GKM A;  2WK6 A;  4IJ1 A;  1ZYK A;  1ZXY A;  1O17 A;  4X5B A;  4MUO A;  4HKM A;  4GTN A;  3QS8 A;  5EY3 A;  2TPT A;  3UU1 A;  4N8Q A;  1GXB A;  4YI7 A;  4LHM A;  5BYT A;  5C7S A;  4GIU A;  2J0F A;  1V8G A;  2DSJ A;  1ZVW A;  3QQS A;  4OWN A;  3R88 A;  4OWQ A;  4XR5 A;  1KGZ A;  3GBR A;  4F3F C;  2WK5 A;  1RF8 B;  5C1R A;  4X5C A;  5C2L A;  1RRZ A;  4ZOF A;  1OTP A;  4ZOK A;  4ZOJ A;  3QSA A;  3H5Q A;  4ZTV A;  4X59 A;  4OWU A;  1KHD A;  4N5V A;  4YEK A;  4OWO A;  4OWS A;  4EAF A;  2GVQ A;  4X46 A;  1BRW A;  4GA4 A;  3TWP A;  4OWV A;  1UOU A;  5BO2 A;  4N93 A;  4GA5 A;  1VQU A;  5EP8 A;  4OWM A;  4M0R A;  4EAD A;  5BNE A;  3QR9 A;  2ELC A;  1AZY A;  4GA6 A;  4X5A A;  4X58 A;  5BO3 A;  4X5E A;  4X5D A; 
#chains in the Genus database with same CATH homology
 4YYY A;  3R6C A;  2BPQ A;  4GKM A;  2WK6 A;  4IJ1 A;  1ZYK A;  1ZXY A;  1O17 A;  4X5B A;  4MUO A;  4HKM A;  4GTN A;  3QS8 A;  5EY3 A;  2TPT A;  3UU1 A;  4N8Q A;  1GXB A;  4YI7 A;  4LHM A;  5BYT A;  5C7S A;  4GIU A;  2J0F A;  1V8G A;  2DSJ A;  1ZVW A;  3QQS A;  4OWN A;  3R88 A;  4OWQ A;  4XR5 A;  1KGZ A;  3GBR A;  2WK5 A;  5C1R A;  4X5C A;  5C2L A;  4ZOF A;  1OTP A;  4ZOK A;  4ZOJ A;  3QSA A;  3H5Q A;  4ZTV A;  4X59 A;  4OWU A;  1KHD A;  4N5V A;  4YEK A;  4OWO A;  4OWS A;  4EAF A;  2GVQ A;  4X46 A;  1BRW A;  4GA4 A;  3TWP A;  4OWV A;  1UOU A;  5BO2 A;  4N93 A;  4GA5 A;  1VQU A;  5EP8 A;  4OWM A;  4M0R A;  4EAD A;  5BNE A;  3QR9 A;  2ELC A;  1AZY A;  4GA6 A;  4X5A A;  4X58 A;  5BO3 A;  4X5E A;  4X5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...