4GJ2A

Tyk2 (jh1) in complex with 2,6-dichloro-n-[2-({[(1r,2r)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
b'TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 288
sequence length 288
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gj2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gj2A01
4H3BA 4YGAA 5FP6A 1RJBA 4I5CA 3S95A 3LMHA 3K54A 2F2CB 3A60A 1ND4A 1Q4LA 3KCKA 5AV4A 2OJIA 2WFYA 2WGJA 3GU4A 3PXYA 3QUPA 5FXRA 4BYIA 3KRRA 4FSYA 1V0PA 2RSVA 4BHZA 3HV7A 3QKKA 5CSXA 1FVVA 5DVRA 3D5VA 3CE3A 3OW3A 2PVMA 4FKVA 4EI4A 3ZFMA 3BGQA 3I4BA 2QG5A 3W55A 2BROA 3RHKA 4FOBA 2BR1A 1R1WA 1ZARA 4FT3A 4UBAA 5L6WL 3NUXA 3QCYA 3F3ZA 2ERKA 3EFJA 4FVQA 1R39A 5AM6A 2J6MA 3F3WA 1UV5A 3RPVA 3F2NA 4CMOA 3DAEA 3HRFA 3ALNA 3O8UA 5C8KA 1FGIA 2ZM4A 1OKYA 5HG5A 4BCPA 2GNJA 3F3VA 3PVBA 1OPJA 4BN1A 4NK9A 4XS2A 2UZVA 3TIZA 3ACKA 3DU8A 3Q53A 5M53A 4P4CA 4D2TA 4RVKA 3D5WA 3ZONA 4DEEA 4BCGA 3RAIA 4EKKA 3TACA 3ZUVA 3C5UA 3COKA 3KC3A 4ASEA 1YXXA 4DFLA 1P5EA 4FV4A 3VAPA 3A7JA 4L42A 2XB7A 4NSTA 4O7RA 2BZKB 3Q04A 2CNQA 4H36A 1UNLA 4RQVA 4WUNA 4IVCA 5L4QA 4AOTA 4DFZE 4YPDA 3P23A 1WCCA 3C0IA 2BDWA 3E3BX 3KMUA 2FYSA 2Y0AA 2OZOA 3B2WA 3GC9A 4EQUA 1OIRA 3DS6A 3HP5A 3TDVA 4DCEA 1LPUA 4MK0A 5HBJA 5AM7A 1VR2A 3FZPA 4ACCA 3UJGA 2Y9QA 1K2PA 4FIFA 2C30A 4EHZA 4IFGA 3UIMA 5M08A 1YHWA 3ORTA 3ORZA 4K33A 3V5LA 5ANEA 4G3DA 4FV3A 4KD1A 4JBOA 5LVLA 5KMOA 4IAAA 5C8NA 4NFMA 4QMNA 5KHXA 1DI8A 1BI8A 2IG7A 5BVDA 3L9LA 2OKRA 4DH5A 2W1DA 2OH0E 4MXOA 1NVRA 2WQBA 2Z7SA 1Q99A 3FHIA 3ET7A 3Q96A 1WFCA 2QCSA 2AC5A 3GU7A 3GC0A 3VF8A 3OXTA 5BVWA 3FEGA 4DLJA 2WEIA 2XKCA 4YO4A 5M06A 4NM3A 1WVXA 4BGGA 4G6OA 4UALA 5BUJA 2VGPA 3ANRA 3HRCA 3KEXA 3MFRA 5HNBA 3W1FA 3ZUUA 4PDYA 1H1QA 1PMNA 3G33A 3FY0A 1J7LA 3C0GA 4RVTA 2C5OA 3VBXA 4XOZA 5CQWA 2R3KA 4ZJJA 3T9TA 2ITUA 3LZBA 3CIKA 4ERKA 5GZ9A 4YZNA 5I9VA 1H1SA 2O5KA 4FA2A 4QQ5A 4ENYA 3KULB 4ZSEA 3DQWA 5KBRA 3O71A 3TXOA 3W16A 4NCTA 4C38A 3FKNA 3THBA 4AU8A 2J2IB 4WNPA 2PHKA 2RGPA 3UPXA 2WXVA 3ZFXA 5HNIX 3BHVA 5IQAA 3QTWA 3QLGA 2WTWA 4WRGA 4AUAA 4EZ7A 4BR3A 3GI3A 2OIBA 5LQFA 4F4PA 1OKZA 5AUWA 4V01A 3MA6A 3F88A 3T9IA 2XKFA 1OL1A 2ETRA 3E92A 4E5AX 5CALA 1BLXA 3I60A 4R7IA 4ACGA 4RJ3A 4CQGA 2E9UA 4NTTA 5AAEA 5JN2A 1ATPE 2IVUA 1IA8A 4QMOA 4D0WA 2YEXA 2FVDA 3ZO1A 5KMKA 2F7ZE 3I0QA 4M13A 4MQ1A 4O0UA 3PVUA 5J95A 1M7NA 4DYMA 2GDOA 3CBLA 2X2LA 2W0JA 2EU9A 5M4CA 4GK2A 5IA5A 3W8LA 4NM7A 5BVOA 1PY5A 3P7CA 4GKIA 3A8XA 5FEDA 3ZUTA 2X2MA 2CKEA 3L8VA 4OTDA 4OTPA 1IA9A 3IS5A 1OECA 3LFFA 3OUKA 3FE3A 4GFMA 1WBOA 3FC2A 1YWNA 4L53A 4A9YA 2VWUA 5C27A 2R3NA 1NVQA 4FVPA 3DJ6A 4FTRA 3UG2A 4AGDA 4L7FA 4AWIA 3WI6A 3QQLA 1OUYA 3FJQE 4D28A 4G5PA 4JR7A 2J0LA 2PZIA 2QO9A 2R0UA 2OI4X 3RALA 4BBMA 3A7IA 4KAOA 3F9NA 2JGZA 4EQMA 3TZ7A 3OW4A 4CVAA 5DMZA 2P2IA 4KRDA 5JQ5A 4JJRA 4UWYA 4UB7A 4ZLZA 1WVYA 1PKDA 4QQCA 4IAIA 5J7BA 5I3OA 4HVIA 5IMXA 3AMYA 2G15A 1VEBA 4QMTA 3TNHA 3FLZA 3QD4A 4AF3A 4BYJA 4U42A 1MUOA 2OG8A 2HYYA 5AR3A 3DB8A 4GCJA 4XP0A 2R3JA 4RPVA 5HCXA 5HKMA 2Z2WA 2EXEA 4AT4A 1M2QA 4FNXA 4K0YA 1BUHA 2X8EA 1H25A 4JBQA 4IM3A 4FT9A 2VX0A 4RX9A 4I5HA 1O6YA 2PVHA 4Y85A 4AOJA 4YHTA 3W2QA 2C1BA 1KE8A 2NPQA 1GZKA 2EXCX 4M0YA 4F7JA 1PXPA 3QYWA 4YMJA 3LFEA 4FKWA 4R6VA 4RIXB 3UVRA 4ZAUA 4H3PA 2BCJA 4PTEA 3OROA 2UVXA 5E8TA 2W1HA 2YM4A 3G0FA 4FV1A 1CTPE 4C4HA 2WIPA 5KKRB 2C6MA 2QR7A 1DAYA 3NEWA 4IB5A 3N4TA 3DFAA 2YWVA 2XNOA 3O23A 3LPBA 4FL3A 4R7HA 3AC1A 3PJ2A 4II5A 4R7BA 5B2KA 4JIKA 4ZY4A 4U6RA 3O7LB 4NIFB 2B52A 4AA5A 3UO5A 3BWFA 4E8AA 3GU5A 2F2UA 4H39A 4FK3A 4AAAA 2OIDA 3HMNA 4GIIA 1UNGA 2GS7A 5EM5A 3CD8A 1LUFA 1HCKA 4QYYA 3W8QA 5CWZA 2QKRA 3PE2A 3AC4A 3P0MA 4X3FA 2ZM3A 3U51A 1ZLTA 4JAJA 5A4EA 1XJDA 3BLHA 2JIIA 4FIEA 4S34A 5HD4A 4EUTA 5HI2A 4ID7A 5IMEA 3OS3A 5F9EA 2R3PA 5BUEA 4HGTA 4HYHA 3VHEA 3F5GA 3OEZA 3REPA 4BTFA 3ZO2A 5IA3A 4TYGA 5AWMA 2C5XA 3BE9A 5KZIA 5I9XA 3OWKA 4PRJA 3RP9A 5BX0A 3BQRA 5E7RA 3V51A 5AUTA 3TNPC 4RGJA 5CYIA 3R7UA 4AZSA 5K0XA 2ERZE 2RL5A 3GENA 5AP0A 3ULZA 4CRSA 4WNKA 2W06A 3BI6A 2WMTA 3WOWA 4DGOA 4LRMA 4K77A 3RMFA 1J91A 4O7VA 4FMQA 4FKIA 4B9DA 1ZYLA 3MPTA 2IW8A 4DN5A 5ANOA 3W2OA 1KE6A 1MRVA 4TPTA 5AP5A 4EJNA 2Q0BA 4DH1A 3OEFX 4F9BA 4CD0A 4F64A 4QPSA 5HE1A 2WMQA 4IC8A 2XM8A 1ZY4A 2W9ZB 4N4SA 2YLFA 4PMSA 3COIA 4BKJA 5CU6A 4EWQA 3G6GA 3KK9A 4YSJA 3PSCA 1PXOA 3BRBA 4C3RA 4C34A 3V8TA 3HRBA 4FEXA 3OD6X 2HZ0A 3C4CA 5CT0A 4UYAA 4C4IA 3TI1A 1ZY5A 2OO8X 3RM6A 2CKQA 2GCDA 4CZYB 4H05A 4EBVA 3DV3A 2HK5A 4U41A 1OKWA 3E8DA 4P5QA 2XA4A 4HCUA 3WZKA 4CZTA 3KU2A 1OL5A 4M0ZA 2YIWA 4RWJA 4MQ2A 3LQ5A 5E90A 2FA2A 4EL9A 5M09A 3IK3A 1JPAA 4NT4A 4RX8A 4K2RA 4JBVA 2I40A 5HE2A 1S9JA 3PXFA 3K5VA 1OL6A 2VNYA 3ZLWA 2OK1A 3H0YA 3VVHA 4I6HA 3RNIA 2ZVAA 5DR2A 3DBFA 4EK4A 1KSWA 2YITA 2Y8OA 5CEPA 5M44A 4A07A 4NU1A 2V7OA 3QLFA 3CS9A 2PVKA 5EM6A 4BWKA 3MIYA 5KX8A 4D1XA 4QP8A 2F4JA 1T46A 2WAJA 4QO9A 4AZFA 4IM2A 4RFMA 3BLRA 2X6DA 2R3RA 4PMMA 4NZWB 1Q24A 3VRZA 5AX3A 4HYUA 4BCFA 2CCHA 1W84A 4TYHA 2YCRA 3NUPA 1W82A 2PMOX 3LJ0A 4DGLC 5GZ8A 5IA4A 2GQSA 4EH9A 1PKGA 2R3QA 5CF8A 3R02A 1L3RE 4DT9A 3P08A 4IAZA 3VS4A 3VW6A 3M2WA 3PJ1A 2JFMA 3EQDA 2BVAA 3PJ3A 4XG2A 2EXMA 4O38A 5IPJA 4IQ6A 5DHJA 4CKIA 4MCVA 4ZMEA 4J99A 4D55A 3MJ2A 4WG3A 3NYNA 4O7TA 3HGKA 4OTIA 2IZUA 2X81A 3RPSA 3OFMA 3D4QA 4G3GA 3TZ9A 1WBNA 3BHHA 3ZLSA 5DNRA 1CKPA 1JSVA 5EM8A 1XH6A 3QKMA 2O64A 5CZIA 4IWPA 4WSYA 4XEYA 5A9UA 3TWJA 4WO5A 4O0RA 4AA0A 4D9TA 5EYKA 5LOHA 2NP8A 4MXXA 3VUIA 3VUHA 1ERKA 4C4JA 4I1ZA 4NJ3A 4JDKA 3OY3A 3JYAA 1KE7A 5DEWA 3IDBA 3P7AA 4IZAA 4S2ZA 5AV1A 4BGQA 4DBNA 2QOIA 4JR3A 3S3IA 3HV4A 1VJYA 3CY2A 2R5TA 3DY7A 1YKRA 3EQRA 3H0ZA 2WMAA 5J1VA 2R7IA 3FYKX 3R1QA 4MAOA 2YM3A 3Q52A 4KIPA 3EL8A 3QZFA 5EYMA 2V5QA 5IUGA 2CSNA 3PLSA 2X9FA 3NLBA 3DNDA 4FODA 1UNHA 3F3UA 4PWNA 4BCMA 2NNWB 2QU6A 4C4GA 4KIOA 4FKGA 4Y5HA 5E8VA 5CS6A 2YISA 3ANQA 5JH6A 4EC8A 2BKKA 3C4XA 2P55A 3Q9YA 3VUKA 5H9BA 4LGHA 4FVRA 3IG7A 4L3JA 3R22A 4GEOA 4PX6A 2C68A 3BGZA 5BVNA 4G16A 4ZZOA 3VUMA 4RJ7A 2BALA 3QYZA 2VX1A 4X2NA 5C8MA 4DGMA 4Z3VA 4CKJA 3EN5A 3GP0A 4BIBA 4FI1A 2CGWA 4OGRA 3ORLA 4LOOA 3V5TA 3RBWA 5KKRC 2WOTA 4UEUA 3QBNA 4KBCA 4HPUE 1DM2A 5HLWA 4G9RA 3A7HA 5HG9A 3R63A 3B8RA 2JDOA 4HJOA 4EH4A 4HGSA 2OF4A 2EWAA 2W96B 2WTVA 1GIHA 2PVRA 3I0OA 4O86A 5KBQA 4L3PA 3DXNA 5AA8A 2Y4PA 4GJ3A 2QG7A 3P78A 1OIQA 4JX3A 4UZDA 5EOLA 3NYVA 3QFVA 5EYCA 4DLIA 5FEEA 1ZYSA 4Y5QA 2VWZA 2R3MA 5ANJA 2VTSA 3EB0A 4KA3A 5HCZA 4F70A 5LVMA 3AG9A 5E9EA 1P4FA 3OZ6A 3HX4A 1PXLA 3UP7A 1XBCA 2W4JA 2JAMA 3LOKA 4XOYA 5DG5A 3ZEWA 4M15A 3R8UA 3CPCA 4GKHA 4BDGA 2WHBA 5AP4A 1JKLA 2YIRA 3NIZA 3M1SA 5EHLA 4EOOA 3R9RA 3NUNA 3LAUA 4DH8A 3NUAA 3GUBA 2BHHA 3W18A 2YACA 4RC3A 2GFSA 4QP2A 2QO7A 2A2AA 2C6DA 3NW6A 3R2BA 4UY9A 3CQEA 5EW9A 3W2SA 4I21A 3EIDA 4M8TA 4NKSA 2XKEA 1QPEA 4FZ7A 4F1MA 5CSPA 5FBNC 3RWPA 3U6JA 4LRJA 3RZFA 3QTZA 4LV8A 3KK8A 2W4OA 3Q6WA 5J79A 2QOOA 4FKTA 3R8ZA 2HIWA 3AT4A 4R78A 4E20A 4MD8E 4HVGA 3MVLA 2CLXA 2RG6A 5C01A 4AE6A 2WU6A 1HCLA 4BDFA 4RIYA 3QWKA 1FINA 3Q5ZA 1YI3A 2CGUA 3BYVA 3LFNA 4L01A 4RIWA 3DKFA 3FZSA 4FSZA 2OXDA 1J7UA 5HLNA 5ANGA 3OWLA 1I44A 5GHVA 2YERA 1A9UA 5KUPA 3OXIA 5HVJA 4CV9A 3WE4A 3OC1A 5AEPA 1JKTA 2HW6A 4YO6A 4YU2A 5HO7A 3PA4A 5KMIA 1STCE 4AG8A 3SW4A 3AC2A 5CENA 4PQNA 3QL8A 2R3FA 4GYGA 2OLCA 1KWPA 4W9XA 2E9NA 1OKVA 4GRBA 3UIUA 4FV8A 3ZBXA 2XJ0A 4FSTA 4MNEB 3RGFA 3ALOA 3O96A 5HESA 4UWCA 3Q4CA 2C5NA 4XG3A 4A9SA 2F7EE 2C6TA 4DEGA 4FTIA 4NEUA 2VWWA 5HIDA 3LXKA 4O83A 5AUVA 5B0XA 3PG3A 2B9IA 3SOAA 2H6DA 2IZSA 2WTIA 2XNGA 3PUPA 3PXQA 2UW9A 2W5HA 3H4JA 2X7OA 3D2IA 1Q41A 3UOHA 4EOLA 2PK9A 4B7TA 5L6PA 4QYFA 3QD2B 1TQPA 2NO3A 2WTCA 3JY0A 3KKVA 3TL8A 1XH9A 5IH6A 2PU8A 4X2KA 5CEMA 3TDWA 2XIZA 1NT2A 2KTYA 3GU6A 4X2GA 4EK8A 5M4FA 3KREA 3AMAA 3A7GA 3A4OX 2W1EA 1BX6A 1UKIA 1JSTA 3KA0A 3SHEA 1F5QA 5HG7A 4R77A 4NWMA 2BRBA 3ULIA 3V5WA 3FC1X 4C58A 1JWHA 3LLTA 1H24A 1WAKA 3EH9A 4DG2E 4BTKA 4UMPA 4DGNA 3HMOA 3VBQA 3E7VA 4OTQA 4QT1A 3RTPA 3UBDA 4U45A 4AW5A 2C3KA 4S30A 5E4HA 5CTPA 5IUIA 2IN6A 3G2FA 5LARA 1QPJA 4BZNA 5CASA 2VTPA 2QR8A 3QTIA 1XHAA 1YHVA 4YC6A 5DH3A 5DT0A 2QOLA 4ANSA 4B8MA 1UU3A 4CFWA 3HMIA 2O8YA 3MN3A 2Q0NA 3EWHA 3LLAA 3R6XA 4J8MA 4X3FC 5BUIA 1E1XA 3A4PA 3LKMA 2I6LA 4XRLA 3V5PA 4BDHA 1F3MC 3KXGA 4CFMA 4JNWA 2CJMA 1Q5KA 4GG7A 4MWIA 5I0BA 1A48A 2Z7RA 4Q5HA 2VO6A 5IDNA 1GZNA 5FTQA 3NW7A 4D5HA 2CDZA 5KE0A 3PRFA 2I0VA 3F3TA 5C9CA 3ID6C 1YXUA 2XJ2A 4L52A 5LCJA 2YWPA 3I5NA 4A9TA 1H07A 2GS6A 4HNIA 4UYNA 3ZSGA 2W1FA 2AYPA 3HLLA 3I1AA 4R3PA 4A06A 3BGPA 3ZM9A 1MQ4A 4AN3A 1NY3A 3BHTA 4ITIA 4ALVA 3DB6A 4ANNA 5JZNA 3RHXA 4ZOGA 4IDVA 4ITJA 1XQZA 3BU6A 4Y8DA 4YTCA 3VBTA 3FI4A 2OZAA 3AD4A 2Z60A 4I0RA 3F82A 4XJ0A 2VTHA 3LJ2A 2HZ4A 3HV3A 3EL7A 1YDRE 4OT6A 4M69B 4QTAA 4HYIA 3CLYA 3MA3A 1XH5A 3ZZEA 2VTNA 1CSNA 3ACJA 4JG7A 5E8UA 3R21A 3L8PA 4IMYA 2WZJA 3PJ8A 4EK6A 5HIBA 4U3YA 2B9JA 4AACA 4RJ8A 5E92A 4C35A 5HVKA 2ITVA 4FEVA 3D5UA 4QTEA 4YJPA 2YIXA 3GFEA 5FDXA 4DEIA 2ITQA 4FSRA 4JVGA 3IW4A 5CQUA 2F49A 3FZTA 4EK5A 3E88A 4O0TA 5D12A 5TO8A 4DITA 2W17A 5HU9A 4O91A 3KRXA 4IADA 3P79A 3R83A 1P14A 4DC2A 2P33A 4B6LA 3AC3A 4IE9A 1V0BA 1ZXEA 4BGHA 3C9WA 1XBBA 2XP2A 3QRKA 4E6QA 2R64A 2XF0A 3Q4UA 3IECA 3PVWA 4GVAA 2WPAA 2QKWB 3UYSA 2C0OA 5CAVA 3LVPA 3ENHA 4ONAA 4EK3A 3E7OA 5L2TA 3DNEA 5A6NA 3S00A 1T45A 1XO2B 3ITZA 4F9CA 5DE2A 4WIHA 3EZRA 3FUPA 3PYYA 4GK3A 4IX3A 2Z8CA 3G0EA 1E1VA 4CZUA 4RFYA 1FQ1B 2WMUA 3GCSA 4E4MA 4BRXA 4LOPA 1FVRA 1SZMA 5K3YA 2CKOA 4UMQA 1MP8A 3V8SA 1RQQA 1Q8ZA 2UZEA 4EH2A 2YM5A 4O0VA 3L9PA 3QD0A 4PNKA 2QHNA 3FLYA 5A4LA 3BYMA 3E63A 4G1WA 3KMMA 4F0IA 2J7TA 3FMDA 2UZWE 3F69A 1ZYJA 3KRJA 5CLPA 5G1XA 4ANOA 3HMMA 3ZBFA 4FZDB 3R04A 3UVPA 3LIJA 3EOCA 2YCFA 5I9WA 4BDAA 1CMKE 2HAKA 2LGCA 3WYXA 4J1RA 5L2SA 4IEBA 4TWOA 2WB8A 2R7BA 5IQGA 4EWHA 4F0GA 1OBDA 3O17A 4RG0A 4LMUA 4LMNA 4GU9A 5J87A 3RK5A 1FPUA 4L45A 3VW8A 3ZH8A 3DJ7A 3P9JA 1M2PA 3C51A 2ZAZA 4F7LA 4YURA 2W05A 3N4VA 4EEVA 5AUYA 4ANMA 3NNXA 4X6RA 1JKSA 3H9OA 5HE0A 3B8QA 4XH6A 4IVDA 3S4QA 3I7CA 3HMPA 3GFWA 2PVYA 3VS7A 3F5XA 5HNGA 3NR9A 4L9IA 3UNKA 3U55A 2VWYA 3ZC6A 2WMRA 2XNBA 3ZO4A 2O63A 1YHSA 3QGYA 3KVXA 4KB8A 3SV0A 3W10A 3WIGA 4D2SA 2I7QA 5HIEA 4AGCA 2UZDA 5EQEA 4E5BA 3PP0A 4GUBA 4E3CA 4J8NA 4FYOA 2BIYA 2YM7A 3E8CA 5AUXA 4RRVA 3RNYA 4KWPA 4G3CA 4IZ5A 3FLSA 3TV7A 2ITPA 2QVSE 2WTKC 2B9FA 4KBAA 3WYYA 2OBJA 3ZXTA 2PVLA 3KF4A 1YOLA 2ITWA 2PZYA 2WTDA 3RWQA 1PF8A 2B53A 2BUJA 5AV3A 4EOQA 4F9AA 4BF2A 2XJ1A 3V5JA 1WBPA 2UZUE 4PP9A 5CU4A 3EFWA 3QQGA 5M4IA 5IH4A 4GT3A 5ANDA 4EORA 2R3HA 2VTOA 1AQ1A 3OCSA 4RT7A 4B0GA 4PMPA 3OHTA 5DPVA 5CF4A 2XK8A 2BFYA 4P7EA 3FI2A 4RA4A 1U46A 4XG7A 3V6RA 4FL2A 1SMHA 4MHAA 3MYGA 1BI7A 2IWIA 2ACXA 3DBCA 3DJ5A 4FIIA 4XBRA 3WARA 4PDSA 3BYOA 4D1SA 4JDJA 2JBPA 4M14A 1OMWA 4PV0A 4KKHA 3A7FA 5BVKA 1PXJA 2WMXA 4C2WA 3I6UA 4EKLA 4F1OA 4ZSAA 2CMWA 2Y4IB 3CCNA 4LUDA 4QP6A 4WOVA 3UO4A 4F9WA 2GS2A 5F94A 4V0GA 4FOCA 4BFMA 3DFCB 3FPMA 5FXSA 2XBAA 3RM7A 3C4FA 5GJDA 2OJGA 4GK4A 4FV7A 3QXPA 3ZXZA 2WKMA 3ATSA 1U59A 4G5JA 4EBWA 3HA8A 1DAWA 4XHKB 4G17A 1YXVA 2X39A 4UV0A 4RWKA 4FT7A 4WBBB 5AR5A 5TF9A 3KXXA 4N70A 5CEKA 1H4LA 4WKQA 3EQIA 2YDIA 5AJQA 3NMUF 2GFCA 5IA2A 5IQEA 2C1AA 1YI6A 4U40A 4X21A 2YDKA 4BDCA 1YQJA 3R71A 4D0XA 2VTLA 3OCTA 4C62A 1G8SA 2FH9A 2UW3A 3OWJA 4U5JA 5EHYA 3R9DA 3R30A 4FSWA 4QMLA 4ENXA 1TQIA 3O0GA 3VN9A 1Q8TA 3E5AA 2IJMA 5ANIA 5GNKA 3QAME 3NYOA 3EQPA 4GG5A 4UXQA 4X2FA 1H0VA 1ZOGA 2YAKA 4J97A 3TZ8A 4ZTSA 3ETAA 1UKHA 1BMKA 5DIAA 3D9VA 1WMKA 3QZGA 1M14A 3CQUA 3EKKA 3GVUA 3OT3A 4V04A 1IR3A 3GOKA 4K1BA 2BPMA 4AN9A 3CTQA 4NUSA 2XRWA 4XMOA 3UDBA 4CMTA 4EHVA 5ICPA 2VWXA 1NW1A 4PPBA 4XCUA 3KXMA 3PZHA 2W5BA 3V04A 2XEZA 2ZMCA 3RPRA 4E6DA 4DFNA 2W9FB 1M2RA 2ESMA 4FTOA 3ZM4A 1GIJA 4YZCA 5CANA 3TUCA 4GH2A 2W99B 4IIRA 3R1SA 4CMUA 4QP7A 5M51A 5GINE 3EHAA 4M12A 3UOJA 2G2HA 3QWJA 2XBJA 5E8XA 4I3ZA 3NIEA 3PSDA 5CU3A 5CU2A 5LXMA 3MW1A 3CJFA 3NGAA 5AR2A 2X1NA 4Z7HA 2HZNA 4ITHA 1TVOA 4RSSA 4FT5A 2HY81 2OW3A 3F6XA 3H30A 2PY3A 3NNVA 4X2JA 5AP2A 2WQMA 5CY3A 3TKHA 3U4UA 3SKCA 4ALWA 4PL5A 1B38A 4RZVA 4EH7A 1Q3WA 5FDPA 3D7TA 5IEYA 4W8DA 3U6IA 4IFCA 2PVNA 1IEPA 2QNJA 2JBOA 4GVJA 2IZRA 5E1SA 4ACDA 5DR6A 3TEIA 2WD1A 3D2KA 4ZEGA 2GNGA 1YXSA 5DT3A 5BMSA 3QZHA 4MBLA 5D7AA 4QQTA 3ORPA 3MJ1A 1ZAOA 3KB7A 4QYEA 4BY9E 2A19B 3KMWA 4ASDA 4CXAA 2F9GA 3LXPA 1WBTA 3ZFYA 2UZOA 4RVMA 4XBUA 5F20A 5HVYA 4TWNA 3UO6A 3S0OA 3ORIA 5JQ8A 4HZSA 5IG1A 3KCFA 4FV2A 4ZTNA 3BBWA 1PXIA 3UOKA 5IH5A 4CSVA 2YZAA 2ZYBA 4YJQA 1PMVA 4CFUA 4DGGA 4ZP5A 3GU8A 4FR4A 5LJJA 4X3JA 4FTMA 3JVSA 3RK9A 5IEVA 3H9RA 5DI1A 4GS6A 4WHZA 5CI6A 3LCKA 5A46A 4DFYA 3SXSA 3DXQA 4E5WA 4OAUC 4DH7A 2B55A 5DN3A 3MBLA 3MTLA 2YABA 4EYMA 3BYUA 4CKRA 1SVGA 4U79A 4ZTLA 5BMMA 3DZQA 2A0CX 2JD5A 3T8OA 2XVDA 2QHMA 4CGAA 4RMZA 1OI9A 4BCOA 5EHOA 5BYZA 5HQ0A 4I0SA 4IZYA 1UWHA 1VZOA 3PSBA 5E8WA 1Y8YA 4M97A 3I79A 4EZ5A 4HVHA 5AFVA 4DHFA 3MH1A 2WMBA 4YZ9A 3UVQA 1GY3A 4C2VA 4C3FA 4O22A 4P90A 4R8QA 4JQ8A 4BIEA 1QCFA 5HZNA 4C37A 5EQPA 2GHMA 4KBKA 5CAUA 2RFSA 4OTFA 1BYGA 4YTIA 3R9OA 5KMLA 4AW1A 2ZB1A 1APME 5CEIA 3NAXA 3R8VA 2C3JA 5CSHA 1CKJA 4PDOA 4JG8A 3UNZA 3U6HA 5M55A 3DXPA 3V01A 4CQEA 5A4CA 2H34A 3EN6A 4ERWA 5KMNA 2ETKA 2UUEA 2JKKA 4H1JA 4DT8A 3MTFA 4CTCA 5IZFA 4TRLA 4IBMA 4BWXA 3N4UA 1OB3A 2JFLA 4W4XA 1Q3DA 3K5UA 3QUEA 2VRXA 3E8NA 1O6KA 4XG4A 1YVJA 2HWOA 3R7VA 4ZLOA 2PYWA 3PIYA 2Z7QA 4IANA 4PP7A 2CN5A 5KMMA 3L1SA 3UPZA 4IB1A 3FMEA 1Q8WA 2CN8A 2OH4A 4CCBA 1DS5A 1PHKA 2BRNA 3F5PA 5HBHA 2UVZA 2BRGA 4JDHA 4BDEA 2REIA 2QOCA 3BYSA 1G8AA 4O7WA 3A2CA 1H00A 2YCQA 4I4EA 4WBOA 4E4XA 5J1WA 1E9HA 5TKDA 3VHKA 4CFFA 4ZLYA 3SC1A 3D94A 2EVAA 3FQSA 2I0EA 3T3UA 3WF7A 3G9NA 1J7IA 1ZRZA 5DA3A 4BI0A 3HUBA 4FK6A 4NM5A 3FYJX 4I20A 3ZSHA 3E87A 3Q4ZA 4E73A 2X6EA 3DKGA 2ZB0A 3FSFA 4FSMA 2ONLC 4G2FA 1OUKA 3SXFA 3T3VA 3VJOA 1FOTA 1M17A 3FXZA 4IAKA 3Q9WA 3VNTA 4FNWA 2GHLA 2QOQA 4GSBA 1CDKA 1RE8A 4QMMA 4FZ6A 3NNUA 4AN2A 1V0OA 3MFUA 1PMUA 2J5FA 1PRYA 4KINA 5K5XA 5LVOA 4FKJA 3OCBA 4B99A 4EH8A 2BAKA 3ZSIA 2B54A 4CLJA 5L8LA 4FC0A 4C36A 4YZDA 3DLZA 3HYHA 4IWOA 3FMNA 5CVGA 4O21A 4MH7A 3ZHPC 4YUQA 4YBKA 5CAQA 4NL0A 4J52A 4F7NA 2XYUA 4BDKA 5EOBA 4QMPA 4TN6A 5CAOA 1Z5MA 5AP3A 5CEQA 3SDJA 3TN8A 2Y4IC 3UTOA 4EOJA 1YRPA 3VUDA 3PPJA 4X3FB 2UZTA 1J1CA 2B4SB 3MFSA 3QUDA 2ITZA 3C50A 3HDNA 4IDTA 5J9ZA 4EJ7A 5M07A 4EH5A 4TKSA 4CTBA 3LFDA 3MB7A 1JQHA 3MY1A 4FTUA 4FIGA 4YTHA 5AR7A 3MH2A 4IVBA 4O7SA 3QGWA 4GV1A 2RIOA 4K18A 4RA5A 3VS6A 2PUNA 3OY1A 2R3IA 5A3XA 1LEZA 3R1NA 2W5AA 3U9CA 2PZPA 4ARKA 4Y72A 5K4JA 2OJ9A 1UA2A 1URCA 2X7GA 3JR1A 5T68A 4D2WA 4PNIA 5JFWA 3CEKA 3FKOA 3H10A 4YC8A 3EQCA 1G3NA 2BDJA 3DOGA 4KUJA 3NYXA 3HZTA 4XRJA 4A4LA 3PA3A 4WSQA 3FLWA 3PIXA 3VS5A 2V0DA 2FSTX 4FTCA 4PDPA 3GT8A 3II5A 4FZAB 4O7ZA 2ZOQA 3QC4A 4C57A 3VQUA 1XWSA 5FM3A 3GCQA 3NDMA 2UV2A 4WA9A 4I0TA 3E64A 5EH0A 3QHRA 5JT2A 1FGKA 4Q5EA 3KF7A 4WRSA 5FM2A 3PRIA 1JKKA 5EW3A 3DK6A 4ZTQA 4Y95A 4AGUA 4ZK5A 3LCSA 4DTBA 2J0KA 4IX4A 5L2QA 1GAGA 3G5DA 3PJCA 3Q5IA 5FQDC 2OWBA 5H8GA 3RZBA 4A7CA 3MVJA 5LMKA 4WD5A 3HV6A 4BKYA 4FEUA 3F2RA 4JQ7A 4Z9LA 3RPOA 3QTQA 4DEDA 3DBQA 2ITTA 4IWDA 5EQYA 1Y91A 2HXQA 3FXWA 2VTTA 3KGAA 4JRVA 1UVRA 5CNNA 5EI6A 5T3QA 3ZTXA 3C5IA 4DFUA 2BRMA 4XLVA 4EOPA 3ZDIA 5AIKA 3L9MA 4MX9A 5LWMA 4FTAA 2XIYA 4ACMA 4TWCA 2VWIA 4BZOA 3UZPA 2BZHB 5HTIA 1YWVA 5LVPA 2X8DA 2R0IA 4HYSA 4CEGA 2UW6A 4E26A 4HW7A 4FNYA 5EDRA 5JRQA 2J51A 4OTGA 2VUWA 5EDQA 3CSVA 4QRCA 4U43A 3RINA 4OAVB 3EMGA 5E8ZA 4MXCA 3MESA 5HTCA 4I6BA 4F7SA 3CTJA 4IW0A 4NCTC 4TYJA 4BL1A 2Z7LA 4IJ9A 5D11A 3N9XA 5K5NA 5JFVA 2J9MA 4YLJA 3U54A 2C6EA 3BHUA 1YOJA 2C6IA 2WEVA 4C59A 4AE9A 4AZVA 4KIKA 3VUGA 1Q62A 2QOHA 4FSUA 2V62A 2JKQA 4LGGA 5HE3A 1PYXA 3LFSA 2WO6A 2BZIB 3QTRA 4TYHB 3VULA 2FO0A 3ORKA 3TNIA 3VS2A 1WBVA 3FMJA 1W98A 4Z7GA 4IB0A 5B2LA 2OICA 3TNWA 1LEWA 2W1GA 3LHJA 2IO6A 3NZ0A 1IRKA 4AT3A 3BX5A 2IPXA 4TYIA 3SRVA 5FEQA 3QD3A 5HCYA 4BDJA 5HGIA 4QPMA 2BZJA 3K3JA 2C6LA 1U5QA 4FEWA 4O84A 2IVSA 4YC3A 4KKEA 1SVHA 4D2PA 4C4EA 3CPBA 1IASA 3U4WA 2PL0A 2YM8A 5AP7A 5AAGA 5LWNA 3DK3A 2G01A 3IONA 3CJGA 3FZOA 3R0TA 3JUHA 5M4UA 2R2PA 1Y57A 4J95A 2O2UA 3R2YA 4AW2A 5CT7A 2JLDA 4M3QA 3QU0A 2AC3A 4RWLA 4FICA 3UYTA 3UOLA 2UZBA 4TNDA 2C47A 3O51A 1KV2A 2VX3A 3ZOSA 5LCKA 4DTKA 2C0TA 3PA5A 3EYHA 5ACKA 3UZRA 2JIUA 2IVVA 1REJA 5B2MA 1S9IA 1J3HA 2XK7A 4AOIA 4ACHA 4RJ4A 1H08A 4Y83A 3AD6A 4FV6A 3FPQA 4FIJA 3PVGA 5BYLA 2EUFB 4WNOA 3R7EA 4F65A 2H9VA 3EQBA 3LMGA 3VC4A 4LRKA 5CAPA 2WTKB 4MXYA 5HLPA 4E4NA 2WMWA 4FTNA 4CT1A 2UW7A 4LI5A 1JVPP 4XP2A 2GNLA 4GUEA 3S2PA 1PXMA 3BU5A 3KFAA 5ACBC 4XYFA 4MKCA 2DWBA 2PTKA 4OW8A 3IOKA 4JIAA 4M68A 3WE8A 4PMTA 4B8LA 3FWQA 3KXNA 4CYIA 2YJSA 2VV9A 5FXQA 5HORA 2QO2A 1YWRA 5EKOA 4G3EA 2R4BA 5E91A 2PSQA 3I81A 1GJOA 3JY9A 3MB6A 3AGLA 3P1AA 5K0KA 5JMSA 4N0SA 2VTIA 3UODA 4EOIA 3BU3A 3NNWA 3DPKA 4O82A 5FTGA 5GIPE 3QQKA 5AUZA 3C4WA 3AC8A 4I6QA 2R3GA 4JAIA 3TJDA 2G9XA 2XNEA 3AT2A 4C4FA 4GFOA 3TIYA 3RK7A 2C3LA 3VWAA 3D0EA 4A4OA 3KL8A 2PMIA 2F7XE 4APCA 3ZZWA 5DFPA 2R3OA 5AV2A 4C33A 1EH4A 3MSSA 4F6WA 2PMNX 4OBPA 4XX9A 3PPZA 1KOBA 3A61A 3GGFA 5F1ZA 4IACA 4AA4A 3FV8A 2FSOX 4CFXA 3O8PA 4E93A 4J53A 4P2KA 4AS0A 5EKNA 1FBNA 4EOKA 2QONA 5BPYA 4A9UA 3ZRKA 4TWPA 3KVWA 3M11A 1DI9A 5BYYA 3LM0A 4W4YA 3ZMMA 3UC3A 5EDPA 4BIDA 2GTMA 2PULA 4FTJA 5M56A 2J0JA 3C0HA 1OITA 4RFZA 3FBVA 1OVEA 3IPHA 4FIHA 4HCVA 4KIQA 3EFLA 4I5PA 3ZDUA 4A9RA 4DBXA 1PXKA 1K9AA 4ASXA 2X2KA 3H3CA 4WUAA 5EYDA 4FKPA 5A4TA 3S1HA 2YIYA 1TQMA 1R78A 1IG1A 3IW8A 4XP3A 3UE4A 3VBYA 1Y6BA 3RAHA 1PXNA 3PWDA 4OTHA 4KRCA 2GNHA 4NW6A 4D58A 1MRYA 3C13A 4C3PA 2XIRA 5DR9A 5CVFA 4JG6A 5AP1A 3FKLA 4FV0A 4RZWA 4QMZA 4ZIMA 4OLIA 3SOCA 4APPA 3FMLA 3EQHA 3Q4TA 5HICA 4CRLA 5CU0A 2G2FA 2HY0A 3FI3A 3R7GA 4BC6A 5J9LA 4YTFA 5IQBA 1AGWA 3GC8A 2CNVA 1ZWSA 4JRNA 4LGDA 3HKOA 3PXZA 4WT6A 4BI1A 4G31A 4XV9A 1W83A 5FD2A 2H8HA 4RIYB 3G15A 3I6WA 4KABA 3QTSA 3NWWA 4RIWB 2ITXA 2UW8A 2J50A 3JS2A 3COHA 4K11A 3IQ7A 4O0SA 4PY1A 3V6SA 4DE4A 3SW7A 1R0EA 2PE0A 4F1TA 3G51A 3IGOA 3R8MA 3L8XA 2J5EA 4BCKA 3FL4A 3NAYA 1ZZ2A 3QCXA 1QMZA 4FZFB 2F57A 4MVFA 1JOWB 3UGCA 4CYJA 4M66A 1OIUA 3ORXA 2PZ5A 5CVHA 1WVWA 4FBXA 1K3AA 3R7IA 2ZM1A 3SLSA 2QOFA 1ZYCA 2ETMA 2QC6A 5HBEA 2QQ7A 4ZTHA 4E6CA 5JGAA 4EHGA 3CKWA 3DAKA 2FGIA 3RKBA 1YXTA 5TOZA 3QQUA 4H1MA 4JDIA 2Z02A 3ERKA 1XH8A 3WIKA 2QOBA 3GQLA 4USFA 5C4LA 5KNJA 2BRHA 1HOWA 2FUMA 2QD9A 3LJ1A 4K6ZA 5J8IA 3MPMA 4KNBA 3A8WA 4LV5A 4FV9A 3HP2A 1XH4A 4FV5A 3VS0A 3OP5A 5KZ0A 4D4YA 3TUBA 3LFAA 4M67A 2JAVA 2C4GA 3UMXA 3F61A 4BTMA 2OU7A 4ZSGA 4UN0C 4QTDA 2XIKA 3EQGA 2XH5A 3DBDA 3CP9A 4EQCA 4DFBA 1ZOEA 3BZ3A 3DKCA 3NSZA 4L00A 4ZY5A 5J9YA 3P4KA 3NW5A 3OWPA 4QYHA 4MNFA 1H1PA 5HHWA 3CY3A 2GU8A 2W1CA 4IWQA 4L6QA 2GQGA 2HENA 2YZLA 5AX9A 3ZCLA 4IC7A 3ATTA 3KY2A 3MVMA 2ITYA 3WBLA 1KOAA 4R3RA 4E4LA 4FSNA 3GCVA 3RAKA 2JITA 4YJOA 5AP6A 5JRSA 3OBGA 2XIXA 3WF5A 2CKPA 2HZIA 5L3AA 4G6NA 3FQHA 2PPQA 3KRLA 4IX5A 3ELJA 4QD6A 4FTTA 4QQJA 4LFIA 4YHJA 2QOKA 2VZ6A 3TTIA 2UZLA 4O2ZA 3U9NA 3GEQA 3Q2MA 4JLCA 1YDSE 3JPVA 3H9FA 3MH3A 3IW7A 3ROYA 3QCQA 3GXLA 2P4IA 3PFQA 3F7WA 5IKWA 4HCTA 1H27A 4EONA 4MF1A 4HOKA 3DGKA 4RIXA 4FG8A 3O8TA 4IB3A 4KS7A 3L8SA 4D4RA 4IHPA 4CCUA 3AC5A 3NPCA 3PG1A 4R5SA 5HOAA 4TNBA 2J4ZA 3ZLYA 4BDDA 3IDPA 5T6KA 3GCPA 5CZHA 4BDIA 5AA9A 2JDVA 4OTRA 2OFUA 4S33A 3QHWA 2HCKA 3D14A 4J71A 5BQ0A 3IOPA 5EI8A 4USDA 3SVVA 4TW9A 2VGOA 3UNJA 3V8WA 2ZV8A 4NIFA 2QLUA 4OBQA 2VWVA 5D9HA 5CNOA 3COMA 2W1ZA 4BBFA 3OOMA 3LM5A 3DDQA 3NCZA 4B4LA 5JK3A 2RG5A 3MVHA 2XEYA 3CTHA 2OZAB 4Q2AA 3EN9A 4JBPA 4GU6A 3ZS5A 5ETCA 3DBEA 3LW0A 1JNKA 4XG8A 3WILA 5KMJA 4IZ7A 3QXOA 5F4NA 3WZDA 5C26A 3FZRA 5AMNA 1OL2A 3MV5A 5HO8A 1Q8UA 4QP4A 4CFNA 3BWJA 4JQEA 4RX5A 1PMEA 4O6EA 4UXLA 2UW0A 5ETAA 5HG8A 5BVFA 2V7AA 5D7VA 5DYJA 2JDRA 2DYLA 1TKIA 2GPHA 4D9UA 3AD5A 3W32A 4KS8A 3LMIA 2VN9A 3SG8A 1XR1A 3W2CA 3OTVA 3B2TA 5IDPA 4PPCA 4R1VA 4XV3A 3Q9XA 4AZWA 3DK7A 4IAFA 4XG9A 5LMKC 5I4NA 2O3PA 4IAYA 4I4FA 3OVVA 3ODZX 1H8FA 2JEDA 3Q60A 4E6AA 1JAMA 4BI2A 3ORMA 3W2PA 5JFSA 3NUYA 5C03A 1GOLA 2WQEA 3PZEA 4YNEA 2ZMDA 4IH8A 3RCJA 3HAVA 3OG7A 3PWYA 4GIHA 4X0MA 3IW5A 4Y73A 3FLQA 5CXZA 3UG1A 1I09A 4YJRA 3PTGA 5AR8A 4QYGA 4XV1A 4JX7A 4I6FA 2PVFA 4FEQA 5EM7A 3VS1A 2HW7A 2E9OA 2OF2A 2XK4A 5JGDA 3R00A 1H1RA 1R3CA 3G6HA 3HUCA 2YJRA 4N57A 4ZZMA 4DEAA 2R3LA 3ZLXA 2VTRA 4KKGA 4UMTA 2WQNA 1B39A 3QX4A 2BAQA 1U54A 2YCSA 3QTXA 2BFXA 5FG8A 3BLQA 4XUFA 3LXNA 4QMSA 1IAHA 4XV2A 4AT5A 4CV8A 5CF6A 1OM1A 2A27A 3R7OA 3FQEA 2I1MA 1NXKA 5IA0A 3SXRA 3MDYA 3CC6A 4BCQA 4R1YA 4ZTMA 3VBVA 2C6OA 2W4KA 3MPAA 3GQIA 3SD0A 3KRWA 4HVSA 2V22A 1OIYA 2R9SA 2E9PA 3N51A 1JBPE 3FAAA 3QX2A 4O1OA 4W4WA 5EK7A 5ETFA 5JZJA 3O50A 4AZEA 4ORKA 2ZDTA 1KE9A 1OBGA 1U4DA 4E7WA 4HVDA 1SNXA 4G34A 4YLKA 2XMYA 3QRUA 2WQOA 3QTUA 1P2AA 3GNIB 3I7BA 4JT3A 3R8LA 3QRTA 4EOMA 3DDPA 1V1KA 4DA5A 3QQFA 4WNMA 3D15A 2P3GX 4U8ZA 3DTWA 5CSWA 2H96A 3KQ7A 4FKUA 4BKZA 1KE5A 2YN8A 3TTJA 1OZ1A 1YDTE 3RJCA 4PL4A 3OXZA 3BQCA 5IQFA 4MWHA 3BPRA 3NX8A 2XK3A 2JKOA 5H8EA 1H1WA 1W7HA 3E93A 4D4VA 5JSMA 3UIBA 4K8AA 4NFNA 3NUUA 4I93A 3HV5A 4YPSA 2QLQA 1GIIA 5D1JA 3MY0A 4OT5A 5FTOA 5F95A 2DQ7X 4O6LA 2KULA 4HNFA 4FTKA 4RLKA 4OTWA 4NTSA 5H8BA 1ZMUA 4TL0A 1URWA 5ANKA 2CCIA 4QTBA 4QP9A 3SG9A 5CEOA 4YR8A 3GC7A 4BCIA 5IISA 3QZIA 3C1XA 5CSVA 4ZXTA 4DINA 4O96A 4FTLA 4MYGA 4QNAA 4EOSA 4CT2A 4YJNA 1XH7A 4NM0A 4ZJIA 4BDBA 5KO1A 2EB3A 4O27B 4C7TA 1WBWA 4MBIA 2X4FA 4LM5A 4QMYA 5BNJA 3OCGA 2YIQA 5HO6A 4A4XA 4AXAA 5HX6A 2PMLX 3OF0A 4J98A 4UMRA 3TV6A 3AT3A 2C0IA 5D10A 2WMVA 4HZRA 5DRDA 3BCEA 5JEBA 3NCGA 2VU3A 2YA9A 4W8EA 1QL6A 1MQBA 2VO0A 2VTQA 3BELA 2V55A 4I92A 5I5ZA 5J5SA 2GNIA 4TTHB 3SAYA 2RFEA 2XCHA 4QMWA 4ANLA 4YLLA 2I0YA 2BILB 3FMHA 4KSQA 1OGUA 3F2AA 3CKXA 5TT7A 5JKGA 1OL7A 2C3IB 4BTJA 4NJDA 2O65A 3NS9A 4ANBA 2WIHA 1KV1A 1SVEA 4DCAA 2Y6MA 4V0GB 2HELA 2A4LA 4G3FA 4MD9E 5C4KA 4EH6A 4TY1A 2LAVA 2VTAA 4MEDA 4MBJA 1VYZA 3GBZA 4K9YA 3RCDA 3SA0A 2IW6A 4DG3E 2J0IA 1WZYA 5A14A 5M57A 2X9EA 3FDNA 3GOPA 3R73A 4YJUA 4LG4A 3DAJA 4CLIA 5B7VA 5AIRA 2JC6A 3HL7A 5L6OA 5FGKA 4LOQA 2PE2A 1U5RA 3ODYX 3PXRA 4RWIA 2GMXA 4ANQA 4RQKA 4R3CA 3JVRA 4YJVA 1CM8A 5L8KA 4I23A 1U54B 5AV0A 3R1YA 1FVTA 2I0HA 4YJTA 3UP2A 1H01A 4RJ6A 4PL3A 3LFQA 1PJKA 4QMVA 2CNUA 2IW9A 2PUPA 4JS8A 4F0FA 1WBSA 5GZAA 2JKMA 5I9ZA 2GTNA 4YP8A 4G6LA 1UU7A 2VWBA 1AD5A 3TZMA 1J1BA 2VTMA 3FI8A 3HVCA 3DA6A 4PF4A 5HD7A 3DLSA 4I24A 4DEBA 5AADA 5CF5A 3P7BA 3C4ZA 4L8MA 4ZTRA 4FKRA 4L46A 3BIZA 1Y8GA 4S31A 3F5UA 3HECA 4L68A 4P5ZA 2BKZA 3W2RA 4JI9A 4U80A 2RFDA 4CNHA 3KXZA 4FTQA 4MXAA 3PIZA 5LMAA 3CGFA 2WNTA 4GW8A 2HWPA 3ZC5A 3TUDA 3UZTA 4L67A 4FE2A 3FL5A 3PPKA 3QRJA 5DRBA 3EZVA 5H3QA 1JSUA 2XS0A 4FSQA 2BMCA 4IM0A 4Q9ZA 2IZTA 4GMYA 1GZOA 5EW8A 3OOGA 4OR5A 4FYNA 2WMSA 5I9UA 4F08A 1CKIA 3VUTA 1SNUA 1M52A 1BKXA 3WF6A 2NRUA 3FXXA 3DT1A 5HTBA 3D7TB 1R0PA 4S32A 4EUUA 4W9WA 3FMMA 2Q83A 5AR4A 2OIQA 3TKIA 4IVAA 2B1PA 1Y6AA 3NRMA 4I22A 2CGVA 3KN5A 2Y7JA 4KSPA 4NKAA 5FLFA 3V5QA 5K4IA 3POZA 3LQ8A 4RC2A 4TYEA 2YM6A 1ZOHA 3EN7A 2X7FA 1RW8A 4CG9A 2XCKA 3BV3A 1XKKA 5C1QB 4LL0A 1FMOE 2WTJA 5G6VA 5H2UA 2ZJWA 4EC9A 5DGZA 3U87A 4AX8A 1O9UA 3Q3BA 4DH3A 1Z9XA 2OXXA 3MH0A 2FSMX 2J0MB 4BCJA 3AXWA 3BEGA 1OPLA 2NRYA 3U8WA 5DEYA 2A1AB 4FGBA 4LUEA 3TT0A 2G1TA 4QMQA 4D2VA 3I5ZA 4N6YA 3QA0A 4QNYA 4D1ZA 4JOAA 2DUVA 3TKUA 4L44A 4AFJA 5HX8A 4ZMFA 1ZZLA 3P5KA 5I9YA 1W8CA 4RBLA 3TG1A 4FKOA 4UWBA 5JFXA 3PDTA 4MNEA 4F99A 3PY1A 2CHLA 4NW5A 3ZRLA 4JL9A 5LVNA 5ETIA 3TCPA 4YJSA 5IF1A 4TT7A 4ZJVA 2XNPA 1B6CB 4YSMA 2B7AA 4BB4A 4AW0A 1UWJA 2JIVA 4X6QC 5K9IA 3BEAA 4ZS4A 3GCUA 4J7BA 1YW2A 4FNZA 4U44A 3ROCA 3PP1A 3EN4A 3OTUA 3KN6A 3WZEA 3CXWA 5J7HA 4Q9SA 2P2HA 5L2WA 2WOUA 3HNGA 4CFVA 4I94A 1YI4A 5FWKK 3GB2A 3PXKA 4FUXA 2G2IA 3VRYA 4AP7A 3ZU7A 4MTAA 1LP4A 2W1IA 4RC4A 3VF9A 5ITAA 5IQDA 3DTCA 4GJ2A 3TNQB 4RJ5A 3O7LD 2DS1A 2P0CA 3AQVA 3EJ1A 4C02A 3MGYA 4GL9A 2VAGA 5A54A 3QKLA 4FX3A 4L3LA 3QC9A 3FY2A 1W0XC 3K3IA 4U0IA 5EFQA 4IXPA 4OUCA 3LCOA 4H3QA 1F0QA 2E9VA 4FG9A 1Q8YA 4HGEA 4IJPA 4U9AA 2JDTA 4I5MA 4W4VA 3WF8A 4USEA 2W7XA 3Q2JA 4OBOA 2ITNA 2OSCA 2PWLA 1RDQE 2QODA 3P86A 2UW4A 2VO3A 1PW2A 3UQCA 4F6SA 5CI7A 3HDMA 3MS9A 1QPDA 2XNMA 4J96A 5CX9A 4C8BA 2YFXA 2HOGA 2ZV2A 4ASZA 5CXHA 4AGWA 2WELA 4FF8A 4EHEA 2VTJA 4F09A 4O0WA 3R9HA 4DG0E 4QTCA 3R8PA 4BBEA 4LL5A 4NH1A 5JGBA 3EKNA 2CLQA 5E1EA 4G9CA 4ZZNA 1IAJA 3DQXA 5GJGA 1BL7A 3RI1A 2C69A 3EFKA 3QA8A 1M7QA 3QALE 4UX9A 2B0QA 3OUNB 3SX9A 2OGVA 3FHRA 4GFGA 2O0UA 1UU8A 3MI9A 3NVKI 3PY0A 2ITOA 5L8JA 3OT8A 2PUIA 3QQJA 3ZO3A 4FL1A 3AOXA 2ZV9A 4PTGA 4PPAA 5DT4A 1MRUA 3ZYAA 3UMWA 1X8BA 4ZSLA 5AAFA 5I3RA 2YHVA 3K2LA 3DCVA 4F6UA 3AGMA 3C4EA 5FBOA 3UQGA 4L43A 1FMKA 5GIOE 4U7ZA 2OJJA 5D41A 4WG4A 4ZS0A 1GNGA 3V3VA 4O1PA 4TZRA 3TJCA 3CQWA 5KCVA 4FKQA 4ALUA 3F7ZA 2HXLA 5DLSA 2YLEA 5TE0A 3D83A 2YAAA 2BTRA 1VYWA 2ZDUA 3ENMA 3R28A 4M69A 4MD7E 2X0GA 3M42A 2GSFA 1REKA 4U81A 4Z16A 4DTAA 3IKAA 4YZMA 3FSKA 3CR0A 3QF9A 3WF9A 4F9YA 4RVLA 4QP1A 5DOSA 3A62A 4V05A 3Q6UA 5BVEA 4DF3A 4FG7A 2UW5A 4U3ZA 3MWUA 3CGOA 2IVTA 3VQHA 4E1ZA 4PUZA 3UIXA 4C61A 4MF0A 3IGGA 3UQFA 4YZBA 4RLLA 3SQQA 1NVSA 2XKDA 1H26A 2PUUA 2CGXA 3O2MA 4XLIA 2CPKE 3L9NA 5FRIA 4H58A 5FP5A 2SRCA 4AQCA 1XBAA 3WZUA 4C0TA 3RAWA 4BCNA 1ZMWA 4EH3A 4EZ3A 3LCTA 5GJFA 1PYEA 2J90A 3TV4A 2XUUA 2PVJA 4QMXA 4AFEA 3MY5A 4LQMA 3BV2A 2FSLX 5IQCA 5TR6A 3TM0A 2C6KA 1KUTA 2UVYA 2PZRA 3F66A 4O2PA 3NVMB 5IA1A 2BDFA 2RKUA 2RF9A 3PE1A 3PY3A 2VD5A 3CD3A 2OXYA 5IU2A 2JDSA 4GT4A 3QRIA 5IQIA 3DZOA 4FUYA 3POOA 3SGCA 4L7SA 4ZY6A 2C5VA 1H28A 2XK9A 1SM2A 4D4SA 4R5YA 4D5KA 3IO7A 2X4ZA 3VIDA 3FZ1A 4I41A 4Z55A 4LYNA 4O81A 2XM9A 3DKOA 3HEGA 2BIKB 4BVUA 1QPCA 4GT5A 3HA6A 1LR4A 3EYGA 3Q9ZA 4O0XA 4UZHA 5EG3A 4O7LA 4BHNA 2RFNA 2XZSA 3LCDA 3RVGA 3PLAE 3BHYA 4M84A 3VO3A 4O7NA 4O0YA 4YNOA 3BKBA 4GYIA 3HAMA 4X7QA 3D5XA 5E8YA 4N6ZA 2OJFE 3E3PA 4FKSA 3NUSA 1JLUE 4DFXE 1SYKA 1G5SA 3E62A 4HGLA 3LQ3A 3OMVA 3MIAA 2WU7A 1GZ8A 3LE6A 4XG6A 1OPKA 4YHFA 4RX7A 3G9LX 3UC4A 4UMUA 3RPYA 3E8EA 5J5TA 1L8TA 2GQRA 3VS3A 2UZNA 2ZV7A 4AZTA 4DAWA 2GHGA 3LFBA 4EYJA 1UU9A 2BAJA 1P4OA 2C5YA 2XRUA 3LXLA 5AUUA 1O6LA 3Q32A 3OBJA 3VBWA 2X8IA 4BWPA 5IUHA 4M7IA 4DEHA 2QU5A 5EI2A 5HU3A 1BL6A 2FB8A 3D7ZA 4FGRA 1Z57A 4QMUA 2QURA 4Y46A 4KIKB 2BHEA 4FT0A 2E2BA 3JXWA 4RIOA 3W33A 2YDJA 4BZDA 4CG8A 4WG5A 3ZEPA 4TXCA 3MFTA 4QOXA 5IEXA 3VJNA 3R01A 4BICA 4QPAA 3BE2A 3IW6A 5LMBA 2BTSA 1H0WA 3IDCA 2XNNA 2QI8A 4PTCA 1A06A 1NA7A 3FLNC 2VNWA 3FMKA 4F63A 3QQHA 2EB2A 1ZMVA 4HPTE 2VO7A 4XNEA 5HEZA 3SRVB 3AMBA 3ZRMA 1ZYDA 5FUTA 2PE1A 3QCSA 2XK6A 2Y6OA 3KULA 3R7YA 2OFVA 3ORNA 3EQFA 5DBXA 3C7QA 4MXZA 3A99A 2XYNA 4BCHA 5KHWA 5L2IA 3BBTB 5A4QA 4YBJA 2B9HA 4NYEA 3KXHA 4FKLA 5E8SA 4D2RA 4U97A 2GNFA 2AUHA 3G90X 4JXFA 3LFCA 1Q61A 5DWRA 3WZJA 4IX6A 4QP3A 5A6OA 1Q97A 1YOMA 2ONLA 3R9NA 5IQHA 4O7YA 4ZSJA
chains in the Genus database with same CATH superfamily
4H3BA 4YGAA 5FP6A 1RJBA 4I5CA 3S95A 3LMHA 3K54A 2F2CB 3A60A 1ND4A 1Q4LA 3KCKA 5AV4A 4FJVA 2OJIA 2WFYA 2WGJA 3GU4A 3PXYA 3QUPA 5FXRA 4BYIA 3KRRA 4FSYA 1V0PA 2RSVA 4BHZA 3HV7A 3QKKA 5CSXA 1FVVA 5DVRA 3D5VA 3CE3A 3OW3A 2PVMA 4FKVA 4EI4A 3ZFMA 3BGQA 3I4BA 2QG5A 3W55A 2BROA 3RHKA 4FOBA 2BR1A 1R1WA 1ZARA 4FT3A 4UBAA 5L6WL 3NUXA 3QCYA 3F3ZA 2ERKA 3EFJA 4FVQA 1R39A 5AM6A 2J6MA 3F3WA 1UV5A 3RPVA 3F2NA 4CMOA 3DAEA 3HRFA 3ALNA 3O8UA 5C8KA 1FGIA 2ZM4A 1OKYA 5HG5A 4BCPA 2GNJA 3F3VA 3PVBA 1OPJA 4BN1A 4NK9A 4XS2A 2UZVA 3TIZA 3ACKA 3DU8A 3Q53A 5M53A 4P4CA 4D2TA 4RVKA 3D5WA 3ZONA 4DEEA 4BCGA 3RAIA 4EKKA 3TACA 3ZUVA 3C5UA 3COKA 3KC3A 4ASEA 1YXXA 4DFLA 1P5EA 4FV4A 3VAPA 3A7JA 4L42A 2XB7A 4NSTA 4O7RA 2BZKB 3Q04A 2CNQA 4H36A 1UNLA 4RQVA 4WUNA 4IVCA 5L4QA 4AOTA 4DFZE 4YPDA 3P23A 1WCCA 3C0IA 2BDWA 3E3BX 3KMUA 2FYSA 2Y0AA 2OZOA 3B2WA 3GC9A 4EQUA 1OIRA 3DS6A 3HP5A 3TDVA 4DCEA 1LPUA 4MK0A 5HBJA 5AM7A 1VR2A 3FZPA 4ACCA 3UJGA 2Y9QA 1K2PA 4FIFA 2C30A 4EHZA 4IFGA 3UIMA 5M08A 1YHWA 3ORTA 3ORZA 4K33A 3V5LA 5ANEA 4G3DA 4FV3A 4KD1A 4JBOA 5LVLA 5KMOA 4IAAA 5C8NA 4NFMA 4QMNA 5KHXA 3P5JC 1DI8A 1BI8A 2IG7A 5BVDA 3L9LA 2OKRA 4DH5A 2W1DA 2OH0E 4MXOA 1NVRA 2WQBA 2Z7SA 1Q99A 3FHIA 3ET7A 3Q96A 1WFCA 2QCSA 2AC5A 3GU7A 3GC0A 3VF8A 3OXTA 5BVWA 1G8KA 3FEGA 4DLJA 2WEIA 2XKCA 4YO4A 5M06A 4NM3A 1WVXA 4BGGA 4G6OA 4UALA 5BUJA 2VGPA 3ANRA 3HRCA 3KEXA 3MFRA 5HNBA 3W1FA 3ZUUA 4PDYA 1H1QA 1PMNA 3G33A 3FY0A 1J7LA 3C0GA 4RVTA 2C5OA 3VBXA 4XOZA 5CQWA 2R3KA 4ZJJA 3T9TA 2ITUA 3LZBA 3CIKA 4ERKA 5GZ9A 4YZNA 5I9VA 1H1SA 2O5KA 4FA2A 4QQ5A 4ENYA 3KULB 4ZSEA 3DQWA 5KBRA 3O71A 3TXOA 3W16A 4NCTA 4C38A 3FKNA 3THBA 4AU8A 2J2IB 4WNPA 2PHKA 2RGPA 3UPXA 2WXVA 3ZFXA 5HNIX 3BHVA 5IQAA 3QTWA 3QLGA 2WTWA 4WRGA 4AUAA 4EZ7A 4BR3A 3GI3A 2OIBA 5LQFA 4F4PA 1OKZA 5AUWA 4V01A 3MA6A 3F88A 3T9IA 2XKFA 1OL1A 2ETRA 3E92A 4E5AX 5CALA 1BLXA 3I60A 4R7IA 4ACGA 4RJ3A 4CQGA 2E9UA 4NTTA 5AAEA 5JN2A 1ATPE 2IVUA 1IA8A 4QMOA 4D0WA 2YEXA 2FVDA 3ZO1A 5KMKA 2F7ZE 3I0QA 4M13A 4MQ1A 4O0UA 3PVUA 5J95A 1M7NA 4DYMA 2GDOA 3CBLA 2X2LA 2W0JA 2EU9A 5M4CA 4GK2A 5IA5A 3W8LA 4NM7A 5BVOA 1PY5A 3P7CA 4GKIA 3A8XA 5FEDA 3ZUTA 2X2MA 2CKEA 3L8VA 4OTDA 4OTPA 1IA9A 3IS5A 1OECA 3LFFA 3OUKA 3FE3A 4GFMA 1WBOA 3FC2A 1YWNA 4L53A 4A9YA 2VWUA 5C27A 2R3NA 1NVQA 1W2CA 3DJ6A 4FTRA 4FVPA 3UG2A 4AGDA 4L7FA 4AWIA 3WI6A 3QQLA 1OUYA 3FJQE 4D28A 4G5PA 4JR7A 2J0LA 2PZIA 2QO9A 2R0UA 2OI4X 3RALA 4BBMA 3A7IA 4KAOA 3F9NA 2JGZA 4EQMA 3TZ7A 3OW4A 4CVAA 5DMZA 2P2IA 4KRDA 5JQ5A 4JJRA 4UWYA 4UB7A 4ZLZA 1WVYA 1PKDA 4QQCA 4IAIA 5J7BA 5I3OA 4HVIA 5IMXA 3AMYA 2G15A 1VEBA 4QMTA 3TNHA 3FLZA 3QD4A 4AF3A 4BYJA 4U42A 1MUOA 4DHZA 2OG8A 2HYYA 5AR3A 3DB8A 4GCJA 4XP0A 2R3JA 4RPVA 5HCXA 5HKMA 2Z2WA 2EXEA 4AT4A 1M2QA 4FNXA 4K0YA 1BUHA 2X8EA 1W2FA 1H25A 4JBQA 4IM3A 4FT9A 2VX0A 4RX9A 4I5HA 1O6YA 2PVHA 4Y85A 4AOJA 4YHTA 3W2QA 2C1BA 1KE8A 2NPQA 1GZKA 2EXCX 4M0YA 4F7JA 1PXPA 3QYWA 4YMJA 3LFEA 4FKWA 4R6VA 4RIXB 3UVRA 4ZAUA 4H3PA 2BCJA 4PTEA 3OROA 3ML1A 2UVXA 5E8TA 2W1HA 2YM4A 3G0FA 4FV1A 1CTPE 4C4HA 2WIPA 5KKRB 2C6MA 2QR7A 1DAYA 3NEWA 4IB5A 3N4TA 3DFAA 2YWVA 2XNOA 4AXEA 3O23A 3LPBA 4FL3A 4R7HA 3AC1A 3PJ2A 4II5A 4R7BA 5B2KA 4JIKA 4ZY4A 4U6RA 3O7LB 4NIFB 2B52A 4AA5A 3UO5A 3BWFA 4E8AA 3GU5A 2F2UA 4H39A 4AXCA 4FK3A 4AAAA 2OIDA 3HMNA 4GIIA 1UNGA 2GS7A 5EM5A 3CD8A 1LUFA 1HCKA 4QYYA 3W8QA 5CWZA 2QKRA 3PE2A 3AC4A 3P0MA 4X3FA 2ZM3A 3U51A 1ZLTA 4JAJA 5A4EA 1XJDA 3BLHA 2JIIA 4FIEA 4S34A 5HD4A 4EUTA 5HI2A 4ID7A 5IMEA 3OS3A 5F9EA 2R3PA 5BUEA 3O5AA 4HGTA 4HYHA 3VHEA 3F5GA 3OEZA 3REPA 4BTFA 3ZO2A 5IA3A 4TYGA 5AWMA 2C5XA 3BE9A 5KZIA 5I9XA 3OWKA 4PRJA 3RP9A 5BX0A 3BQRA 5E7RA 3V51A 5AUTA 3TNPC 4RGJA 5CYIA 3R7UA 4AZSA 5K0XA 2ERZE 2RL5A 3GENA 5AP0A 3ULZA 4CRSA 4WNKA 2W06A 3BI6A 2WMTA 3WOWA 4DGOA 4LRMA 4K77A 3RMFA 1J91A 4O7VA 4FMQA 4FKIA 4B9DA 1ZYLA 3MPTA 2IW8A 4DN5A 5ANOA 3W2OA 1KE6A 1MRVA 4TPTA 5AP5A 4EJNA 2Q0BA 4DH1A 3OEFX 4F9BA 4CD0A 4F64A 4QPSA 5HE1A 2WMQA 4IC8A 2XM8A 1ZY4A 2W9ZB 4N4SA 2YLFA 4PMSA 3COIA 4BKJA 5CU6A 4EWQA 3G6GA 3KK9A 4YSJA 3PSCA 1PXOA 3BRBA 4C3RA 4C34A 1G8JA 3V8TA 3HRBA 4FEXA 3OD6X 2HZ0A 3C4CA 5CT0A 4UYAA 4C4IA 3TI1A 1ZY5A 2OO8X 3RM6A 2CKQA 2GCDA 4CZYB 4H05A 4EBVA 3DV3A 2HK5A 4U41A 1OKWA 3E8DA 4P5QA 2XA4A 4HCUA 3WZKA 4CZTA 3KU2A 1OL5A 4M0ZA 2AEGA 2YIWA 3W0MA 4RWJA 4MQ2A 3LQ5A 5E90A 2FA2A 4EL9A 5M09A 3IK3A 1JPAA 4NT4A 4RX8A 4K2RA 4JBVA 2I40A 5HE2A 1S9JA 3PXFA 4BJJB 3K5VA 1OL6A 2VNYA 3ZLWA 2OK1A 3H0YA 3VVHA 4I6HA 3RNIA 2XANA 2ZVAA 5DR2A 3DBFA 4EK4A 1KSWA 2YITA 2Y8OA 5CEPA 5M44A 4A07A 4NU1A 2V7OA 3QLFA 3CS9A 2PVKA 5EM6A 4BWKA 3MIYA 5KX8A 4D1XA 4QP8A 2F4JA 1T46A 2WAJA 4QO9A 4AZFA 4IM2A 4RFMA 3BLRA 2X6DA 2R3RA 4PMMA 4NZWB 1Q24A 3VRZA 5AX3A 4HYUA 4BCFA 2CCHA 1W84A 4TYHA 2YCRA 3NUPA 1W82A 2PMOX 3LJ0A 4DGLC 5GZ8A 5IA4A 2GQSA 4EH9A 1PKGA 2R3QA 5CF8A 3R02A 1L3RE 4DT9A 3P08A 4IAZA 3VS4A 3VW6A 3M2WA 3PJ1A 2JFMA 3EQDA 2BVAA 3PJ3A 4XG2A 2EXMA 4O38A 5IPJA 4IQ6A 5DHJA 4CKIA 4MCVA 4ZMEA 4J99A 4D55A 3MJ2A 4WG3A 3NYNA 4O7TA 3HGKA 4OTIA 2IZUA 2X81A 3RPSA 3OFMA 3D4QA 4G3GA 3TZ9A 1WBNA 3BHHA 3ZLSA 5DNRA 1CKPA 1JSVA 5EM8A 1XH6A 3QKMA 2O64A 5CZIA 4IWPA 4WSYA 4XEYA 5A9UA 3TWJA 4WO5A 4O0RA 4AA0A 4D9TA 5EYKA 5LOHA 2NP8A 4MXXA 3VUIA 3VUHA 1ERKA 4C4JA 4I1ZA 4NJ3A 4JDKA 3OY3A 3JYAA 1KE7A 5DEWA 3IDBA 3P7AA 4IZAA 4S2ZA 5AV1A 4BGQA 4DBNA 2QOIA 4JR3A 3S3IA 3HV4A 1VJYA 3CY2A 2R5TA 3DY7A 1YKRA 3EQRA 3H0ZA 2WMAA 5J1VA 2R7IA 3FYKX 3R1QA 4MAOA 2YM3A 3Q52A 4KIPA 3EL8A 3QZFA 5EYMA 2V5QA 5IUGA 2CSNA 3PLSA 2X9FA 3NLBA 3DNDA 4FODA 1UNHA 3F3UA 4PWNA 4DHJA 4BCMA 2NNWB 2QU6A 4C4GA 2XARA 4KIOA 4FKGA 4Y5HA 5E8VA 5CS6A 2YISA 3ANQA 5JH6A 4EC8A 2BKKA 3C4XA 2P55A 3Q9YA 3VUKA 5H9BA 4LGHA 4FVRA 3IG7A 4L3JA 3R22A 4GEOA 4PX6A 2C68A 3BGZA 4LV7A 5BVNA 4G16A 4ZZOA 3VUMA 4RJ7A 2BALA 3QYZA 2VX1A 4X2NA 5C8MA 4DGMA 4Z3VA 4CKJA 3EN5A 3GP0A 4BIBA 4FI1A 2CGWA 4OGRA 3ORLA 4LOOA 3V5TA 3RBWA 5KKRC 2WOTA 4UEUA 3QBNA 4KBCA 4HPUE 1DM2A 5HLWA 4G9RA 3A7HA 5HG9A 3R63A 3B8RA 2JDOA 4HJOA 4EH4A 3BLAA 4HGSA 2OF4A 2EWAA 2W96B 2WTVA 1GIHA 2PVRA 3I0OA 4O86A 5KBQA 4L3PA 3DXNA 5AA8A 3PUFC 2Y4PA 4GJ3A 2QG7A 3P78A 1OIQA 2X0PA 4JX3A 4UZDA 5EOLA 3NYVA 3QFVA 5EYCA 4DLIA 5FEEA 1ZYSA 4Y5QA 2VWZA 2R3MA 5ANJA 2VTSA 3EB0A 4KA3A 5HCZA 4F70A 5LVMA 3AG9A 5E9EA 1P4FA 3OZ6A 3HX4A 1PXLA 3UP7A 1XBCA 2W4JA 2JAMA 3LOKA 4XOYA 5DG5A 3ZEWA 4M15A 3R8UA 3CPCA 4GKHA 4BDGA 2WHBA 5AP4A 1JKLA 2YIRA 3NIZA 3M1SA 5EHLA 4EOOA 3R9RA 3NUNA 3LAUA 4DH8A 3NUAA 3GUBA 2BHHA 3W18A 2YACA 4RC3A 2GFSA 4QP2A 2QO7A 2A2AA 2C6DA 3NW6A 3R2BA 4UY9A 3CQEA 5EW9A 3W2SA 4I21A 3EIDA 4M8TA 4NKSA 2XKEA 1QPEA 4FZ7A 4F1MA 5CSPA 5FBNC 3RWPA 3U6JA 4LRJA 3RZFA 3QTZA 4LV8A 3KK8A 2W4OA 3Q6WA 5J79A 2QOOA 4FKTA 3R8ZA 2HIWA 3AT4A 4R78A 4E20A 4MD8E 4HVGA 3MVLA 2CLXA 2RG6A 5C01A 4AE6A 2WU6A 1HCLA 4BDFA 4RIYA 3QWKA 1FINA 3Q5ZA 1YI3A 2CGUA 3BYVA 3LFNA 4L01A 4RIWA 3DKFA 3FZSA 4FSZA 2OXDA 1J7UA 5HLNA 5ANGA 3OWLA 1I44A 5GHVA 2YERA 1A9UA 5KUPA 3OXIA 5HVJA 4CV9A 3WE4A 3OC1A 5AEPA 1JKTA 2HW6A 4YO6A 4YU2A 5HO7A 3PA4A 5KMIA 1STCE 4AG8A 3SW4A 3AC2A 5CENA 4PQNA 3QL8A 2R3FA 4GYGA 2OLCA 1KWPA 4W9XA 2E9NA 1OKVA 4GRBA 3UIUA 4FV8A 3ZBXA 2XJ0A 4FSTA 4MNEB 3RGFA 3ALOA 3O96A 5HESA 4UWCA 3Q4CA 2C5NA 4XG3A 4A9SA 2F7EE 2C6TA 4DEGA 4FTIA 4NEUA 2VWWA 5HIDA 3LXKA 4O83A 5AUVA 5B0XA 3PG3A 2B9IA 3SOAA 2H6DA 2IZSA 2WTIA 2XNGA 3PUPA 3PXQA 2UW9A 2W5HA 3H4JA 2X7OA 3D2IA 1Q41A 3UOHA 4EOLA 2PK9A 4B7TA 4O4FA 4QYFA 5L6PA 3QD2B 1TQPA 2NO3A 2WTCA 3JY0A 3KKVA 3TL8A 1XH9A 5IH6A 2PU8A 4X2KA 5CEMA 3TDWA 2XIZA 1NT2A 2KTYA 3GU6A 4X2GA 4EK8A 5M4FA 3KREA 3AMAA 3A7GA 3A4OX 2W1EA 1BX6A 1UKIA 1JSTA 3KA0A 3SHEA 1F5QA 5HG7A 4R77A 4NWMA 2BRBA 3ULIA 3V5WA 3FC1X 4C58A 3W0SA 1JWHA 3LLTA 1H24A 1WAKA 3EH9A 4DG2E 4BTKA 4UMPA 4DGNA 3HMOA 3VBQA 3E7VA 4OTQA 4QT1A 3RTPA 3UBDA 4U45A 4AW5A 2C3KA 4S30A 5E4HA 5CTPA 5IUIA 2IN6A 3G2FA 5LARA 1QPJA 4BZNA 5CASA 4AXFA 2VTPA 2QR8A 3QTIA 1XHAA 1YHVA 4YC6A 5DH3A 5DT0A 2QOLA 4ANSA 4B8MA 1UU3A 4CFWA 3HMIA 2O8YA 3MN3A 2Q0NA 3EWHA 3LLAA 3R6XA 4J8MA 4X3FC 5BUIA 1E1XA 3A4PA 3LKMA 2I6LA 4XRLA 3V5PA 4BDHA 1F3MC 3KXGA 4CFMA 4JNWA 2CJMA 1Q5KA 4GG7A 4MWIA 5I0BA 1A48A 2Z7RA 4Q5HA 2VO6A 5IDNA 1GZNA 5FTQA 3NW7A 4D5HA 2CDZA 5KE0A 3PRFA 2I0VA 3F3TA 5C9CA 3ID6C 1YXUA 2XJ2A 4L52A 5LCJA 2YWPA 3I5NA 4A9TA 1H07A 2GS6A 4HNIA 4UYNA 3ZSGA 2W1FA 2AYPA 4LDTA 3HLLA 3I1AA 4R3PA 4A06A 3BGPA 3ZM9A 1MQ4A 4AN3A 1NY3A 3BHTA 4ITIA 4ALVA 3DB6A 4ANNA 5JZNA 3RHXA 4ZOGA 4IDVA 4ITJA 1XQZA 3BU6A 4Y8DA 4YTCA 3VBTA 3FI4A 2OZAA 3AD4A 2Z60A 4I0RA 3F82A 4XJ0A 2VTHA 3LJ2A 2HZ4A 3HV3A 3EL7A 1YDRE 4OT6A 4M69B 4QTAA 4HYIA 3CLYA 3MA3A 1XH5A 3ZZEA 2VTNA 1CSNA 3ACJA 4JG7A 5E8UA 3R21A 3L8PA 4IMYA 2WZJA 3PJ8A 4EK6A 5HIBA 4U3YA 2B9JA 4AACA 4RJ8A 5E92A 4C35A 5HVKA 2ITVA 2XALA 4FEVA 3D5UA 4QTEA 4YJPA 2YIXA 3GFEA 5FDXA 4DEIA 2ITQA 4FSRA 4JVGA 3IW4A 5CQUA 2F49A 3FZTA 4EK5A 3E88A 4O0TA 5D12A 5TO8A 4DITA 2W17A 5HU9A 4O91A 3KRXA 4IADA 3P79A 3R83A 1P14A 4DC2A 2P33A 4B6LA 3AC3A 4IE9A 1V0BA 1ZXEA 4BGHA 3C9WA 1XBBA 2XP2A 3QRKA 4E6QA 2R64A 2XF0A 3Q4UA 3IECA 3PVWA 4GVAA 2WPAA 2QKWB 3UYSA 2C0OA 5CAVA 3LVPA 3ENHA 4ONAA 4EK3A 3E7OA 5L2TA 3DNEA 5A6NA 3S00A 1T45A 1XO2B 3ITZA 4F9CA 5DE2A 4WIHA 3EZRA 3FUPA 3PYYA 4GK3A 4IX3A 2Z8CA 3G0EA 1E1VA 4CZUA 4RFYA 1FQ1B 2WMUA 3GCSA 4E4MA 4BRXA 4LOPA 1FVRA 1SZMA 5K3YA 2CKOA 4UMQA 1MP8A 3V8SA 1RQQA 1Q8ZA 2UZEA 4EH2A 2YM5A 4O0VA 3L9PA 3QD0A 4PNKA 2QHNA 3FLYA 5A4LA 3BYMA 3E63A 4G1WA 3KMMA 4F0IA 2J7TA 3FMDA 2UZWE 3F69A 1ZYJA 3KRJA 5CLPA 5G1XA 4ANOA 3AKLA 3HMMA 3ZBFA 4FZDB 3R04A 3UVPA 3LIJA 3EOCA 2YCFA 5I9WA 4BDAA 1CMKE 2HAKA 2LGCA 3WYXA 4J1RA 5L2SA 4IEBA 4TWOA 2WB8A 2R7BA 5IQGA 4EWHA 4F0GA 1OBDA 3O17A 4RG0A 4LMUA 4LMNA 4GU9A 5J87A 3RK5A 1FPUA 4L45A 3VW8A 3ZH8A 3DJ7A 3P9JA 1M2PA 3C51A 2ZAZA 4F7LA 4YURA 2W05A 3N4VA 4EEVA 5AUYA 4ANMA 3NNXA 4X6RA 1JKSA 3H9OA 5HE0A 3B8QA 4XH6A 4IVDA 3S4QA 3I7CA 3HMPA 3GFWA 2PVYA 3VS7A 3F5XA 5HNGA 3NR9A 4L9IA 3UNKA 3U55A 2VWYA 3ZC6A 2WMRA 2XNBA 3ZO4A 2O63A 1YHSA 3QGYA 3KVXA 4KB8A 3SV0A 3W10A 3WIGA 4D2SA 2I7QA 5HIEA 5BV3A 4AGCA 2UZDA 5EQEA 4E5BA 3PP0A 4GUBA 4E3CA 4J8NA 4FYOA 2BIYA 2YM7A 3E8CA 5AUXA 4RRVA 3RNYA 4KWPA 4G3CA 4IZ5A 3FLSA 3TV7A 2ITPA 2QVSE 2WTKC 2B9FA 4KBAA 3WYYA 2OBJA 3ZXTA 2PVLA 3KF4A 1YOLA 2ITWA 2PZYA 2WTDA 3RWQA 1PF8A 2B53A 2BUJA 5AV3A 4EOQA 4F9AA 4BF2A 2XJ1A 3V5JA 1WBPA 2UZUE 4PP9A 5CU4A 3EFWA 3QQGA 5M4IA 5IH4A 4GT3A 5ANDA 4EORA 2R3HA 2VTOA 1AQ1A 3OCSA 4RT7A 4B0GA 4PMPA 3OHTA 5DPVA 5CF4A 2XK8A 2BFYA 4P7EA 3FI2A 4RA4A 1U46A 4XG7A 3V6RA 4FL2A 1SMHA 4MHAA 3MYGA 1BI7A 2IWIA 2ACXA 3DBCA 3DJ5A 4FIIA 4XBRA 3WARA 4PDSA 3BYOA 4D1SA 4JDJA 2JBPA 4M14A 1OMWA 4PV0A 4KKHA 3A7FA 5BVKA 1PXJA 2WMXA 4C2WA 3I6UA 4EKLA 4F1OA 4ZSAA 2CMWA 2Y4IB 3CCNA 4LUDA 4QP6A 4WOVA 3UO4A 4F9WA 2GS2A 5F94A 4V0GA 4FOCA 4BFMA 3DFCB 3FPMA 5FXSA 2XBAA 3RM7A 3C4FA 5GJDA 2OJGA 4GK4A 4FV7A 3QXPA 3ZXZA 2WKMA 3ATSA 1U59A 4G5JA 4EBWA 3HA8A 1DAWA 4XHKB 4G17A 1YXVA 2X39A 4UV0A 4RWKA 4FT7A 4WBBB 5AR5A 5TF9A 3KXXA 4N70A 5CEKA 1H4LA 4WKQA 3EQIA 2YDIA 5AJQA 3NMUF 2GFCA 5IA2A 5IQEA 2C1AA 1YI6A 4U40A 4X21A 2YDKA 4BDCA 1YQJA 3R71A 4D0XA 2VTLA 3OCTA 4C62A 1G8SA 2FH9A 2UW3A 3OWJA 4U5JA 5EHYA 3R9DA 3R30A 4FSWA 4QMLA 4ENXA 1TQIA 3O0GA 3VN9A 1Q8TA 3E5AA 2IJMA 5ANIA 5GNKA 3QAME 3NYOA 3EQPA 4GG5A 4UXQA 4X2FA 1H0VA 1ZOGA 2YAKA 4J97A 3TZ8A 4ZTSA 3ETAA 1UKHA 1BMKA 5DIAA 3D9VA 1WMKA 3QZGA 1M14A 3CQUA 3EKKA 3GVUA 3OT3A 4V04A 1IR3A 3GOKA 4K1BA 2BPMA 4AN9A 3CTQA 4NUSA 2XRWA 4XMOA 3UDBA 4CMTA 4EHVA 5ICPA 2VWXA 1NW1A 4PPBA 4XCUA 3KXMA 3PZHA 3UDSA 2W5BA 3V04A 2XEZA 2ZMCA 3RPRA 4E6DA 4DFNA 2W9FB 1M2RA 2ESMA 4FTOA 3ZM4A 1GIJA 4YZCA 5CANA 3TUCA 4GH2A 2W99B 4IIRA 3R1SA 4CMUA 4QP7A 5M51A 5GINE 3EHAA 4M12A 3UOJA 2G2HA 3QWJA 2XBJA 5E8XA 4I3ZA 3NIEA 3PSDA 5CU3A 5CU2A 5LXMA 3MW1A 3CJFA 3NGAA 5AR2A 2X1NA 4AQKA 4Z7HA 2HZNA 4FRFA 4ITHA 1TVOA 4RSSA 4FT5A 2HY81 2OW3A 3F6XA 3H30A 2PY3A 3NNVA 4X2JA 5AP2A 2WQMA 5CY3A 3TKHA 3U4UA 3SKCA 4ALWA 4PL5A 1B38A 4RZVA 4EH7A 1Q3WA 5FDPA 3D7TA 5IEYA 4W8DA 3U6IA 4IFCA 2PVNA 1IEPA 2QNJA 2JBOA 4GVJA 2IZRA 5E1SA 4ACDA 5DR6A 3TEIA 2WD1A 3D2KA 4ZEGA 2GNGA 1YXSA 5DT3A 5BMSA 3QZHA 4MBLA 5D7AA 4QQTA 3ORPA 3MJ1A 1ZAOA 3KB7A 4QYEA 4BY9E 2A19B 3KMWA 4ASDA 4CXAA 2F9GA 3LXPA 1WBTA 3AKKA 3ZFYA 2UZOA 4RVMA 4XBUA 5F20A 5HVYA 4TWNA 3UO6A 3S0OA 3ORIA 5JQ8A 4HZSA 5IG1A 3KCFA 4FV2A 4ZTNA 3BBWA 1PXIA 3UOKA 5IH5A 4CSVA 2YZAA 2ZYBA 4YJQA 1PMVA 4CFUA 4DGGA 4ZP5A 3GU8A 4FR4A 5LJJA 4X3JA 4FTMA 3JVSA 3RK9A 5IEVA 3H9RA 5DI1A 4GS6A 4WHZA 5CI6A 3LCKA 5A46A 4DFYA 3SXSA 3DXQA 4E5WA 4OAUC 4DH7A 2B55A 5DN3A 3MBLA 3MTLA 2YABA 4EYMA 3BYUA 4CKRA 3W0RA 1SVGA 4U79A 4ZTLA 5BMMA 3DZQA 2A0CX 2JD5A 3T8OA 2XVDA 2QHMA 4CGAA 4RMZA 1OI9A 4BCOA 5EHOA 5BYZA 5HQ0A 4I0SA 4IZYA 1UWHA 1VZOA 3PSBA 5E8WA 1Y8YA 4M97A 3I79A 4EZ5A 4HVHA 5AFVA 4DHFA 3MH1A 2WMBA 4YZ9A 3UVQA 1GY3A 4C2VA 4C3FA 4O22A 4P90A 4R8QA 4JQ8A 4BIEA 1QCFA 5HZNA 4C37A 5EQPA 2GHMA 4KBKA 5CAUA 2RFSA 4OTFA 1BYGA 4YTIA 3R9OA 5KMLA 4AW1A 2ZB1A 1APME 5CEIA 3NAXA 2XAMA 3R8VA 2C3JA 5CSHA 1CKJA 4PDOA 4JG8A 3UNZA 3U6HA 5M55A 3DXPA 3V01A 4CQEA 5A4CA 2H34A 3EN6A 4ERWA 5KMNA 2ETKA 2UUEA 2JKKA 4H1JA 4DT8A 3MTFA 4CTCA 3W0PA 5IZFA 4TRLA 4IBMA 4BWXA 3N4UA 1OB3A 2JFLA 4W4XA 1Q3DA 3K5UA 3QUEA 2VRXA 3E8NA 1O6KA 4XG4A 1YVJA 2HWOA 3R7VA 4ZLOA 2PYWA 3PIYA 2Z7QA 4IANA 4PP7A 2CN5A 5KMMA 3L1SA 3UPZA 4IB1A 3FMEA 1Q8WA 2CN8A 2OH4A 4CCBA 1DS5A 1PHKA 2BRNA 3F5PA 5HBHA 2UVZA 2BRGA 4JDHA 4BDEA 2REIA 2QOCA 3BYSA 1G8AA 4O7WA 3A2CA 1H00A 2YCQA 4I4EA 4WBOA 4E4XA 5J1WA 1E9HA 5TKDA 3VHKA 4CFFA 4ZLYA 3SC1A 3D94A 2EVAA 3FQSA 2I0EA 3T3UA 3WF7A 3G9NA 1J7IA 1ZRZA 5DA3A 4BI0A 3HUBA 4FK6A 4NM5A 3FYJX 4I20A 3ZSHA 3W0NA 3E87A 3Q4ZA 4E73A 2X6EA 3DKGA 2ZB0A 3FSFA 4FSMA 2ONLC 4G2FA 1OUKA 3SXFA 3T3VA 3VJOA 1FOTA 1M17A 3FXZA 4IAKA 3Q9WA 3VNTA 4FNWA 2GHLA 2QOQA 4GSBA 1CDKA 1RE8A 4QMMA 4FZ6A 3NNUA 4AN2A 1V0OA