4GJ2A

Tyk2 (jh1) in complex with 2,6-dichloro-n-[2-({[(1r,2r)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 288
sequence length 288
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gj2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gj2A01
2PL0A 3RHXA 2JIVA 5I9UA 3CPCA 2PVHA 4BFMA 3RAIA 3DAJA 4RFYA 3N9XA 4X3FC 3PXZA 3D7TB 1XH6A 3L9PA 3VRYA 3EFJA 4FYOA 5DVRA 4ZJJA 3TN8A 4AW5A 2UW4A 4QNAA 5EQYA 1YRPA 2H96A 4UALA 4IAZA 2JIIA 4IZYA 5BUEA 5IA1A 3QUDA 3D5WA 4D2WA 2G2FA 3QRTA 4AQCA 2OGVA 5CI7A 2UZLA 4HGSA 3Q6WA 2PVMA 4XJ0A 2Q0NA 3F61A 2B9FA 1H1QA 4YPSA 3U8WA 2HZ0A 3UG1A 3KXXA 3KC3A 4FL1A 5DE2A 4AFJA 2F9GA 4JIAA 4JG7A 2PSQA 5HHWA 2VRXA 4ARKA 3ITZA 3F2RA 4PDOA 2BRMA 4FX3A 3LLAA 3RBWA 5CAPA 2WMWA 2ETRA 4BF2A 4FL2A 5CU0A 4L45A 4TN6A 5GNKA 2XIRA 4IE9A 3SW4A 1BUHA 5A4CA 3OWPA 2G2HA 3G6HA 2OU7A 3UVRA 5CEQA 2JKQA 1NVRA 4YPDA 4MXOA 5IKWA 2C3JA 4BDIA 4USDA 5B7VA 5C1QB 1Z9XA 3E5AA 3SXSA 4IM3A 3LXNA 4J8MA 4QPSA 3UZPA 3VQUA 5K4IA 4FT0A 4L3PA 4LUDA 4M68A 2W1HA 3DKFA 4RJ8A 4BWPA 4TZRA 5C4KA 1W0XC 3IONA 4O0SA 4DH1A 3G15A 3KN6A 3S00A 2XMYA 3HMMA 3ZO2A 1GNGA 4Q2AA 4OTHA 4WG5A 4M7IA 2YHVA 4YZBA 4EH8A 1MRVA 2VO3A 3AC8A 3GU4A 3BV2A 1S9JA 3QQHA 5EDQA 2R3QA 3DOGA 5J9LA 3FC1X 3MVLA 4NCTA 4YO4A 3OROA 4CQEA 4L46A 4UZDA 4RA4A 3FWQA 3K5VA 3W18A 2G01A 4BB4A 4IAYA 3NWWA 4KIPA 3GNIB 3G90X 1H28A 5AP1A 3EQCA 3FYJX 3IG7A 5HG5A 5BQ0A 4DA5A 1SVGA 2HW7A 3A62A 3E7VA 3I1AA 4HYHA 4YJNA 1V0PA 4NTTA 1M52A 3LFEA 1KE6A 5AMNA 1PXNA 3GCPA 4PMMA 3NEWA 4QMXA 5AR8A 5A3XA 3CLYA 4U44A 4YJQA 3NSZA 3PFQA 4A07A 5JFSA 3LM0A 3HV6A 3MY5A 1OL5A 4FYNA 2BPMA 4MF1A 3PUPA 4EJ7A 3D5VA 3OWJA 4FV7A 3V04A 4WO5A 2GDOA 2FSOX 3ETAA 3HRBA 5DT0A 5A6OA 2ITWA 4D5KA 2GNIA 4JIKA 3I6WA 4JBVA 2V55A 4XP0A 4PL3A 4CFWA 4XRJA 3I5ZA 3II5A 3HRFA 3BYOA 4Y8DA 4JRVA 3BGZA 4DCEA 2HCKA 3GFEA 3HP5A 3IW6A 3PPKA 2YDKA 4XH6A 4IWDA 2VTMA 2CNQA 4IVAA 3QTZA 3U9NA 3COKA 4U45A 2VO6A 5F1ZA 4C7TA 4DCAA 4M8TA 3R8MA 2CSNA 3PRIA 5AIKA 1O9UA 1V1KA 3HP2A 3UOKA 5LJJA 3CGFA 3R71A 4O7NA 4IH8A 3PG3A 3ZRKA 3K3IA 4C2VA 3LVPA 3OBGA 2BCJA 2XJ1A 3PP0A 4NJ3A 1F5QA 5DIAA 2X2KA 4ANQA 4OAVB 3PJ8A 3PSDA 4FSYA 3QXOA 4AOTA 5CF8A 5HVYA 4IQ6A 3COHA 5J95A 3HKOA 4MF0A 3WYXA 4UN0C 3FY0A 1QL6A 3O0GA 4MXXA 1Y8YA 3RTPA 3GU6A 2CKQA 3LCSA 4YNEA 2PMIA 4U3ZA 1ZYLA 4FTKA 1H27A 1JSVA 4L8MA 3NUNA 2XH5A 3WF8A 4AGUA 1NA7A 3EN4A 5FTOA 3ZSHA 3UGCA 4BBFA 3A7IA 4ENYA 1PKDA 4G5PA 2XRUA 4XNEA 2YERA 5HQ0A 3TTIA 3QCYA 4IVDA 4QP9A 1JVPP 1H07A 2BKZA 4BIBA 3F3ZA 3IW7A 4F63A 3RK5A 4M69A 5HZNA 2PY3A 3QYWA 4QD6A 3QQLA 2W1DA 3BHYA 2BMCA 3CY2A 4RX8A 4FVPA 4RZVA 4ZLZA 4YC6A 1PF8A 5GINE 1RJBA 3F3TA 3LZBA 5K5XA 3FQHA 3LXPA 3WYYA 3BELA 2BIYA 4O38A 4UWBA 2VTIA 3EQFA 3KXZA 5EK7A 3QA0A 4QYFA 5CAQA 4JOAA 1YQJA 5KMIA 1CMKE 3C1XA 2FB8A 3RALA 4FMQA 2FSLX 3MVHA 4WA9A 2OWBA 1OL2A 2OJ9A 4LRMA 3ZOSA 2FA2A 3DBCA 1OBDA 1PRYA 3I0OA 4ANOA 4OTRA 4FTLA 3AD4A 2HW6A 3CEKA 1AGWA 1CKPA 1OZ1A 3FMHA 4XOYA 5IZFA 2XKDA 5IQBA 1OPLA 4BZDA 3UPZA 4MH7A 4FZ6A 2GNJA 3FPQA 3OBJA 3E8NA 2J51A 3QUEA 5HE3A 5HE2A 3MVJA 2C6IA 3A4OX 4TYJA 4YZ9A 5AM7A 3VBVA 3FXWA 3FYKX 1VJYA 2O2UA 4C37A 5JT2A 3VO3A 3VJNA 1M2PA 3JUHA 3LXKA 3R00A 5C8MA 2EU9A 2WQEA 2WAJA 3Q9XA 3G6GA 3NW5A 5D9HA 5HNIX 1JPAA 1UWJA 2YAAA 4ANLA 5HCZA 2FH9A 3D4QA 3DV3A 1PMUA 3NNXA 1Z5MA 2F7EE 5E8WA 3WOWA 5EYMA 4Y5QA 3R7VA 2QD9A 3AT2A 3ZXTA 3CS9A 4I6HA 3TV4A 5A9UA 5FBOA 3E8EA 3F82A 4EKLA 3QRJA 2A4LA 2W1IA 3ZZEA 4KRCA 2X8DA 1Q99A 2BUJA 2ITNA 4M97A 3C5UA 3RINA 1UKIA 1WCCA 4ENXA 3EQDA 4I22A 1ZARA 5L8JA 3C0HA 4C57A 4NU1A 3VRZA 1NW1A 2QR7A 2XNOA 4QQCA 5HKMA 1OKZA 3BYVA 3R8LA 4R8QA 2OF2A 4DHFA 5L6PA 3PTGA 3VBQA 3DZQA 3ZFYA 4YBJA 4Z3VA 4CTBA 4BKYA 5K5NA 3MW1A 2UZWE 3AMAA 4O81A 1BX6A 5ANJA 3NNVA 2ZMCA 2AC3A 2XIZA 4C38A 3K3JA 4YTCA 4V04A 4EEVA 2R4BA 4EC9A 4K33A 4E6DA 1I09A 3VW8A 1H1PA 1GZNA 4K9YA 4FR4A 4QP6A 4OUCA 4RFMA 3UODA 2IPXA 3QTQA 3HMNA 3VS2A 4YZNA 2WTVA 3TUDA 4RIYA 1OI9A 4QOXA 3IOPA 2JBPA 5HU9A 1SM2A 4FICA 3QD3A 2Z7LA 2R64A 3FZTA 4FV9A 3VS7A 2ZAZA 3MPAA 5DGZA 2VTTA 3KF4A 4CMUA 2OIQA 3A2CA 5CEKA 3ZHPC 2I0HA 2OZAA 3MA6A 4PTEA 5KHWA 3V6SA 1F3MC 4JVGA 4BDEA 1JKTA 3L8SA 4J53A 2VTNA 3V5WA 2XNBA 3F2AA 1G3NA 5EFQA 3KA0A 4G9CA 3U55A 5BVFA 4LFIA 4A4OA 1XH4A 4JX7A 3PJ1A 3LLTA 3RAWA 4AU8A 2UW3A 4FBXA 4GW8A 2OFUA 5CENA 3ZLSA 3VC4A 2NRUA 3QFVA 3ZRMA 3LFSA 2CLQA 4QMMA 2F4JA 4C35A 5BYYA 2BKKA 5M4FA 3QLFA 4FV3A 3VS0A 4QMOA 3TNPC 4AOJA 3S95A 3TDVA 1REKA 4FK3A 4RVTA 4JQ7A 2PYWA 4D1XA 4ITHA 4JNWA 4GIIA 3L9MA 4IANA 1WBTA 1WVYA 4YLJA 5IQAA 5FXSA 4ZK5A 3T3UA 4L3JA 3GT8A 3GQLA 4E20A 3BEGA 1E1XA 3WIGA 3R1SA 4UYAA 5H9BA 2Y0AA 2HAKA 2W5AA 3LQ8A 5AP2A 4AX8A 3UIMA 2A0CX 1KV2A 4FKGA 4D2PA 4J52A 4FKUA 1IG1A 1Y57A 2UW5A 3SG8A 3NUYA 2PZPA 4D1SA 2YN8A 4JJRA 4OT6A 4U40A 4FGBA 3NMUF 1BMKA 4NCTC 4CXAA 3E8CA 2G15A 4JAIA 2UZVA 3E62A 3S4QA 3Q9ZA 4EK3A 1BLXA 2VN9A 4G1WA 1XH7A 3HLLA 4IHPA 2O3PA 4OTDA 2G2IA 4A9TA 4EBWA 3A7GA 3LW0A 4GT4A 3PXFA 3UG2A 5FWKK 4BZOA 4R1VA 2CN8A 1YHVA 2IJMA 2P4IA 1OL7A 4JBPA 3FDNA 5EYKA 3V01A 3QF9A 1O6LA 4EWQA 4I5PA 3ODZX 4GK4A 4ZSLA 3QHWA 4HW7A 3NYOA 1IA9A 2E9VA 4X3FA 1FMOE 1TVOA 2J90A 4UMPA 2QOIA 5AAEA 3HA8A 4FZDB 4MEDA 1PXPA 1PHKA 4IB1A 4WNPA 4EONA 3RWPA 5BYLA 3VBXA 4O7SA 3Q5IA 3T8OA 4BDDA 1YI6A 3TKHA 4QQ5A 1UU3A 3P5KA 2EXMA 1LR4A 1GZKA 3DKGA 3EOCA 2OKRA 4KBKA 4DEHA 4DFXE 2AYPA 3IOKA 3AD5A 2PHKA 4XLIA 2NNWB 4ANNA 3VF8A 5HG9A 5IH4A 4IMYA 3FI2A 4KRDA 3QKLA 2Y4IC 1R3CA 2B52A 4R5YA 2J0LA 3FMLA 4J96A 1H00A 2WOUA 2P2IA 4M69B 4RX7A 4CNHA 2Z02A 3UJGA 1XH8A 3FSKA 3VJOA 5LOHA 3QZGA 4FEUA 3BGQA 3EB0A 1JSUA 5DEWA 5GIPE 5KCVA 3GUBA 3TJCA 5G1XA 2EB2A 4Y95A 5E8XA 3KXHA 3DDQA 3R6XA 4OBQA 4HCTA 5TR6A 3MH0A 3QGWA 3RZFA 3V5PA 4MQ2A 4BDGA 4BTFA 5JQ8A 4DEBA 3GGFA 5IH5A 1TQMA 2UV2A 2YCQA 3FMKA 3KXNA 2CJMA 3PJCA 4Q5EA 4ACMA 2RFSA 3DA6A 2IN6A 5F4NA 1P4OA 3R9RA 1G5SA 1H0VA 4J95A 4TWPA 3MY1A 4ERKA 2C3KA 4U8ZA 3NAXA 4CYIA 4EK4A 3CTJA 4GYGA 3O7LD 3T9TA 4L01A 1FOTA 3FE3A 4I5HA 3PSCA 2J0JA 4HJOA 3DBFA 2X81A 4QP8A 4IWQA 5EYCA 4PDPA 3MGYA 5EDRA 1YWRA 3B2TA 4TTHB 3MV5A 4DH7A 3DXPA 1JBPE 3R1YA 3MTLA 4K18A 3SOAA 4EL9A 3MJ2A 5CT7A 3DGKA 4D28A 2J4ZA 4D2TA 5KMJA 4FZ7A 3HDMA 3LE6A 1F0QA 5CEIA 1P14A 3C4WA 4F9WA 3R1NA 1OITA 4JG6A 2HXQA 4NM3A 2C6OA 3NUPA 4X2NA 2GNFA 2DYLA 4GJ2A 2J2IB 3UVQA 4BCFA 2QONA 4QRCA 3ATSA 2GNLA 4PRJA 1BL6A 4J1RA 3NRMA 2J5EA 4ZTLA 4CFNA 2E9PA 4XG8A 2VWWA 3K2LA 3A7JA 4FEQA 4KIQA 1XR1A 3HYHA 2IZUA 2ZDTA 2WZJA 1MUOA 3TZ7A 1OM1A 3HX4A 3MH1A 2RIOA 4BDCA 4AA5A 4FTJA 3MFSA 5HG8A 4RX5A 3CC6A 1YOJA 4BCGA 1IAJA 4YJSA 4CKJA 2WMQA 4R7HA 4DG3E 1KOAA 3G9LX 3PRFA 1YXSA 3R7GA 2Y7JA 4NKAA 5IG1A 2QO7A 4OTGA 2PU8A 4XG2A 3G9NA 1ZYDA 4DN5A 3BWJA 3KULB 4DGLC 2OW3A 3CQUA 3O50A 3UIUA 4FV4A 2BDJA 3I5NA 2WTKB 3EQBA 5I3OA 4BWKA 3E8DA 3CXWA 3NCZA 3WZJA 1WBVA 5HE0A 3QALE 5AAFA 4N70A 1ERKA 2UW9A 4FIIA 4RIXA 3FQSA 4UMRA 2ZYBA 4HOKA 2EUFB 4EH4A 2O63A 3EIDA 2Y6OA 5TE0A 3P7CA 3EQIA 3C4XA 4EOKA 3ZO1A 2RFNA 3DLSA 2JAMA 3LMGA 5CEMA 2B9JA 3LFBA 2VTSA 5IUIA 2YABA 4O96A 2YIRA 3DK7A 2OZAB 3H0ZA 5CYIA 4BIEA 4RVLA 2FO0A 1YOLA 4FEXA 3G2FA 4FTMA 4C02A 4C4HA 2F49A 1YWVA 3OWLA 1JAMA 3UNJA 5M57A 4TWOA 4AWIA 3FSFA 2QCSA 3CQEA 2BFYA 4PUZA 3GEQA 4U80A 4XV9A 5JMSA 3E7OA 5KBRA 3FZ1A 4L43A 5HIBA 4ANBA 4F0FA 3JY9A 4XLVA 4MHAA 1U5QA 1ZOHA 2GS2A 5FBNC 2NRYA 2UVXA 4EHVA 4GV1A 5C8NA 3TNWA 5L6OA 4O1PA 2HZ4A 3D0EA 3O96A 4FTAA 5ANOA 2VWBA 1YI3A 1Q8UA 3F5PA 5LARA 4H39A 1PXJA 3QD4A 4I3ZA 4K11A 4O7YA 4H3PA 5FDXA 3FL5A 3KREA 2W96B 2PZ5A 4XV3A 4ANSA 2FUMA 2A27A 2X6DA 3Q4ZA 4W4VA 4KKEA 2P33A 3B8RA 4JS8A 4AT3A 4I6BA 2ETKA 5L2IA 1FBNA 4IIRA 3NZ0A 4RMZA 2XIXA 4FOCA 4BCMA 5DA3A 2ITYA 2O65A 2XNPA 2XZSA 2ZV7A 4M14A 5AUVA 5AV0A 3GC8A 3ZLYA 4GYIA 4FE2A 4YNOA 5J9YA 3DTWA 3QHRA 1L8TA 2OI4X 1H1SA 2PZYA 4ASZA 3HUCA 3NIEA 4ZJIA 2ITQA 5AR4A 3W55A 1IEPA 1J7LA 2DQ7X 4ZTRA 1TKIA 5AUXA 4Q9ZA 3QWJA 4XS2A 5DG5A 3ZEWA 1PY5A 3ORZA 3BE9A 2VX0A 2WQBA 3UPXA 5AR7A 2QOBA 4XG7A 2JAVA 1Q61A 4KAOA 2RFEA 2C5VA 3ACKA 5M08A 2WMSA 3UMWA 4HVIA 2PVJA 2ZM3A 4UV0A 4FSZA 2BILB 2E2BA 4N0SA 5HU3A 3MH2A 4BBMA 4AW1A 3KMUA 3OCSA 1GZOA 4CT2A 1E9HA 3IW5A 5F9EA 1M7QA 2BHEA 1LPUA 3BE2A 3I79A 4X3FB 4O0TA 4QT1A 3V8WA 4QNYA 3Q60A 3LMIA 2ITTA 5J7BA 3QRUA 3NR9A 1HOWA 4RWLA 3UYSA 4APPA 4YURA 5CZHA 5HO8A 4CMTA 4E6QA 1YXVA 4RT7A 4UWCA 5IA4A 2R3OA 4UY9A 3ZFMA 4KS7A 4FKTA 5BPYA 4NL0A 4FKPA 2VO7A 5HEZA 2WB8A 4EOLA 3I4BA 1WVXA 4H36A 4TT7A 2BZKB 2QURA 4S32A 3NDMA 4FT5A 4BR3A 1J1CA 5HBEA 3H9OA 3AC1A 3OUKA 3MTFA 2QI8A 5JH6A 5HICA 4DEDA 2PVKA 3GOPA 4IVCA 1OGUA 1YDTE 3QRIA 4LGHA 2C30A 2C47A 2WMBA 1JOWB 3BLHA 3I60A 4KINA 3DTCA 2YM4A 3O7LB 3SC1A 4C0TA 4DH3A 4EBVA 4HVGA 3TKUA 3Q9WA 3GVUA 1PXIA 4FG7A 4QMVA 4TRLA 5KE0A 3KK8A 4O0UA 3W2OA 5I3RA 3V6RA 4FV1A 4EK5A 4D2SA 1V0BA 3CR0A 1KE8A 5AM6A 1WFCA 4I23A 4G3FA 5EM8A 4ZS4A 3EYHA 5IEXA 4G3DA 3KFAA 5ANKA 3E3BX 2WQOA 4PQNA 2VWYA 1UKHA 4L7SA 1PMVA 3WZKA 3PIYA 4LV8A 4O83A 3MIAA 2OFVA 4W9XA 4CCUA 1UU9A 3ORMA 4UBAA 3UNZA 3A8XA 1GY3A 2IZTA 4JDKA 4W4XA 5HTIA 4KD1A 4GK3A 2JGZA 2YM5A 5EW8A 1T46A 2J7TA 3L8XA 3ZZWA 1A9UA 3GXLA 4ID7A 2W5BA 3FMMA 4O0WA 5EQPA 4QYHA 3EKKA 2R3LA 2R3RA 1DM2A 3EZRA 4H1MA 2JDTA 4TKSA 3KKVA 3FHRA 4V01A 5B2KA 3V5TA 2BALA 4KABA 2XS0A 4C3FA 4AE6A 4FKVA 4ASXA 4IW0A 4EK8A 1ZYCA 3PWDA 4HZSA 4IZAA 3TZ8A 3QU0A 2CGVA 2I6LA 4H3QA 4WBOA 5H8GA 3VHEA 3U6HA 3QWKA 4RC4A 2VGPA 4O84A 3CPBA 4DG0E 4C3RA 2VNYA 5E8UA 3R83A 3DY7A 3ZXZA 4C8BA 3GC7A 3MY0A 4X6QC 2AC5A 4ZZOA 4A06A 3GC9A 2ZB1A 5HCYA 5J7HA 4BDBA 4HYIA 3EN6A 3KQ7A 4H1JA 1OL1A 2C6DA 5I9XA 2W06A 4QMYA 1K2PA 3EFKA 4RRVA 2UZEA 5JFXA 2FVDA 4YBKA 3SX9A 3Q96A 2YM6A 3I7BA 3VWAA 3HEGA 3UOLA 1RDQE 3A99A 3C4FA 4IZ7A 4MD8E 2YM8A 3ZM4A 1WBWA 2PK9A 2PMNX 3UOJA 3HAMA 4AT4A 5AP4A 3PIZA 4DEAA 2OLCA 3QCSA 1PYEA 2FYSA 3LPBA 5CEOA 1H4LA 3VS1A 3QCXA 5JSMA 3IPHA 4DEEA 5CSXA 1QPCA 2G9XA 3VN9A 4EH3A 4O7WA 1B39A 4AE9A 4TYHA 4ZTMA 5IQHA 5DYJA 5H2UA 4BCIA 4RIXB 5JGDA 3TWJA 5K4JA 1STCE 3KRXA 5C01A 1YXXA 3E93A 5CEPA 4CG8A 4QO9A 4YLLA 3E3PA 4ZMFA 2YFXA 2VWVA 1FGIA 5AX3A 5LMAA 1NVSA 3O71A 4FKJA 3TCPA 3PWYA 3Q2MA 4NIFA 3GBZA 1Z57A 4X6RA 3BV3A 4AZVA 2YACA 3H9RA 4BTMA 5CVGA 2YM3A 3KMMA 3A60A 4R3CA 3RWQA 4TWNA 2HZNA 3NYVA 5DR6A 3RCJA 4BHZA 2HK5A 1OIRA 2X9FA 3A4PA 1UWHA 3UVPA 3ZLXA 4E5AX 3OOGA 4R77A 2ZDUA 3D7ZA 2PVNA 5CSWA 3VUKA 5EHLA 4RVKA 1LEZA 2C3IB 2UW7A 3F3VA 4HNIA 5CZIA 5AUYA 4XV1A 3W32A 4GG7A 3C4EA 4B8MA 4V0GA 4EUUA 2IW8A 2BDWA 4FIFA 3FMJA 3LFFA 3OEFX 4XG9A 4ACCA 2QG7A 4RIOA 4WNKA 3RMFA 3NUSA 5ICPA 2KULA 4YLKA 2IW9A 4F08A 4CLIA 3KB7A 2XRWA 2EXEA 1FVRA 1FVTA 2CMWA 3PVBA 4FIJA 2YZLA 4L53A 3F5GA 3T3VA 4CRSA 4CG9A 4NTSA 4MVFA 2ACXA 1R78A 4G31A 4EK6A 3QQKA 4I6QA 4JBOA 4AZSA 4EYMA 5HORA 3MESA 1REJA 2VTLA 4FGRA 3FI3A 2XEYA 4KBCA 2XIKA 2EB3A 3U4WA 1Q3WA 1VYWA 3M42A 4EZ5A 2B9IA 4JDHA 1PXKA 4RWJA 3VAPA 3DXNA 4NW5A 3EL8A 4I20A 5JEBA 4L7FA 2REIA 3R01A 1DI9A 5JFVA 4FNZA 1Q24A 2Q0BA 2BAKA 3FV8A 3ZONA 4O7LA 5GJGA 3FZOA 4UMQA 5CSPA 3BLRA 5LMBA 1UNGA 3NPCA 3CJFA 5AEPA 4FV8A 1DI8A 2Z7QA 4EZ7A 2GMXA 2J6MA 1IRKA 2RG5A 3L9NA 2UZTA 3OF0A 2YCRA 3TUBA 3IKAA 2VWZA 2GTNA 2XBAA 2H6DA 3SXRA 5LVNA 4I5CA 1NXKA 4U81A 3DXQA 4PPCA 3ZC5A 4F1MA 4EOMA 5KBQA 4BDFA 3V8SA 3OD6X 2BAJA 1JNKA 2ITUA 5BVOA 3DAEA 4AZTA 1XKKA 2R3KA 2PZIA 3BHHA 4LMNA 5HE1A 4PDYA 3V8TA 3KRLA 3CTHA 1WMKA 4I0RA 5CWZA 2XBJA 2CGUA 2EWAA 1ATPE 2XNNA 2C0OA 3RI1A 3R8PA 1PJKA 2GCDA 4IM2A 4DBXA 4GU9A 4C58A 3DLZA 3MJ1A 3OHTA 4ITIA 5AV3A 4FKWA 3RCDA 3T9IA 3UC4A 3UIXA 3TIYA 3R2YA 2JFLA 3VQHA 2QOQA 2WIPA 1GAGA 5EHYA 1FMKA 4KSPA 4RIWA 5HVJA 4EOOA 5AV2A 4YZDA 5E91A 5BVDA 3BCEA 4M0ZA 1YHSA 4XG4A 4PP7A 4D9UA 3TNQB 3KRWA 3RM7A 2ZVAA 3ZSGA 2WIHA 4ANMA 4R3RA 1UNHA 2B54A 4MBIA 2B53A 2YJRA 3BYUA 5ANDA 2WMTA 2XIYA 4HZRA 1XHAA 3CTQA 4ASDA 3VBWA 3PA5A 4IX5A 4L52A 4RJ3A 1OMWA 1HCLA 4FSQA 4BZNA 3FJQE 4PX6A 2PE2A 4F7SA 4OW8A 3CIKA 3PXKA 3UTOA 4NK9A 2XM8A 3VVHA 1H0WA 2CCIA 4U79A 3FAAA 2WTCA 3HVCA 3AXWA 3NW6A 3P1AA 4D55A 4E6CA 4EZ3A 4YSJA 2CNUA 1Y6BA 1OECA 5JN2A 5LMKA 4OTWA 5CT0A 4YP8A 4NSTA 3ZMMA 4I4FA 2OO8X 4LRJA 4WD5A 1AD5A 4UEUA 3FLZA 2YDIA 4KB8A 5CQWA 4D4YA 3BPRA 1S9IA 3ZO4A 2UZUE 2YIWA 3LMHA 5CU4A 4M67A 4FT7A 4IAKA 4DT8A 5BMSA 2J0IA 1Q4LA 4HYSA 4YJUA 4BTKA 2R7IA 2YAKA 5M44A 3FKNA 5BX0A 1EH4A 3AG9A 4X2FA 4GSBA 5M06A 2O64A 1YDRE 5TF9A 3DKCA 1BKXA 2PZRA 2E9UA 4IM0A 4BCPA 3I0QA 3EN9A 4O86A 3OUNB 2PULA 3R8UA 2J0MB 2B55A 3ZO3A 2QR8A 5IU2A 4P7EA 5FEEA 1OBGA 3GQIA 4X2GA 3UO5A 3LHJA 5DBXA 2W1FA 1UU8A 3DU8A 4PMSA 3PIXA 1L3RE 2GS7A 2VU3A 2OZOA 5C03A 4L42A 3RPSA 2OJIA 2RFDA 2F57A 3ORNA 4APCA 4K77A 3ZFXA 5IDPA 2O8YA 4HVSA 1W98A 4FTNA 4IJ9A 1J3HA 2C0TA 3W2SA 5IA2A 2DUVA 2HZIA 3FXXA 3LOKA 1R0EA 4JG8A 4LGDA 4PTGA 3H0YA 4XP3A 4AT5A 2XCKA 4EOJA 5ITAA 4C3PA 2GFCA 4M13A 2R3GA 4R7BA 4C4FA 3K5UA 4RQKA 4C36A 3ELJA 4C4IA 5GJDA 3EMGA 4USEA 4M66A 5FUTA 5EQEA 2RGPA 3OEZA 2PVRA 4K2RA 3FBVA 5KZ0A 3BGPA 3R7UA 2HY0A 4BGQA 4TWCA 4E1ZA 3R63A 4GJ3A 3QQJA 3Q6UA 4BICA 4DEIA 3QTXA 4TYGA 4ASEA 4L67A 3OT3A 3TV7A 2XJ2A 3LFDA 2W4KA 3D5UA 2GSFA 4A9YA 4WHZA 4CV9A 3AC2A 4O7ZA 4K6ZA 3IGGA 4DT9A 5FRIA 1J1BA 3TT0A 2C1BA 1UVRA 4S30A 3QTIA 4D2RA 4YTFA 3QD0A 4ZSAA 4CKIA 2W7XA 3RGFA 3LQ5A 2YLEA 3ACJA 4DFYA 5I4NA 3LCDA 4EQUA 3QAME 4FODA 1T45A 5HBJA 2WTWA 5D7AA 4BVUA 3NGAA 2WU7A 4WIHA 4FTIA 3C0GA 5JRQA 3QL8A 2Z7RA 1XH9A 4FSUA 5EKNA 3O8TA 5H8EA 5IUGA 4QP7A 4ALVA 5FG8A 3N4UA 3VF9A 4W8EA 2R3PA 4RWIA 5L8KA 2I1MA 3EFWA 2O0UA 1J7IA 3R7EA 1OB3A 3QBNA 2VUWA 3KCKA 3MN3A 2H9VA 4A7CA 2AUHA 4J7BA 2PMLX 4HGEA 3FI4A 3R73A 3MSSA 3U6IA 1YW2A 2HWOA 2VWUA 2PMOX 3MPTA 5AUUA 3P79A 4IC8A 4UXLA 3NUUA 4S33A 3KXGA 3QTRA 4TW9A 4AGWA 3QZFA 4YJOA 1XBAA 2WMVA 3BI6A 2ZV9A 3ANQA 3VULA 1WAKA 2Y4IB 2P2HA 5HESA 4AAAA 3R28A 3UNKA 3UQFA 3THBA 4C62A 2B9HA 1AQ1A 4IEBA 4QQTA 2R3FA 4NFNA 3PY1A 4NYEA 3HMPA 2BHHA 5J79A 3SGCA 5LVMA 2XNGA 1U54A 1WBOA 2PE1A 2WFYA 4G5JA 4X3JA 1ZLTA 4OTIA 5ANEA 3U51A 3PPJA 4JLCA 4E4MA 3MIYA 5DH3A 3NVMB 4O1OA 4R5SA 5HLNA 3C0IA 3CD3A 2CHLA 5E8ZA 2VO0A 4BCOA 2YJSA 4UMUA 2C6MA 3Q2JA 2J50A 4DYMA 4EHGA 4FIGA 2V7OA 4DFBA 1YXTA 2ESMA 2C6KA 4TNDA 3QQFA 4YTIA 4YU2A 3VUTA 2A1AB 3PXYA 1Y8GA 2ITZA 2PE0A 4R3PA 4U9AA 2UZOA 5T6KA 5GZ8A 3F3WA 3DT1A 4XP2A 2XYUA 2XM9A 3FLWA 3VBTA 4FKRA 5M53A 5ETIA 3UO6A 3C4CA 2HYYA 3ZSIA 4TYEA 3WF7A 4F4PA 4BBEA 3BBWA 3HUBA 4TYIA 5BVKA 3VUDA 5AADA 4PPAA 1K9AA 4BL1A 5HIEA 5IQIA 1KSWA 3R8ZA 2NPQA 3PE2A 2RG6A 5J1WA 4MBJA 3AMBA 4JXFA 4QPAA 4L9IA 4S31A 3ZLWA 3EZVA 4I6FA 2I0VA 3R30A 1ZMVA 3RAKA 3SV0A 2JLDA 5E92A 4WKQA 5BMMA 3UZRA 2QC6A 2JKKA 3C51A 3IDBA 4GCJA 3ZTXA 4FA2A 5J87A 3W2RA 3PZHA 3QTSA 1H8FA 4FTCA 4ZMEA 2IO6A 4YZCA 3HV3A 2R5TA 1Y6AA 2Z2WA 4MXYA 2I0EA 4OBOA 4CVAA 5JQ5A 2W1ZA 1HCKA 1PMEA 4RIWB 4NM5A 4U7ZA 3WE4A 1E1VA 4RWKA 2ERKA 2GNHA 3QKMA 1OUKA 5CVHA 4ZTNA 3VBYA 1DS5A 1KWPA 2RSVA 2FSMX 2VD5A 4BIDA 4DGGA 1H1RA 5M51A 1ZZLA 4J8NA 3EJ1A 3HV5A 3JS2A 3R1QA 4F64A 3TEIA 2B4SB 2Z8CA 4J97A 4PTCA 2EXCX 3HA6A 4LOQA 2WELA 4M0YA 5IMXA 3JPVA 3C4ZA 5CQUA 2OJJA 3RJCA 3DKOA 4K8AA 4O0XA 2Y9QA 2OXDA 4I41A 3TIZA 1ZY4A 5HD4A 1SNXA 2WTDA 3WILA 3SHEA 4W4WA 1ZMUA 2WMAA 3QZHA 4PY1A 5EM7A 1JKSA 2CN5A 3DBDA 3CSVA 3UBDA 2C68A 3F3UA 1WZYA 3ULIA 3ORLA 4JDJA 2YM7A 5DOSA 4FTRA 3BBTB 2J5FA 3PJ2A 4QMPA 2YA9A 3LJ1A 3WF5A 3QC9A 3LM5A 2Z7SA 2JFMA 4JQ8A 5IQGA 4UMTA 4JX3A 1KOBA 5CASA 4FSRA 5HNBA 4KNBA 3UMXA 3COIA 4A4LA 4EHZA 3SXFA 2XK3A 4I1ZA 4Y46A 4GL9A 3GCSA 3GFWA 5CSHA 5BUJA 4RZWA 5KKRC 4JL9A 2ZOQA 1A48A 4O0VA 4YSMA 1IA8A 2IW6A 3F7ZA 3G33A 5I0BA 5A14A 4CFVA 4FEWA 1FQ1B 5G6VA 3BEAA 1OPJA 1PMNA 3TZMA 4EOIA 4F70A 3QQGA 4I0TA 4IFGA 4E7WA 2X7FA 3FZPA 1FPUA 2F2UA 4BKZA 5JGBA 5EI2A 5CSVA 1Q5KA 2QQ7A 4YJVA 3V5LA 5E1EA 2W1EA 4RPVA 3Q4TA 3TI1A 4BKJA 4PMPA 4KKGA 2RL5A 2OJGA 4JT3A 4BY9E 3C13A 2QHNA 2VTQA 3A7FA 3JXWA 4YC8A 4X2JA 1CSNA 3OY3A 4DH5A 4RC3A 1GJOA 3R7IA 3RP9A 2JBOA 5LMKC 2GHGA 3QUPA 3WARA 3LAUA 4TL0A 4F1TA 1OIYA 3EYGA 4I93A 5A4LA 4RIYB 3ORIA 3A61A 3EWHA 4EH6A 4I0SA 1B38A 5DEYA 5HLPA 4EOSA 1P4FA 2V62A 4ZY5A 1NY3A 3HAVA 2WD1A 4N6ZA 5FTGA 2CKEA 2DS1A 3IW4A 3Q4CA 4AXAA 4G16A 4YO6A 3ROCA 3BU3A 3C9WA 4QPMA 2PUIA 4CZUA 1GOLA 2YZAA 3Q32A 2UZNA 4DLJA 1BI8A 4HVDA 2GQSA 4M15A 5LQFA 3Q5ZA 3LQ3A 4HGTA 3TXOA 2H8HA 2YCSA 4RC2A 5C8KA 4HYUA 3TM0A 2W99B 4LL5A 3WZEA 4FI1A 4ALWA 3DBEA 4PL4A 2BZHB 4FZFB 4O6LA 3EKNA 4IX3A 1PXMA 1M14A 2OH0E 4MD7E 2WHBA 1Q97A 4BGHA 1YI4A 2Y6MA 4G6OA 3D94A 4II5A 4AGCA 3JVRA 3NUXA 3R0TA 4PNIA 4FV5A 4P2KA 5J1VA 3DFAA 3PE1A 2A2AA 4FSTA 4NM7A 2UZDA 3C5IA 4FV6A 5IH6A 3IDPA 5CAUA 2VTAA 2X8EA 3SLSA 5IA3A 1H25A 2ZB0A 2UVYA 3G0EA 5FP6A 4EC8A 5AAGA 4U5JA 3BU6A 4EJNA 3BYSA 4AFEA 4I4EA 5AP3A 4WUNA 3VHKA 2GQGA 2W4OA 2WQNA 4YJPA 4FKOA 5EI8A 4KIKA 3L8VA 3QD2B 4FL3A 3W10A 3FLNC 2O5KA 4Y85A 3ZM9A 3F5XA 1M17A 1DAWA 5EW9A 4AN9A 5IDNA 4BN1A 3PSBA 4OAUC 3VIDA 3U87A 5K0KA 2X6EA 1OKWA 3LCKA 3O17A 4Z9LA 4Y73A 3MWUA 3ORKA 4WBBB 3EQHA 4FVQA 3D9VA 5LXMA 4DINA 4MXCA 3CP9A 3MB6A 5ANIA 2CLXA 2W17A 4NW6A 2QG5A 5AJQA 3DQXA 3RKBA 3D14A 3R2BA 3UQCA 4UYNA 4QYYA 1A06A 1SZMA 5DPVA 5AUZA 1JKKA 2R0UA 5LVOA 2JKMA 4DGOA 2BVAA 5KNJA 5ETCA 2YISA 5FDPA 1Q8YA 4G3CA 4WNOA 3TUCA 2QOKA 3W2CA 1MP8A 3AMYA 4FTTA 4CD0A 3UE4A 4XMOA 5EM5A 3LJ2A 4EOPA 4E3CA 3BZ3A 4B6LA 3KK9A 4XRLA 1PYXA 1U5RA 2JDOA 4GT3A 3AT4A 2YDJA 3GCUA 4F6WA 3E63A 2X8IA 4HPTE 2P55A 3PZEA 4UB7A 4WNMA 4GT5A 4C2WA 5CNOA 3PY0A 4DGMA 1PXOA 4XBUA 2GHLA 5CF6A 1YVJA 3LFAA 5E90A 3UP2A 4D1ZA 2QOFA 4OLIA 3ZUVA 4QP3A 2JDRA 3EQGA 4ZAUA 3L9LA 5HNGA 3R02A 2VTHA 2X4FA 5K0XA 5ACKA 1W84A 3QC4A 3PLAE 1B6CB 4KA3A 4QTEA 3P7BA 1Q41A 2I0YA 1OUYA 2VAGA 1CDKA 1ZRZA 3EFLA 4B4LA 2YIYA 3ZUTA 3ORTA 1ZAOA 3MVMA 4MX9A 2R3NA 3CY3A 2LAVA 5HX6A 3FQEA 2R3MA 4M84A 3EQPA 3P4KA 2WPAA 4RJ5A 3ZC6A 1OL6A 3UQGA 5GJFA 4YJRA 4CGAA 4AP7A 4AA4A 3UO4A 4O22A 1Q8WA 5EM6A 5T68A 3HZTA 4LL0A 4FKLA 3UDBA 3RPYA 4WRGA 4CZTA 4OTQA 1YWNA 1XH5A 2WKMA 3R21A 4GUEA 3F6XA 1CKIA 3QKKA 5DMZA 4F6SA 2R3IA 4IFCA 4Y72A 4MWIA 3H4JA 5KMMA 3HV7A 5GHVA 4E5WA 1X8BA 4YZMA 4RJ7A 4I24A 3OW4A 5BUIA 3U54A 4OGRA 4IVBA 4BRXA 3D83A 2C4GA 1SVHA 3AC3A 1LEWA 2VX1A 3HDNA 4R6VA 4BHNA 3QX2A 4FTQA 2WGJA 3BHTA 4O82A 3DS6A 3PYYA 4WG4A 3ZDUA 3QLGA 5E7RA 3S0OA 3ZH8A 5FM3A 1LP4A 3RZBA 4QMQA 3FPMA 4IAIA 4P5QA 3VUMA 2IWIA 2V0DA 3ET7A 3U6JA 3ENHA 2QO2A 1JWHA 1KUTA 3SVVA 5IMEA 3O51A 4BWXA 2ITXA 4GH2A 2WU6A 3OTVA 4U41A 3MB7A 4AZWA 2V22A 5DT4A 4F6UA 4O7RA 2XK4A 1UV5A 2H34A 3EH9A 3MI9A 3MDYA 4QTBA 1H01A 2QO9A 2VWXA 4YR8A 3P7AA 4LGGA 2XKFA 5ETAA 4JBQA 5EHOA 3QA8A 4AW0A 4O7VA 5TKDA 2C6TA 5I5ZA 5EOBA 5HCXA 2QODA 3DZOA 2FGIA 4OTFA 5DT3A 4BC6A 4QYGA 2PWLA 4AN3A 2Y4PA 3KVXA 4EKKA 1CKJA 2XYNA 5LVPA 3KRJA 4ZSEA 2VTOA 3Q53A 4QMNA 3FI8A 3W16A 4L44A 4LYNA 4DTAA 1U4DA 3L1SA 5CU3A 4AG8A 4DH8A 3Q9YA 2C69A 2WEVA 3TNHA 2PVYA 3GU5A 4X21A 3VS4A 4QMTA 4CMOA 4NWMA 5EH0A 4IX6A 3OFMA 3RAHA 3CE3A 3ZRLA 2JEDA 4DTBA 5CLPA 3DPKA 3M1SA 4RLLA 3VS6A 2ZJWA 3E92A 3EQRA 5TOZA 2X2MA 4ZLOA 4FC0A 2P0CA 4RJ4A 4ZIMA 4Y5HA 4E4XA 1FVVA 4FNXA 4PP9A 3ENMA 4FT3A 5E8TA 4ZY4A 4IWPA 2CGWA 3DK3A 1QCFA 2BFXA 1IAHA 1CTPE 2B0QA 4D0XA 1UNLA 3WIKA 2BTSA 2QKWB 2QVSE 5AV1A 4KBAA 4MYGA 5CU6A 4BGGA 4CFFA 4ZS0A 3LIJA 3EN5A 3R8VA 1LUFA 2X0GA 1UA2A 3R9OA 3A8WA 2XNEA 1MQBA 4J99A 3VS5A 4FTOA 1IR3A 3DAKA 3FC2A 3FLSA 4M3QA 4U3YA 4E73A 1YOMA 3QRKA 5KHXA 4MXZA 4O91A 1U46A 2OSCA 2QOOA 3LFNA 4GRBA 4IDVA 5FEDA 2C6EA 2PUUA 3E88A 4IAFA 5GZ9A 4QTCA 3WZUA 4N4SA 4FIEA 4EQCA 3SRVA 4RX9A 4O21A 1RE8A 4USFA 4CEGA 5FM2A 1IASA 3ANRA 5EI6A 4Z16A 3MS9A 5E8SA 2WOTA 4JR3A 4TPTA 2CCHA 3FZRA 2CKPA 4LM5A 2IVUA 4AS0A 4MK0A 4GFMA 4FEVA 4MXAA 3O8PA 3QTWA 3WE8A 2W1CA 4KWPA 5IEYA 2ITOA 4GVAA 4IDTA 2R0IA 4XUFA 2F2CB 4AACA 3HECA 2OJFE 3LKMA 1ZXEA 1OVEA 4EYJA 1VZOA 4YGAA 1RW8A 2R9SA 4FKIA 1O6KA 1H1WA 1P2AA 2VTPA 4AGDA 4IXPA 5IF1A 2WQMA 4Q9SA 5ANGA 5B0XA 2BDFA 4A4XA 4OR5A 4KIKB 2C0IA 3V5JA 5T3QA 2WMXA 3OW3A 1ZYSA 2CPKE 3NW7A 3DNDA 5HD7A 3WI6A 1ZZ2A 3V51A 4AZFA 2ONLA 2QU5A 4RA5A 4N6YA 2SRCA 4LOPA 3TL8A 4BI0A 2QNJA 3H30A 4TY1A 2JDVA 2A19B 2W9FB 3DJ7A 3F7WA 3F69A 3ULZA 1XBCA 4BYJA 4MBLA 2R7BA 2GFSA 2UW0A 3FL4A 4G9RA 5E1SA 4YC3A 2XK8A 5J5TA 4G6LA 1ZOGA 3QZIA 4NZWB 4G3GA 4BCHA 1ZMWA 4EH2A 3C7QA 3NLBA 4O2PA 4QMZA 3TJDA 3ATTA 3JR1A 2W9ZB 5ACBC 4FSMA 3CGOA 2WXVA 5F20A 5AA9A 3FZSA 3OXTA 4BDAA 5JKGA 2I40A 3RK9A 3G5DA 1P5EA 4F1OA 4D58A 4D9TA 3PXRA 3ALNA 2ZMDA 3KRRA 3RNYA 2EVAA 2IVVA 4QMUA 4BYIA 4L3LA 5ETFA 5BVEA 3RNIA 4CYJA 4QQJA 2DWBA 2HOGA 3BYMA 3COMA 4ITJA 4MNEA 5H8BA 3S2PA 3FUPA 4DLIA 2XK7A 4G34A 4PNKA 3N4VA 4WOVA 3EHAA 4Y83A 5DRBA 1OIUA 4Q5HA 2XA4A 3PLSA 4C4GA 4CCBA 1M2RA 3TKIA 2QHMA 3MA3A 2IZRA 5D7VA 3FEGA 2OIBA 3PG1A 2Z60A 4QYEA 3B8QA 4AA0A 4S34A 2JKOA 5A46A 4G3EA 3GU8A 3DNEA 1YXUA 3PDTA 3PA4A 3DDPA 1BYGA 2G1TA 3HL7A 4WRSA 4BI1A 3RPVA 3LCOA 3DCVA 3OXIA 2ETMA 3FKLA 3F2NA 1Y91A 5KX8A 4DC2A 1Q62A 3KEXA 2W05A 4EORA 1GIJA 3R9DA 3BIZA 3F88A 4ZTHA 5KO1A 1YHWA 2BRNA 2PVFA 3KXMA 3POZA 3TG1A 1I44A 3GB2A 4TXCA 4HNFA 3LCTA 4WT6A 5AX9A 3FXZA 2UVZA 3NNUA 4P4CA 5CI6A 1QPJA 3KL8A 4AN2A 4DGNA 5J5SA 3CBLA 2C5NA 4FNYA 3HV4A 4GKHA 5CS6A 2RKUA 4ACDA 4B99A 4P90A 4RQVA 3QCQA 4RVMA 3EL7A 5I9VA 5E9EA 3G0FA 1URCA 5DFPA 4PL5A 1UU7A 1SYKA 1RQQA 2BTRA 4IZ5A 4O27B 5FEQA 3PXQA 3GENA 5DN3A 3NUAA 4ZEGA 5LWMA 4F9CA 3NVKI 4H58A 5EYDA 5JFWA 4QP4A 4QP2A 5C26A 4JI9A 4U42A 4F65A 3OS3A 4XYFA 3FHIA 4YUQA 5HOAA 3G51A 4XV2A 4S2ZA 5CXHA 4F0IA 5AA8A 1GIIA 4DFZE 5KZIA 4MD9E 4YHFA 2W4JA 3AC4A 4CSVA 3L8PA 2ITPA 4CKRA 4MAOA 5L2TA 5TT7A 3R9NA 1URWA 1R1WA 5JK3A 4MNFA 3D5XA 5CTPA 3POOA 3OXZA 5K9IA 4AOIA 4LG4A 4I94A 2YLFA 4JR7A 4GIHA 4H05A 3H10A 4NJDA 3NAYA 3MFTA 3VS3A 1KE7A 5BVNA 4F09A 3FLQA 5IPJA 4OTPA 1FGKA 3W33A 5KUPA 4B7TA 4U0IA 5CAVA 3DB6A 4ZOGA 3NCGA 3W1FA 4QTAA 1XQZA 5LWNA 3KMWA 5DWRA 3ZYAA 3CD8A 3AGMA 2B7AA 3LXLA 4OT5A 4NEUA 2UZBA 4W9WA 5D11A 1VR2A 4D2VA 4TYHB 3AQVA 3KULA 3SA0A 2QOLA 3PA3A 5A4QA 4XG3A 3AC5A 2QLUA 3SOCA 2QKRA 3SQQA 4B9DA 5B2LA 2Y8OA 3IO7A 5IISA 3S3IA 4QMSA 2XKEA 1MRUA 5L2SA 5E8VA 5A4EA 5DI1A 5D10A 5DLSA 3DB8A 4NIFB 5DRDA 2VWIA 3PP1A 3TACA 2BROA 3MFRA 3OVVA 3KU2A 5I9WA 4CV8A 3AGLA 1OKVA 4GFGA 4F7LA 3ZBFA 4GFOA 3DK6A 1WBPA 4HPUE 3FMDA 4Z7HA 1VYZA 5EG3A 2CKOA 1NVQA 5AR3A 5CNNA 2YIXA 2YWPA 2IZSA 3DJ6A 1W8CA 3PJ3A 5F94A 5D41A 4GKIA 2BIKB 2R3JA 2CGXA 3DBQA 5IA5A 2GHMA 2VX3A 4V0GB 3OCGA 4E4NA 5B2MA 4DFUA 5IQEA 3SRVB 4RBLA 4L00A 5A54A 3RVGA 3ZDIA 4FIHA 3R7OA 3SKCA 3VW6A 1JSTA 2XK6A 2B1PA 3NYNA 5IQCA 2VGOA 3QGYA 4U43A 3KN5A 3W8QA 3ZCLA 4CT1A 1ZY5A 4D0WA 4ACHA 3FY2A 2C5OA 4EH5A 3IQ7A 4FUYA 5DNRA 5IUHA 2NO3A 2OIDA 1SMHA 2R2PA 3A7HA 4FSWA 4EH9A 5FTQA 4ZZNA 5JGAA 5FQDC 2WNTA 3CQWA 4AW2A 4EQMA 3RK7A 2VZ6A 2XCHA 5M56A 2QOHA 2BR1A 2UW6A 1M7NA 1YKRA 4EUTA 1G8SA 3F5UA 2WMUA 4GK2A 5HG7A 1SVEA 2UUEA 4PWNA 2I7QA 4D4SA 2XNMA 2CNVA 3GI3A 3LFQA 3W8LA 5HVKA 3D2IA 4ZZMA 2V7AA 4QMWA 2OF4A 2LGCA 3IGOA 2E9NA 4L6QA 4BDJA 2X7OA 3IECA 3O23A 5AR5A 4C4EA 3OCTA 2YIQA 2QOCA 5LCKA 5DR9A 2BRHA 3MYGA 3P0MA 4FG9A 4LUEA 5EDPA 4XHKB 4FKSA 1KE9A 5J8IA 4LV5A 3I7CA 4CFUA 4ONAA 2XEZA 2JD5A 2XKCA 4D4VA 2BZIB 3H9FA 3D2KA 2BZJA 3GCQA 4W4YA 1NT2A 3PVGA 3Q4UA 3OP5A 4GEOA 4KKHA 5A6NA 1OKYA 3CCNA 5L6WL 4DITA 1GZ8A 3TZ9A 4X0MA 4ALUA 5AP7A 4U97A 4Z55A 3KVWA 4LMUA 3TNIA 5EOLA 4BDKA 4EH7A 2BAQA 4NFMA 2ZM4A 4G2FA 3R7YA 4BCKA 1TQIA 3ORPA 4C4JA 3OY1A 3BLQA 3E87A 2QLQA 3I6UA 3M2WA 4GU6A 4J71A 3KF7A 3QYZA 2VV9A 4J98A 4F7JA 4DF3A 5HBHA 4CFMA 3PPZA 5FGKA 2PUNA 3O2MA 4XG6A 2BRGA 2HWPA 4C33A 5JZJA 3REPA 2GQRA 3PVUA 1TQPA 5KKRB 2WO6A 5HTCA 3OZ6A 5J9ZA 4KIOA 2CDZA 4MNEB 4NKSA 4ZTSA 3ZBXA 5L2WA 3BQRA 1QMZA 4CQGA 4ZLYA 1PW2A 4FV0A 3BRBA 3U4UA 4NH1A 2YITA 2XP2A 4FSNA 5M4UA 3GOKA 3W2QA 5KMOA 4E93A 1APME 5H3QA 4IC7A 4CZYB 3AT3A 4IADA 1M2QA 4MCVA 3P08A 4FVRA 2ONLC 2WTJA 1BL7A 3KY2A 5BYZA 3ZEPA 1WBSA 4A9SA 3GCVA 1ND4A 2X39A 4QMLA 3MBLA 3V5QA 3ZU7A 2IVTA 3BHUA 2WTIA 5A4TA 4BCQA 3CJGA 5CY3A 4I92A 5AP6A 1R0PA 2V5QA 4O6EA 4EOQA 3JVSA 2OICA 2VTRA 2J9MA 4TNBA 3UYTA 3P78A 4E26A 1JLUE 1WVWA 2GTMA 2OH4A 5AR2A 4E6AA 4DAWA 3DQWA 2HENA 3B2WA 1XO2B 4RFZA 3SDJA 4C59A 3DJ5A 4YHJA 2XVDA 4IJPA 3K54A 3W2PA 4E8AA 5FXRA 3TV6A 4EHEA 5JZNA 4JQEA 1V0OA 3WZDA 3D7TA 3NNWA 2YWVA 4LI5A 4FKQA 4R78A 1O6YA 1J91A 4I21A 2HIWA 5AP0A 1U59A 1GIHA 2X1NA 3E64A 2C5YA 2C6LA 5HLWA 5CXZA 4K1BA 2C5XA 4LOOA 4RJ6A 5FXQA 5HX8A 3RPRA 2VNWA 5C27A 3ERKA 1H24A 2JDSA 3BWFA 1PKGA 4M12A 1W7HA 3BHVA 2HY81 2PUPA 2FSTX 4G6NA 3VUIA 3RHKA 5CF5A 3HMOA 5IQFA 2UW8A 1VEBA 2WMRA 4AF3A 5I9ZA 2W0JA 3I81A 4GUBA 1ZOEA 4PV0A 4ACGA 4F0GA 4L68A 2X2LA 2Q83A 3M11A 2X7GA 3OOMA 4F9YA 4IX4A 3UOHA 2XF0A 4UWYA 2W1GA 3OMVA 3O8UA 2OXXA 3R22A 2JC6A 3WBLA 4YHTA 4DEGA 5IEVA 5KMKA 4H3BA 4O7TA 3PVWA 1QPEA 4FNWA 3BX5A 5K3YA 3JY0A 3RM6A 1OIQA 2WEIA 3LFCA 3N51A 4WSQA 4W8DA 3OTUA 5AV4A 3NS9A 5AIRA 1G8AA 4D5HA 4ORKA 4A9RA 4EI4A 3IDCA 4IAAA 5HTBA 5BNJA 3WF9A 2ERZE 4QTDA 3U9CA 5I9YA 5L2QA 2XB7A 1MRYA 5M55A 5L8LA 3NYXA 2XK9A 3F9NA 4IBMA 4N57A 3SW7A 4BTJA 1Q8TA 4UZHA 4FUXA 3UIBA 4DTKA 5DHJA 4F7NA 4XX9A 5TO8A 3MFUA 4MQ1A 1BI7A 4X2KA 1JKLA 3FLYA 4K0YA 3UC3A 4ZXTA 4B8LA 3C50A 4MTAA 5DR2A 4YTHA 4WG3A 4YMJA 4F9BA 4O2ZA 5KMLA 2X4ZA 3UP7A 5BVWA 5CAOA 3VUHA 2F7XE 4UX9A 2F7ZE 2VTJA 2KTYA 5CALA 2C3LA 2R3HA 4RSSA 3ORXA 4XCUA 4IB3A 5CVFA 5AUWA 5D1JA 2GU8A 3P23A 5CANA 5M09A 4WSYA 4DBNA 1J7UA 2BRBA 4PPBA 5CX9A 4F9AA 4XOZA 3V3VA 5AFVA 1ZWSA 3OG7A 4X7QA 5CU2A 2ZV2A 3RPOA 4FV2A 3FMNA 3KCFA 3DFCB 1W83A 2NP8A 3Q04A 3HMIA 4HCUA 5GIOE 5AP5A 3NX8A 4FK6A 1Q3DA 4BDHA 4BCJA 1KV1A 1CM8A 1XWSA 4RGJA 3GP0A 4JAJA 4CLJA 5M4CA 2PPQA 4IB0A 4DG2E 1XJDA 4NUSA 3VNTA 5IQDA 3CKXA 4CRLA 3MH3A 1U54B 5FLFA 3TTJA 3TDWA 4CFXA 1JQHA 4P5ZA 2WTKC 4CTCA 4D4RA 3H3CA 4DFLA 4AZEA 3P9JA 4DE4A 2ZM1A 5CF4A 4JDIA 5C4LA 2PVLA 3QQUA 3P86A 4NM0A 5L4QA 3SD0A 4UXQA 5M07A 4U6RA 3IK3A 4HCVA 1YDSE 3JYAA 4HVHA 4I5MA 4GMYA 5EW3A 1FINA 4BCNA 2GS6A 4IWOA 3HNGA 3N4TA 2OBJA 2ZV8A 4FOBA 3CKWA 4PMTA 3GU7A 2XUUA 4FTUA 1OPKA 4IACA 3R9HA 2QU6A 2OXYA 3HGKA 3IS5A 3PY3A 5D12A 4B0GA 4G17A 3NIZA 2IG7A 4F99A 4ZY6A 3OT8A 4V05A 4XBRA 4ZSGA 2JIUA 4FG8A 5HI2A 5GZAA 3ID6C 4RG0A 3ZUUA 4KS8A 5E8YA 3ODYX 4GS6A 5EKOA 5HO7A 2IVSA 3VUGA 4JRNA 5HO6A 4EWHA 4XEYA 4NT4A 2C1AA 4R1YA 5F95A 2E9OA 4PF4A 4FF8A 4AUAA 2GPHA 5HGIA 1DAYA 4A9UA 4BI2A 3SG9A 3AOXA 4Z7GA 5AWMA 5LVLA 3ZS5A 4FT9A 1ZYJA 3S1HA 3FKOA 3QTUA 2XJ0A 5JRSA 1PXLA 2YCFA 3EN7A 2GNGA 3QX4A 3Q52A 5HIDA 1WBNA 4ZJVA 5IA0A 5FP5A 4GG5A 4HGLA 4C34A 5KMNA 1SNUA 4DFNA 2P3GX 4FZAB 4E5BA 2JITA 3OCBA 1MQ4A 4PDSA 1K3AA 3R04A 3MPMA 3ROYA 3BU5A 4WUAA 4OBPA 2W5HA 4IB5A 4QP1A 1R39A 5C9CA 4GVJA 2J0KA 2HXLA 4MWHA 1H26A 3OWKA 3BQCA 2OK1A 4O0RA 4R7IA 5AUTA 1XBBA 4RLKA 5L3AA 3LJ0A 4LRKA 5LCJA 4E4LA 2HELA 3GC0A 2RF9A 4ERWA 3IW8A 3AD6A 4ZTQA 4KUJA 4ZP5A 4LQMA 4O0YA 3HRCA 3QXPA 3WF6A 3UZTA 1Q8ZA 4C61A 1H08A 2YEXA 3SAYA 5FD2A 1W82A 1QPDA 3ALOA 5M4IA 3BKBA 3Q3BA 2X9EA 3F66A 2ITVA 2PTKA 3KGAA 4ZSJA 5E4HA 4KSQA 3FMEA 3OC1A 1KE5A 4YJTA 2OG8A 4MKCA 3D15A
chains in the Genus database with same CATH superfamily
2PL0A 3RHXA 2JIVA 5I9UA 3CPCA 2PVHA 4BFMA 3RAIA 3DAJA 4RFYA 3N9XA 4X3FC 3PXZA 3D7TB 1XH6A 3L9PA 3VRYA 3EFJA 4FYOA 5DVRA 4ZJJA 3TN8A 4AW5A 2UW4A 4QNAA 5EQYA 1YRPA 2H96A 4UALA 4IAZA 2JIIA 4IZYA 5BUEA 5IA1A 3QUDA 3D5WA 4D2WA 2G2FA 3QRTA 4AQCA 2OGVA 5CI7A 2UZLA 4HGSA 4BJJB 3Q6WA 2PVMA 4XJ0A 2Q0NA 3F61A 2B9FA 1H1QA 4YPSA 3U8WA 2HZ0A 3UG1A 3KXXA 3KC3A 4FL1A 5DE2A 4AFJA 2F9GA 4JIAA 4JG7A 2PSQA 5HHWA 2VRXA 4ARKA 3ITZA 4DHJA 3F2RA 4PDOA 2BRMA 4FX3A 3LLAA 3RBWA 2X0OA 5CAPA 2WMWA 2ETRA 4BF2A 4FL2A 5CU0A 4L45A 4TN6A 5GNKA 2XIRA 4IE9A 3SW4A 1BUHA 5A4CA 3OWPA 2G2HA 3G6HA 2OU7A 3UVRA 5CEQA 2JKQA 1NVRA 4YPDA 4MXOA 5IKWA 2C3JA 4BDIA 4USDA 5B7VA 5C1QB 1Z9XA 3E5AA 3SXSA 4IM3A 3LXNA 4J8MA 4QPSA 3UZPA 3VQUA 5K4IA 4FT0A 4L3PA 4LUDA 4M68A 2W1HA 3DKFA 4RJ8A 4BWPA 2A98A 4TZRA 5C4KA 1W0XC 3IONA 4O0SA 4DH1A 3G15A 3KN6A 3S00A 2XMYA 3HMMA 3ZO2A 1GNGA 4Q2AA 4OTHA 4WG5A 4M7IA 2YHVA 4YZBA 4EH8A 1MRVA 2VO3A 3AC8A 3GU4A 3BV2A 1S9JA 3QQHA 5EDQA 2R3QA 3DOGA 5J9LA 3FC1X 3MVLA 4NCTA 4YO4A 3OROA 3ML1A 4CQEA 4L46A 1W2CA 4UZDA 4RA4A 3FWQA 3K5VA 3W18A 2G01A 4BB4A 4IAYA 3NWWA 4KIPA 3GNIB 3G90X 1H28A 1W2DA 3EQCA 3FYJX 3IG7A 5AP1A 5HG5A 5BQ0A 4DA5A 1SVGA 2HW7A 3A62A 3E7VA 3I1AA 4HYHA 4YJNA 1V0PA 4NTTA 1M52A 3LFEA 1KE6A 5AMNA 1PXNA 3GCPA 4PMMA 3NEWA 4QMXA 5AR8A 5A3XA 3CLYA 4U44A 4YJQA 3NSZA 3PFQA 4A07A 5JFSA 3LM0A 3HV6A 3MY5A 1OL5A 4FYNA 2BPMA 4MF1A 3PUPA 4EJ7A 3D5VA 3OWJA 4FV7A 3V04A 4WO5A 2GDOA 2FSOX 3ETAA 3HRBA 5DT0A 5A6OA 2ITWA 4D5KA 2GNIA 4JIKA 3I6WA 4JBVA 2V55A 4XP0A 4PL3A 4CFWA 4XRJA 3I5ZA 3II5A 3HRFA 3BYOA 4Y8DA 4JRVA 3BGZA 4DCEA 2HCKA 3GFEA 3HP5A 3IW6A 3PPKA 2YDKA 4XH6A 4IWDA 2VTMA 2CNQA 4IVAA 3QTZA 3U9NA 3COKA 4U45A 2VO6A 5F1ZA 4C7TA 4DCAA 4M8TA 3R8MA 2CSNA 3PRIA 5AIKA 1O9UA 1V1KA 3UDSA 3HP2A 3UOKA 5LJJA 3CGFA 3R71A 4O7NA 4IH8A 3PG3A 3ZRKA 3K3IA 4C2VA 3LVPA 3OBGA 2BCJA 2XJ1A 3PP0A 4NJ3A 1F5QA 5DIAA 2X2KA 4ANQA 4OAVB 3PJ8A 1TFFA 3PSDA 4FSYA 3QXOA 4AOTA 5CF8A 5HVYA 4IQ6A 3COHA 5J95A 3HKOA 4MF0A 3WYXA 4UN0C 3FY0A 1QL6A 3O0GA 4MXXA 1Y8YA 3RTPA 3GU6A 2CKQA 3LCSA 4YNEA 2PMIA 4U3ZA 1ZYLA 4FTKA 1H27A 1JSVA 4L8MA 2IF8A 3NUNA 2XH5A 3WF8A 4AGUA 1NA7A 3EN4A 5FTOA 3ZSHA 3UGCA 4BBFA 3A7IA 4ENYA 1PKDA 4G5PA 2XRUA 4XNEA 2YERA 5HQ0A 3TTIA 3QCYA 4IVDA 4QP9A 1JVPP 1H07A 2BKZA 4BIBA 3F3ZA 3IW7A 4F63A 3RK5A 4M69A 5HZNA 2PY3A 3QYWA 4QD6A 3QQLA 2W1DA 3BHYA 2BMCA 3CY2A 4RX8A 4FVPA 4RZVA 4ZLZA 4YC6A 1PF8A 4QDEA 1RJBA 3F3TA 3LZBA 5K5XA 5GINE 3FQHA 3LXPA 3WYYA 3BELA 2BIYA 4O38A 4UWBA 2VTIA 3EQFA 4DDGA 3KXZA 5EK7A 3QA0A 4QYFA 5CAQA 4JOAA 1YQJA 5KMIA 1CMKE 3C1XA 2FB8A 3RALA 4FMQA 2FSLX 3MVHA 4WA9A 2OWBA 1OL2A 2OJ9A 4LRMA 3ZOSA 2FA2A 3DBCA 1OBDA 1PRYA 3I0OA 4ANOA 4OTRA 4FTLA 3AD4A 2HW6A 3CEKA 1AGWA 1CKPA 1OZ1A 3FMHA 4XOYA 5IZFA 3PUFC 2XKDA 5IQBA 1OPLA 4BZDA 3UPZA 4MH7A 4FZ6A 2GNJA 3FPQA 3OBJA 3E8NA 2J51A 3QUEA 5HE3A 5HE2A 3MVJA 2C6IA 3A4OX 4TYJA 4YZ9A 5AM7A 3VBVA 3FXWA 3FYKX 1VJYA 2O2UA 4C37A 5JT2A 3VO3A 3VJNA 1M2PA 3JUHA 3LXKA 3R00A 5C8MA 2EU9A 2WQEA 2WAJA 3Q9XA 3G6GA 3NW5A 5D9HA 5HNIX 1JPAA 1UWJA 2YAAA 4ANLA 5HCZA 2FH9A 3D4QA 3DV3A 1PMUA 3NNXA 1Z5MA 2F7EE 5E8WA 3WOWA 5EYMA 4Y5QA 3R7VA 2QD9A 3AT2A 3ZXTA 3CS9A 4I6HA 3TV4A 5A9UA 5FBOA 3E8EA 3F82A 4EKLA 3QRJA 2A4LA 2W1IA 3ZZEA 4KRCA 2X8DA 1Q99A 2BUJA 2ITNA 4M97A 3C5UA 3RINA 1UKIA 1WCCA 4ENXA 3EQDA 4I22A 1ZARA 5L8JA 3C0HA 4C57A 4NU1A 3VRZA 1NW1A 2QR7A 2XNOA 4QQCA 5HKMA 1OKZA 3BYVA 3R8LA 4R8QA 2OF2A 4DHFA 5L6PA 3PTGA 3VBQA 3DZQA 3ZFYA 4YBJA 4Z3VA 4CTBA 4BKYA 5K5NA 3MW1A 2UZWE 3AMAA 4O81A 1BX6A 5ANJA 3NNVA 2ZMCA 2AC3A 2XIZA 4C38A 3K3JA 4YTCA 4V04A 4EEVA 2R4BA 4EC9A 4K33A 4E6DA 1I09A 3VW8A 1H1PA 1GZNA 4K9YA 4FR4A 4QP6A 4OUCA 4RFMA 3UODA 2IPXA 3QTQA 3HMNA 3VS2A 4YZNA 2WTVA 3TUDA 4RIYA 1OI9A 4QOXA 3IOPA 2JBPA 5HU9A 1SM2A 4FICA 3QD3A 2Z7LA 2R64A 3FZTA 4FV9A 3VS7A 2ZAZA 3MPAA 5DGZA 2VTTA 3KF4A 4CMUA 2OIQA 3A2CA 5CEKA 3ZHPC 2I0HA 2OZAA 3MA6A 4PTEA 5KHWA 3V6SA 1F3MC 4JVGA 4BDEA 1JKTA 3L8SA 4J53A 2VTNA 3V5WA 2XNBA 3F2AA 1G3NA 5EFQA 3KA0A 4G9CA 3U55A 5BVFA 4LFIA 4A4OA 1XH4A 4JX7A 3PJ1A 3LLTA 3RAWA 4AU8A 2UW3A 4FBXA 4GW8A 2OFUA 5CENA 3ZLSA 3VC4A 2NRUA 3QFVA 3ZRMA 3LFSA 2CLQA 4QMMA 2F4JA 4C35A 5BYYA 2BKKA 5M4FA 3QLFA 4FV3A 3VS0A 4QMOA 3TNPC 4AOJA 3S95A 3TDVA 1REKA 4FK3A 4RVTA 4JQ7A 2PYWA 4D1XA 4ITHA 4JNWA 4GIIA 3L9MA 4IANA 1WBTA 1WVYA 4YLJA 5IQAA 5FXSA 4ZK5A 3T3UA 4L3JA 3GT8A 3GQLA 4E20A 3BEGA 1E1XA 3WIGA 3R1SA 4UYAA 5H9BA 2Y0AA 2HAKA 2W5AA 3LQ8A 5AP2A 4AX8A 3UIMA 2A0CX 1KV2A 4FKGA 4D2PA 4J52A 4FKUA 4LDTA 1IG1A 1Y57A 2UW5A 3SG8A 3NUYA 2PZPA 4D1SA 2YN8A 4JJRA 4OT6A 4U40A 4FGBA 3NMUF 1BMKA 4NCTC 4CXAA 3E8CA 2G15A 4JAIA 2UZVA 3E62A 3S4QA 3Q9ZA 4EK3A 1BLXA 2VN9A 4G1WA 1XH7A 3HLLA 4IHPA 2O3PA 4OTDA 2G2IA 4A9TA 4EBWA 3A7GA 3LW0A 4GT4A 3PXFA 3UG2A 5FWKK 4BZOA 4R1VA 2CN8A 1YHVA 2IJMA 2P4IA 1OL7A 4JBPA 3FDNA 5EYKA 3V01A 3QF9A 1O6LA 4EWQA 4I5PA 3ODZX 4GK4A 4ZSLA 3QHWA 4HW7A 3NYOA 1IA9A 2E9VA 4X3FA 1FMOE 1TVOA 2J90A 4UMPA 2QOIA 5AAEA 3HA8A 4FZDB 4MEDA 1PXPA 1PHKA 4IB1A 2XANA 4WNPA 4EONA 3RWPA 5BYLA 3VBXA 4O7SA 3Q5IA 3T8OA 4BDDA 1YI6A 3TKHA 4QQ5A 1UU3A 3P5KA 2EXMA 1LR4A 1GZKA 3DKGA 3EOCA 2OKRA 4KBKA 4DEHA 1TZDA 2AYPA 3IOKA 4DFXE 3AD5A 1W2FA 2PHKA 4XLIA 2NNWB 4ANNA 3VF8A 5HG9A 5IH4A 4IMYA 3FI2A 4KRDA 3QKLA 2Y4IC 1R3CA 2B52A 4R5YA 2J0LA 3FMLA 4J96A 1H00A 2WOUA 2P2IA 4M69B 4RX7A 4CNHA 2Z02A 3UJGA 1XH8A 3FSKA 3VJOA 5LOHA 3QZGA 4FEUA 3BGQA 3EB0A 1JSUA 5DEWA 5GIPE 5KCVA 3GUBA 3TJCA 5G1XA 2EB2A 4Y95A 5E8XA 3KXHA 3DDQA 3R6XA 4OBQA 4HCTA 5TR6A 3MH0A 3QGWA 3RZFA 3V5PA 4MQ2A 4BDGA 4BTFA 5JQ8A 4DEBA 3GGFA 5IH5A 1TQMA 2UV2A 2YCQA 3FMKA 3KXNA 2CJMA 3PJCA 4Q5EA 4ACMA 2RFSA 3DA6A 2IN6A 5F4NA 1P4OA 3R9RA 1G5SA 1H0VA 4J95A 4TWPA 3MY1A 4ERKA 2C3KA 4U8ZA 3NAXA 4CYIA 4EK4A 3CTJA 4GYGA 3O7LD 3T9TA 4L01A 1FOTA 3FE3A 4I5HA 3PSCA 2J0JA 4HJOA 3DBFA 2X81A 4QP8A 4IWQA 5EYCA 4PDPA 3MGYA 5EDRA 1YWRA 3B2TA 4TTHB 3MV5A 4DH7A 3DXPA 1JBPE 3R1YA 3MTLA 4K18A 3SOAA 4EL9A 3MJ2A 5CT7A 3DGKA 4D28A 2J4ZA 4D2TA 5KMJA 3BL7A 4FZ7A 3HDMA 3LE6A 1F0QA 5CEIA 1P14A 3C4WA 4F9WA 3R1NA 1OITA 4JG6A 2HXQA 4NM3A 2C6OA 3NUPA 4X2NA 2GNFA 2DYLA 4GJ2A 2J2IB 3UVQA 4BCFA 2QONA 4QRCA 3ATSA 2GNLA 4PRJA 1BL6A 4J1RA 3NRMA 2J5EA 4ZTLA 4CFNA 2E9PA 4XG8A 3BLAA 2VWWA 3K2LA 3A7JA 4FEQA 4KIQA 1XR1A 3HYHA 2IZUA 2ZDTA 2WZJA 1MUOA 3TZ7A 1OM1A 3HX4A 3MH1A 2RIOA 4BDCA 4AA5A 4FTJA 3MFSA 5HG8A 4RX5A 3CC6A 1YOJA 4BCGA 1IAJA 3AKKA 4YJSA 4CKJA 2WMQA 4R7HA 4DG3E 1KOAA 3G9LX 3PRFA 1YXSA 3R7GA 2Y7JA 4NKAA 5IG1A 2QO7A 4OTGA 2PU8A 4XG2A 3G9NA 1ZYDA 4DN5A 3BWJA 3KULB 4DGLC 2OW3A 3CQUA 3O50A 3UIUA 4FV4A 2BDJA 3I5NA 2WTKB 3EQBA 5I3OA 4BWKA 3E8DA 3CXWA 3NCZA 3WZJA 1WBVA 5HE0A 3QALE 5AAFA 4O4FA 4N70A 1ERKA 2UW9A 4FIIA 4RIXA 3FQSA 4UMRA 2ZYBA 4HOKA 2EUFB 4EH4A 2O63A 3EIDA 2Y6OA 5TE0A 3P7CA 3EQIA 3C4XA 4EOKA 3ZO1A 2RFNA 3DLSA 2JAMA 3LMGA 5CEMA 2B9JA 3LFBA 2VTSA 5IUIA 2YABA 4O96A 2YIRA 3DK7A 2OZAB 3H0ZA 5CYIA 4BIEA 4RVLA 2FO0A 1YOLA 4FEXA 3G2FA 4FTMA 4C02A 4C4HA 2F49A 1YWVA 3OWLA 1JAMA 1XMLA 3UNJA 5M57A 4TWOA 4AWIA 3FSFA 2QCSA 3CQEA 2BFYA 4PUZA 3GEQA 4U80A 4XV9A 5JMSA 3E7OA 5KBRA 3FZ1A 4L43A 5HIBA 4ANBA 4F0FA 3JY9A 4XLVA 4MHAA 1U5QA 1ZOHA 2GS2A 5FBNC 2NRYA 2UVXA 4EHVA 4GV1A 5C8NA 3TNWA 5L6OA 4O1PA 2HZ4A 3D0EA 3O96A 4FTAA 5ANOA 2VWBA 4DHZA 1YI3A 1Q8UA 3F5PA 5LARA 4H39A 1PXJA 3QD4A 4I3ZA 4K11A 4O7YA 4H3PA 5FDXA 3FL5A 3KREA 2W96B 2PZ5A 4XV3A 4ANSA 2FUMA 2A27A 2X6DA 3Q4ZA 4W4VA 4KKEA 2P33A 3B8RA 4JS8A 4AT3A 4I6BA 2ETKA 5L2IA 1FBNA 4IIRA 3NZ0A 4RMZA 2XIXA 4FOCA 4BCMA 5DA3A 2ITYA 4FRFA 2O65A 2XNPA 2XZSA 2ZV7A 4M14A 5AUVA 5AV0A 3GC8A 3ZLYA 4GYIA 4FE2A 4YNOA 5J9YA 3DTWA 3QHRA 1L8TA 2OI4X 1H1SA 2PZYA 4ASZA 3HUCA 3NIEA 4ZJIA 2ITQA 5AR4A 3W55A 1IEPA 1J7LA 2DQ7X 4ZTRA 1TKIA 5AUXA 4Q9ZA 3QWJA 4XS2A 5DG5A 3ZEWA 1PY5A 3ORZA 3BE9A 2VX0A 2WQBA 3UPXA 5AR7A 3W0OA 2QOBA 4XG7A 2JAVA 1Q61A 4KAOA 2RFEA 2C5VA 3ACKA 5M08A 2WMSA 3UMWA 4HVIA 2PVJA 2ZM3A 4UV0A 4FSZA 2BILB 2E2BA 4N0SA 5HU3A 3MH2A 4BBMA 4AW1A 3KMUA 3OCSA 1GZOA 4CT2A 1E9HA 3IW5A 5F9EA 1M7QA 2BHEA 1LPUA 3BE2A 3I79A 4X3FB 4O0TA 4QT1A 3V8WA 4QNYA 3Q60A 3LMIA 2ITTA 5J7BA 3QRUA 3NR9A 1HOWA 4RWLA 3UYSA 4APPA 4YURA 5CZHA 5HO8A 4CMTA 4E6QA 1YXVA 4RT7A 4UWCA 5IA4A 2R3OA 4UY9A 3ZFMA 4KS7A 4FKTA 5BPYA 4NL0A 4FKPA 2VO7A 5HEZA 2WB8A 4EOLA 3I4BA 1WVXA 4H36A 4TT7A 2BZKB 2QURA 4S32A 3NDMA 4FT5A 4BR3A 1J1CA 5HBEA 3H9OA 3AC1A 3OUKA 3MTFA 2QI8A 5JH6A 5HICA 4DEDA 2PVKA 3GOPA 4IVCA 1OGUA 1YDTE 3QRIA 4LGHA 2C30A 2C47A 2WMBA 1JOWB 3BLHA 3I60A 4KINA 3DTCA 2YM4A 3O7LB 3SC1A 4C0TA 4DH3A 4EBVA 4HVGA 3TKUA 3Q9WA 3GVUA 1PXIA 4FG7A 4QMVA 4TRLA 5KE0A 3KK8A 4O0UA 3W2OA 5I3RA 3V6RA 4FV1A 4EK5A 4D2SA 1V0BA 3CR0A 1KE8A 5AM6A 1WFCA 4I23A 4G3FA 5EM8A 4ZS4A 3EYHA 5IEXA 4G3DA 3KFAA 5ANKA 3E3BX 2WQOA 4PQNA 2VWYA 1UKHA 4L7SA 1PMVA 3WZKA 3PIYA 4LV8A 4O83A 3MIAA 2OFVA 4W9XA 4CCUA 1UU9A 3ORMA 4UBAA 3UNZA 3A8XA 1GY3A 2IZTA 4JDKA 4W4XA 5HTIA 4KD1A 4GK3A 2JGZA 2YM5A 5EW8A 1T46A 2J7TA 3L8XA 3ZZWA 1A9UA 3GXLA 4ID7A 2W5BA 3FMMA 4O0WA 5EQPA 4QYHA 3EKKA 2R3LA 2R3RA 4AAYA 1DM2A 3EZRA 4H1MA 2JDTA 4TKSA 3KKVA 3FHRA 4V01A 5B2KA 3V5TA 2BALA 4F78A 4KABA 2XS0A 4C3FA 4AE6A 4FKVA 4ASXA 4IW0A 4EK8A 1ZYCA 3PWDA 4HZSA 4IZAA 3TZ8A 3QU0A 2CGVA 2I6LA 4H3QA 4WBOA 5H8GA 3VHEA 3U6HA 3QWKA 1G8KA 4RC4A 2VGPA 4O84A 3CPBA 4DG0E 4C3RA 2VNYA 5E8UA 3R83A 3DY7A 3ZXZA 4C8BA 3GC7A 3MY0A 4X6QC 2AC5A 4ZZOA 4A06A 3GC9A 2ZB1A 5HCYA 5J7HA 4BDBA 4HYIA 3EN6A 3KQ7A 4H1JA 1OL1A 2C6DA 5I9XA 2W06A 4QMYA 1K2PA 3EFKA 4RRVA 2UZEA 5JFXA 2FVDA 4YBKA 3SX9A 3Q96A 2YM6A 3I7BA 3VWAA 3HEGA 3UOLA 3W0PA 1RDQE 3A99A 3C4FA 4IZ7A 4MD8E 2YM8A 3ZM4A 1WBWA 2PK9A 2PMNX 3UOJA 3HAMA 4AT4A 5AP4A 3PIZA 4DEAA 2OLCA 3QCSA 1PYEA 2FYSA 3LPBA 5CEOA 1H4LA 3VS1A 3QCXA 5JSMA 3IPHA 4DEEA 5CSXA 1QPCA 2G9XA 3VN9A 4EH3A 4O7WA 1B39A 4AE9A 4TYHA 4ZTMA 5IQHA 5DYJA 5H2UA 4BCIA 4RIXB 5JGDA 3TWJA 5K4JA 1STCE 3KRXA 5C01A 1YXXA 3E93A 5CEPA 4CG8A 4QO9A 4YLLA 3E3PA 4ZMFA 2YFXA 2VWVA 1FGIA 5AX3A 5LMAA 1NVSA 3O71A 4FKJA 3TCPA 3PWYA 3Q2MA 4NIFA 3GBZA 1VLRA 1Z57A 4X6RA 3NFFB 3BV3A 4AZVA 2YACA 3H9RA 4BTMA 5CVGA 2YM3A 3KMMA 3A60A 4R3CA 3RWQA 4TWNA 2HZNA 3NYVA 4O4EA 5DR6A 3RCJA 4BHZA 2HK5A 1OIRA 2X9FA 3A4PA 1UWHA 3UVPA 3ZLXA 4E5AX 3OOGA 4R77A 2ZDUA 3D7ZA 2PVNA 5CSWA 3VUKA 5EHLA 4RVKA 1LEZA 2C3IB 2UW7A 3F3VA 4HNIA 5CZIA 5AUYA 4XV1A 3W32A 4GG7A 3C4EA 4B8MA 4V0GA 4EUUA 2IW8A 2BDWA 4FIFA 3FMJA 3LFFA 3OEFX 4O4CA 4XG9A 4ACCA 2QG7A 4RIOA 4WNKA 3RMFA 3NUSA 5ICPA 2KULA 4YLKA 2IW9A 4F08A 4CLIA 3KB7A 2XRWA 2EXEA 1FVRA 1FVTA 2CMWA 3PVBA 4FIJA 2YZLA 4L53A 3F5GA 3T3VA 4CRSA 4CG9A 4NTSA 4MVFA 2ACXA 1R78A 4G31A 4EK6A 3QQKA 4I6QA 4JBOA 4AZSA 4EYMA 5HORA 3MESA 1REJA 2VTLA 4FGRA 2X0QA 3FI3A 2XEYA 4KBCA 2XIKA 2EB3A 3U4WA 1Q3WA 1VYWA 3M42A 4EZ5A 2B9IA 4JDHA 1PXKA 4RWJA 3VAPA 3DXNA 4NW5A 3EL8A 4I20A 5JEBA 4L7FA 2REIA 3R01A 1DI9A 5JFVA 4FNZA 1Q24A 2Q0BA 2BAKA 3FV8A 3ZONA 4O7LA 5GJGA 3FZOA 4UMQA 5CSPA 3BLRA 5LMBA 1UNGA 3NPCA 3CJFA 5AEPA 4FV8A 1DI8A 2Z7QA 4EZ7A 2GMXA 2J6MA 1IRKA 2RG5A 3L9NA 2UZTA 3OF0A 2YCRA 3TUBA 3IKAA 4AXEA 2VWZA 2GTNA 2XBAA 2H6DA 3SXRA 5LVNA 4I5CA 1NXKA 4U81A 3DXQA 4PPCA 3ZC5A 4F1MA 4EOMA 5KBQA 4BDFA 3V8SA 3OD6X 2BAJA 1JNKA 2ITUA 5BVOA 3DAEA 4AZTA 1XKKA 2R3KA 3W0NA 2PZIA 3BHHA 4LMNA 5HE1A 4PDYA 3V8TA 3KRLA 3CTHA 1WMKA 4I0RA 5CWZA 2XBJA 2CGUA 2EWAA 1ATPE 2XNNA 2C0OA 3RI1A 3R8PA 1PJKA 2GCDA 4IM2A 4DBXA 4GU9A 4C58A 3DLZA 3MJ1A 3OHTA 4ITIA 5AV3A 4FKWA 3RCDA 3T9IA 3UC4A 3UIXA 4I6LA 3TIYA 3R2YA 2JFLA 3VQHA 2QOQA 2WIPA 1GAGA 5EHYA 1FMKA 4KSPA 4RIWA 5HVJA 4EOOA 5AV2A 4YZDA 5E91A 5BVDA 3BCEA 4M0ZA 1YHSA 4XG4A 4PP7A 4D9UA 3TNQB 3KRWA 3RM7A 2ZVAA 3ZSGA 2WIHA 4ANMA 4R3RA 1UNHA 2B54A 4MBIA 2B53A 2YJRA 3BYUA 5ANDA 2WMTA 2XIYA 4HZRA 1XHAA 3CTQA 4ASDA 3VBWA 3PA5A 4IX5A 4L52A 4RJ3A 1OMWA 1HCLA 4FSQA 4BZNA 3FJQE 4PX6A 2PE2A 4F7SA 4OW8A 3CIKA 3PXKA 3UTOA 4NK9A 2XM8A 3VVHA 1H0WA 2CCIA 4U79A 3FAAA 2WTCA 3HVCA 3AXWA 3NW6A 3P1AA 4D55A 4E6CA 4EZ3A 4YSJA 2CNUA 3P5JC 1Y6BA 1OECA 5JN2A 5LMKA 4OTWA 5CT0A 4YP8A 4NSTA 3ZMMA 1ST0A 4I4FA 2OO8X 4LRJA 4WD5A 4DDIA 1AD5A 4UEUA 3FLZA 2YDIA 4KB8A 5CQWA 4D4YA 3BPRA 1S9IA 3ZO4A 2UZUE 2YIWA 3LMHA 5CU4A 4M67A 4FT7A 4IAKA 4DT8A 5BMSA 2J0IA 1Q4LA 4HYSA 4YJUA 4BTKA 2R7IA 2YAKA 5M44A 3FKNA 5BX0A 1EH4A 3AG9A 4X2FA 4GSBA 5M06A 2O64A 1YDRE 4AQKA 5TF9A 3UDZA 3DKCA 1BKXA 2PZRA 2E9UA 4IM0A 4BCPA 3I0QA 3EN9A 4O86A 3OUNB 2PULA 3R8UA 2J0MB 2B55A 3ZO3A 2QR8A 5IU2A 4P7EA 5FEEA 1OBGA 3GQIA 4X2GA 3UO5A 3LHJA 5DBXA 2W1FA 1UU8A 3DU8A 4PMSA 3PIXA 1L3RE 2GS7A 2VU3A 2OZOA 5C03A 4L42A 3RPSA 2OJIA 2RFDA 2F57A 3ORNA 4APCA 4K77A 3ZFXA 5IDPA 2O8YA 4HVSA 1W98A 4FTNA 4IJ9A 1J3HA 2C0TA 3W2SA 5IA2A 2DUVA 2HZIA 3FXXA 3LOKA 1R0EA 4JG8A 4LGDA 4PTGA 3H0YA 4XP3A 4AT5A 2XCKA 4EOJA 5ITAA 4C3PA 5BV3A 2GFCA 4M13A 2R3GA 4R7BA 4C4FA 3K5UA 4RQKA 4C36A 3ELJA 4C4IA 5GJDA 3EMGA 4USEA 4M66A 1XMMA 5FUTA 5EQEA 2RGPA 3OEZA 2PVRA 4K2RA 3FBVA 5KZ0A 3BGPA 3R7UA 2HY0A 4BGQA 4TWCA 4E1ZA 3R63A 4GJ3A 3QQJA 3Q6UA 4BICA 4DEIA 3QTXA 4TYGA 4ASEA 4L67A 3OT3A 3TV7A 2XJ2A 3LFDA 2W4KA 3D5UA 2GSFA 4A9YA 4WHZA 4CV9A 3AC2A 4MUQA 4O7ZA 4K6ZA 3IGGA 4DT9A 5FRIA 1J1BA 3TT0A 2C1BA 1UVRA 4S30A 3QTIA 4D2RA 4YTFA 3QD0A 4ZSAA 4CKIA 2W7XA 4QEBA 3RGFA 3LQ5A 2YLEA 3ACJA 4DFYA 5I4NA 3LCDA 4EQUA 3QAME 4FODA 1T45A 5HBJA 2WTWA 5D7AA 4BVUA 3NGAA 2WU7A 4WIHA 4FTIA 3C0GA 5JRQA 3QL8A 2Z7RA 1XH9A 4FSUA 5EKNA 3O8TA 5H8EA 5IUGA 2X0PA 4QP7A 4ALVA 5FG8A 3N4UA 3VF9A 4W8EA 2R3PA 4RWIA 5L8KA 2I1MA 3EFWA 2O0UA 1J7IA 3R7EA 1OB3A 3QBNA 2VUWA 3KCKA 3MN3A 2H9VA 4A7CA 2AUHA 4J7BA 2PMLX 4HGEA 3FI4A 3R73A 3MSSA 3U6IA 1YW2A 2HWOA 2VWUA 2PMOX 3MPTA 5AUUA 3P79A 4IC8A 4UXLA 3NUUA 4S33A 3KXGA 3QTRA 4TW9A 4AGWA 3QZFA 4YJOA 1XBAA 2WMVA 3BI6A 2ZV9A 3ANQA 3VULA 1WAKA 2Y4IB 2P2HA 5HESA 4AAAA 3R28A 3UNKA 3UQFA 3THBA 4C62A 2B9HA 1AQ1A 4IEBA 4QQTA 2R3FA 4NFNA 3PY1A 1G8JA 4NYEA 3HMPA 2BHHA 5J79A 3SGCA 5LVMA 2XNGA 1U54A 1WBOA 2PE1A