4GJ2A

Tyk2 (jh1) in complex with 2,6-dichloro-n-[2-({[(1r,2r)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 288
sequence length 288
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gj2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gj2A01
4DFZE 3CXWA 2R3QA 4FKJA 2I0VA 4RQVA 3FI3A 3O8UA 2VX1A 5M55A 3TNQB 4FI1A 4U5JA 5AUWA 4R3PA 5DR9A 5LMKA 2C5YA 1PXIA 1URCA 3VNTA 5AUTA 1WBSA 3ORPA 4EOJA 4ZTQA 4XP3A 3FZOA 2J0JA 4CRLA 3QRIA 1F5QA 1SNUA 2FSLX 2O65A 2XM8A 4TYJA 4YZMA 4RZWA 2BR1A 2QO9A 2UW9A 5EFQA 5IQGA 1YDTE 5HO8A 3TV6A 4OTGA 3UC3A 4O7SA 2GTNA 2CLQA 2CNQA 4NL0A 3HMOA 2VTOA 1YXXA 3MS9A 3RK5A 4I5PA 4YNEA 2QOCA 4R78A 3FL5A 3PLAE 3ZSGA 4BTKA 4DG3E 3A7IA 4BCGA 4Z7GA 4WG3A 5AUZA 1U46A 2C3JA 4C57A 3H9OA 5CSVA 5ANEA 5EI2A 4GEOA 2AUHA 3TZ9A 5HTIA 4UV0A 3ALNA 4XG3A 2XKCA 2BVAA 1QPCA 3KEXA 4RA5A 2UVXA 2ETKA 4G3FA 4BDEA 3MJ1A 4JAJA 4DG0E 4YLLA 3EQBA 4ZSEA 4ZY6A 4JVGA 3WIGA 4C2VA 5JT2A 3IOPA 3L9MA 4D2TA 3HVCA 1YWRA 2X2MA 4KAOA 4BI0A 4Z7HA 5J7BA 4FTJA 2OH4A 3DLSA 4H36A 4CQGA 5L8JA 3SAYA 5EDRA 2BPMA 3RM7A 5CF6A 1IEPA 5AX3A 3ZSIA 2REIA 2XA4A 4BWXA 3FV8A 5A6OA 4QYEA 3TUBA 5FP6A 1DAYA 2VZ6A 3R7UA 3W2OA 4G34A 5CEOA 4ORKA 2WB8A 1H0WA 5C27A 4CSVA 1FMOE 3NNWA 1M2QA 2YAAA 4HYSA 4YLJA 2ITWA 5M07A 4ZTNA 4LUEA 2BFXA 4BDBA 4OTRA 3NDMA 1OBDA 3D0EA 4DTBA 3F6XA 4I0TA 4FSYA 4FMQA 2ZV8A 2F2UA 3WOWA 3U6HA 4ZTMA 5CNNA 4O1OA 3Q96A 4IDTA 3LE6A 3VQHA 2GNGA 3FMNA 5HO7A 1V0BA 3ZLSA 3SXRA 5BNJA 3MY0A 4MF0A 5DIAA 3OT3A 2YM8A 3LCDA 2Q0BA 2GTMA 4IDVA 4CFVA 2BHEA 2XIYA 4GFGA 4MNFA 4QMVA 3HUBA 4X2JA 2VN9A 5M56A 4OBPA 4E1ZA 4AE9A 3D7ZA 2IO6A 4IEBA 4R5YA 2XB7A 3KB7A 5TOZA 2HWOA 1OB3A 3HNGA 5H8GA 3UJGA 5C26A 2X9EA 4TWPA 3UZPA 2P55A 4K6ZA 4R6VA 5FEEA 4MBLA 5J9LA 1FVVA 3KVWA 4XV2A 4YJUA 4F09A 2V55A 1YXVA 3PFQA 4E7WA 3KVXA 4Y83A 4X2NA 3LCKA 2VTNA 3QRTA 5IZFA 3VBYA 3D94A 3KKVA 5CY3A 3GCSA 3ZZEA 3LFSA 4JBPA 4K9YA 2YM5A 4FUYA 1U5QA 4JBOA 1VEBA 4YPSA 4DGNA 2VWWA 1Y6AA 2JBPA 3OWJA 5LVMA 5DOSA 2ETRA 5HX8A 2HOGA 4B4LA 2A2AA 4HZSA 2EXMA 2WPAA 5HBHA 1PMUA 4BF2A 4D1ZA 3VULA 5CZHA 5B0XA 4FKQA 4IHPA 4JDKA 5EW3A 4QOXA 3UVPA 1BMKA 3PTGA 3PJ1A 3MPTA 4WRGA 5L2QA 5I0BA 2PZ5A 5FTOA 3MVMA 4O82A 2W99B 4JT3A 3JY0A 1VYZA 3LIJA 3ZM9A 4KIKB 2WMXA 3KL8A 4RFMA 4ZJIA 4EEVA 1OIQA 4FG8A 4ZTSA 4XRLA 3ORMA 4Y5QA 2YLEA 4M12A 4YO6A 3MESA 1W82A 3QGWA 4L68A 3QQHA 4XOZA 2AC3A 4BRXA 2WTVA 4TWOA 4WBOA 4Q9SA 2C0IA 3LPBA 4TXCA 1W84A 2QHNA 4MCVA 1H08A 2JDRA 4JQ8A 4JG6A 4FSRA 1P2AA 4AN9A 1RJBA 2BTSA 2P33A 3Q5IA 4RJ3A 4WKQA 4D9TA 3I7BA 4Y8DA 5L6OA 3G0EA 3GP0A 4BDJA 4FICA 2YIWA 4FOBA 5LWNA 4TPTA 1LR4A 4I4EA 4UZHA 2CGVA 3EFLA 2CCIA 4TW9A 4O7WA 1H00A 2XBAA 3FZ1A 3P7BA 1Q8ZA 4W8EA 4QP9A 5KCVA 2Q0NA 4FTAA 3MSSA 4RLKA 3ZEPA 5DRBA 1F3MC 3PY3A 5AV4A 4ALUA 4FKSA 4QP8A 3QQUA 5HKMA 3QTUA 3NVMB 4Y95A 4CQEA 3NYNA 3ZC6A 4DA5A 4RIWB 2WXVA 3R04A 4JBVA 3HA6A 4EK8A 3DXQA 4ZTHA 5EHOA 4HCTA 4OTIA 2OWBA 4KIOA 3MFUA 4IB5A 3SC1A 4C58A 3KU2A 4D2PA 3Q2JA 4C0TA 1KE5A 4O0VA 1BI7A 4EJ7A 3F7ZA 1YI6A 1ZYLA 4AN2A 3BQCA 3BLQA 1H25A 4JDIA 3F3UA 4X2FA 2W1HA 1SMHA 4I23A 4PPAA 3DXPA 4CFUA 3TNWA 1Q62A 3FZTA 4FG7A 3MWUA 4GIHA 3E8EA 3G9NA 3LM0A 3M42A 2ITTA 4ID7A 4IZYA 4V01A 3RPOA 1YOJA 3MPAA 4FVPA 4UZDA 3GOKA 3PA5A 4Z55A 2RSVA 3ZONA 4D5HA 3V5QA 3SXFA 4IC7A 4IX3A 1ZMUA 3GC0A 5BVFA 2XMYA 3TNPC 5KNJA 4BCQA 2IZUA 4PMMA 3DBQA 1W7HA 5C8MA 1GIIA 4EZ7A 4RJ7A 3D7TA 4BDGA 3DS6A 4KABA 3QRJA 2Z60A 5CXHA 4H3BA 4E4NA 3IDPA 2UZUE 2YM7A 2VU3A 4TT7A 4IXPA 4FSQA 3PXYA 3TIYA 1EH4A 3RBWA 2QO7A 5HVKA 4FT3A 3B8RA 3EFJA 3WARA 2NPQA 4O0WA 3LCOA 5CVGA 4CMOA 3SV0A 5DYJA 3OXIA 3QL8A 4GS6A 2ITOA 3K2LA 5JH6A 2ZM1A 3KRLA 4EH9A 2R3MA 3COMA 4PL5A 5D7VA 3S00A 3ITZA 2YN8A 4J7BA 2Q83A 4QMUA 2QONA 4I20A 3IDBA 2Y8OA 4E4MA 3OBJA 4IJPA 4TL0A 1MRUA 4NH1A 4CG8A 1YHVA 5AR5A 2WMSA 1UKIA 3ZRLA 4BYIA 2HZ0A 3CQUA 5E8ZA 3WF7A 3ZM4A 5KMMA 3G33A 4I6FA 3O7LD 2C6KA 2XK6A 2C4GA 2C6OA 4N0SA 4PV0A 1Q3WA 1FINA 4DEEA 5I9YA 3VUKA 2XK8A 3NZ0A 3RPVA 2XKFA 4YHTA 5E90A 3VN9A 1F0QA 2X1NA 1XKKA 2VGOA 2QKRA 2VX3A 4V0GA 4ZTLA 4LRKA 5FP5A 2J90A 5GHVA 2UUEA 4JX3A 4QP4A 3SD0A 2BDFA 4KIQA 1YHSA 2LGCA 2HAKA 3LJ1A 1AGWA 2CMWA 4FSMA 3EZVA 5BVKA 1BL7A 5FUTA 3W8LA 4TNBA 2E9NA 2ZMCA 4H39A 3UVQA 4AOTA 4JR3A 4YZNA 2UZLA 5HCXA 3RP9A 4XJ0A 3UDBA 5L2SA 2OSCA 2HENA 4EYMA 2XJ2A 2C3LA 3FLZA 4FKIA 1CDKA 4P5ZA 4KD1A 1DM2A 3HZTA 5C03A 3OP5A 3FPQA 3S4QA 2CKPA 3O71A 3QCSA 3VUDA 5TE0A 4YTFA 3AD4A 3NW7A 3BGQA 3U9NA 4DEDA 3NRMA 1K3AA 4ZY5A 3GENA 4NKSA 4XEYA 1TKIA 4F65A 2A19B 5EOLA 3MB6A 3E7VA 4ANQA 4R77A 3NX8A 3FEGA 4ZZNA 2X8DA 4PDOA 4FIIA 3P5KA 1XR1A 5KMOA 2I6LA 2R3JA 3U9CA 3BRBA 4OBOA 3MJ2A 5CVHA 3UQFA 1A48A 4AS0A 3RMFA 3R1YA 1FGKA 1K9AA 5HD4A 4BZOA 1BI8A 3KULA 1O6YA 4Q5EA 4YBJA 1WVXA 2DQ7X 3BHUA 5JMSA 4FOCA 4O2PA 2PUPA 2JIVA 3EQGA 4IZAA 5HG5A 3I0OA 4F9WA 4NK9A 5KO1A 1OPJA 3ANQA 4KKHA 3QYWA 3HEGA 3UPXA 4UWCA 5CT7A 4ENYA 2Y6OA 3HYHA 4TYEA 4BHZA 5CASA 3UNKA 4F6SA 5CQWA 2X81A 1XHAA 4O7VA 1UU7A 3DNEA 4IH8A 3FXWA 1JAMA 4ZSJA 4E5AX 5HORA 2YCFA 5I9XA 2JKOA 1R1WA 3ETAA 2O5KA 5I4NA 4CCUA 3FLWA 2WFYA 3LQ3A 4BGQA 4NCTC 3GCQA 2OFUA 3I5NA 3TTIA 3A4OX 3BCEA 2VWIA 4LQMA 2ZM3A 4BCFA 4DEGA 3WBLA 4KSPA 3TT0A 3PSCA 3OT8A 2IW8A 3FXZA 2EUFB 2J2IB 5GINE 3S2PA 3E3BX 3P4KA 2X39A 3QWKA 3ZEWA 5HESA 5LVPA 5DR2A 2QNJA 4PDYA 2GNLA 4N57A 4AF3A 2XJ1A 2XCHA 4DEBA 1QL6A 2QR7A 3KFAA 4QTCA 2YDJA 4PUZA 4OAVB 2WTKB 3LFBA 2IW6A 5KZ0A 1GZOA 2B53A 3C51A 4APPA 2YCQA 4EOSA 4IAIA 4PPBA 3AC3A 5M09A 3K3JA 5J5SA 2X2LA 5LARA 3LFCA 3L9LA 4PY1A 3ENHA 3AOXA 2YDKA 2IWIA 4GFOA 5IH5A 3WF8A 4QRCA 3ZZWA 4OLIA 2VO0A 4IB0A 4XLVA 2ZV2A 2JIIA 2UZBA 3CQEA 3VBVA 1H01A 1JSTA 1DI9A 4YJPA 5J7HA 4R7BA 2F2CB 4EC8A 2XYNA 3HDNA 5HVYA 4YMJA 4U43A 3HRFA 4D0WA 3Q52A 3DJ6A 3GU7A 3G0FA 4PL4A 5J87A 3R00A 4HGEA 3PJCA 3W2QA 4FG9A 4IAYA 3TUCA 3FMKA 4G6NA 3Q2MA 4RMZA 4FEQA 4BTFA 3L8XA 5EI8A 4ITIA 1XH6A 3PUPA 2VRXA 2VWXA 4OT5A 3TKHA 5BVNA 4DGOA 3UQCA 3ZTXA 4MNEB 3R73A 4M8TA 1ZZLA 2XNNA 4FT5A 1Y8YA 4GU9A 2R4BA 3GUBA 4BGHA 5M53A 3D2KA 3MA6A 1RW8A 4ERKA 1J7IA 2H34A 4YSMA 3FLQA 4RQKA 4U81A 4AT3A 3O17A 4DGLC 5EW9A 5AA9A 3QA8A 2WOTA 4BCOA 2HELA 5IU2A 2QOOA 2XCKA 2XH5A 5A4EA 3SRVA 2C30A 4YTHA 4I6QA 3RWPA 1Q41A 4MTAA 3GQIA 4KKGA 2WQBA 4RWIA 1YQJA 1YXUA 3HKOA 2B1PA 4IZ7A 3R6XA 2HWPA 3R2YA 4ENXA 3KCKA 2CKEA 4O22A 2JITA 3O96A 3F2AA 4L9IA 5JFVA 4KBAA 3D5UA 3AGLA 3I1AA 4FTLA 4LGDA 2QHMA 5CANA 1CKJA 4D2RA 4BZNA 4DLJA 2B9JA 3U8WA 1REKA 3FMDA 2CHLA 5CF5A 3FKLA 5EYDA 4BCHA 3ULIA 4JIKA 4DYMA 3SGCA 4CKRA 2P3GX 3MN3A 3BGPA 3TIZA 4FTMA 4U3YA 4YHJA 1FVRA 4QNYA 5EK7A 4M69A 5EOBA 1UVRA 3E5AA 3BZ3A 1UA2A 3R9OA 3C7QA 1PXOA 1ZOHA 3GT8A 2OJIA 3QGYA 4GT4A 2RL5A 4JAIA 3ZU7A 2OK1A 5AP3A 2VTRA 4I4FA 2VTLA 4Z9LA 3ODZX 2YA9A 4IMYA 4HCVA 5KZIA 3FXXA 2YAKA 4KBCA 2FUMA 3H0ZA 1WBTA 2AYPA 3A7HA 2PE0A 4GJ3A 4L00A 2UW6A 3ALOA 4B6LA 4JOAA 5IQBA 4S33A 4L45A 4FTKA 1OGUA 2WU7A 3QC9A 4PMTA 3BU3A 3RNIA 4L6QA 3OXTA 2QOKA 3DQWA 4HOKA 4YPDA 5M57A 3QZGA 4RGJA 3GNIB 4ZSGA 1WCCA 5EQPA 4YTCA 4YJQA 4D4RA 3TN8A 5JQ8A 4R8QA 2F7EE 1KV2A 3CC6A 3V8SA 4C4JA 4DT8A 5AA8A 3KREA 3R9HA 3VWAA 3CS9A 3ATTA 2FB8A 3QD4A 4EOPA 5JN2A 1U54B 5G6VA 4ALVA 4QMOA 4F1MA 3OEZA 1PF8A 4U80A 1KE6A 4XG8A 3V04A 4NTTA 3U55A 1YWVA 2ONLA 3NUSA 4YO4A 3GCUA 1Z9XA 3Q4UA 4FKGA 3OFMA 1FVTA 2XIXA 4IAZA 3R1NA 3NUUA 2WMBA 4DITA 2E9OA 4OGRA 4FV4A 5DT4A 2YM6A 2J9MA 3BU6A 4H58A 4ACDA 5IF1A 3I0QA 2OJJA 5HZNA 2QQ7A 2ZVAA 3OOMA 3QRUA 2H6DA 5IMXA 4E4LA 2OIQA 3ID6C 4FNZA 4BCMA 1ZAOA 3R8VA 3I4BA 2UZNA 1RDQE 3JVSA 3R1SA 3JS2A 3BU5A 2VTIA 4J52A 4WRSA 4ANOA 3GC9A 3PY0A 3HP2A 4IANA 4TNDA 3T9TA 2ERZE 4AN3A 4FSZA 5CQUA 2HIWA 4BZDA 2WD1A 2PE2A 3F61A 3K54A 4K8AA 1PXKA 1WVWA 3U51A 4ZXTA 3DA6A 5A3XA 1SZMA 5DG5A 3W2RA 4FTTA 3U4WA 3PWDA 3TL8A 4WHZA 3UE4A 3VS5A 4D4YA 4DFUA 4D5KA 4JRNA 2HXQA 2UZDA 4XUFA 4UXLA 1GAGA 4GG5A 4MF1A 5D1JA 4OTPA 3E93A 5JFSA 4ZLYA 2GU8A 3EN7A 5E9EA 3QRKA 4XV1A 2PHKA 3IECA 4PTGA 3HDMA 3TZ8A 1ATPE 4ACMA 4L3PA 4QD6A 2WMAA 4F7JA 2J0MB 5IEYA 2PU8A 1KOAA 1JVPP 5AAGA 5CEMA 2YM3A 3OHTA 4OUCA 4O7ZA 4GK2A 4EH2A 4F0GA 4Q9ZA 5C8KA 3C5IA 4DE4A 2OIDA 5I9UA 2OJGA 4NUSA 4F7SA 3NAXA 2C6TA 4HYIA 1GZKA 4L42A 4BDFA 3VJNA 4XNEA 4JQ7A 5IUIA 3ZDUA 3ZXTA 3FLSA 4FA2A 3NCZA 3D7TB 4JG7A 4MXZA 4DLIA 3GXLA 4TWNA 4PQNA 4K0YA 4YLKA 4ZS4A 2QU5A 3FWQA 2PVKA 4UMUA 3QTRA 3JY9A 2C6LA 4XX9A 4W4XA 4GUEA 4J95A 3RZBA 4BTMA 3NW5A 4CMTA 3VBTA 4D1SA 4KSQA 2C3KA 2C5NA 4FT0A 4OTQA 3C1XA 3KQ7A 4IVAA 3OWPA 3TV7A 4FBXA 1K2PA 1YRPA 2JDOA 3D5VA 3P79A 4TTHB 2PWLA 4JQEA 3TNIA 3OCGA 3LMGA 4AW1A 3DV3A 4LOOA 4I1ZA 4FKWA 2FO0A 5AP2A 2E9VA 2ZMDA 3LHJA 4CLJA 3PVGA 5LCJA 3A61A 1WZYA 1ZY4A 3EN6A 4MVFA 5E8VA 2J50A 4WG4A 4GK4A 4ALWA 5CEKA 3EQCA 3IO7A 5AV0A 3A7GA 1OL7A 3PZEA 5IQCA 2XK4A 4M3QA 2BIKB 4FVQA 3FQEA 3OBGA 3PRFA 3E88A 4K33A 3P08A 3R7VA 2ZYBA 2JKQA 4D2SA 5HE1A 3IW6A 2R7BA 3R71A 4JDJA 1G8AA 4RIYA 5CALA 1G5SA 1V1KA 3DFAA 5CVFA 3ZLWA 4DEHA 3UTOA 5K3YA 4EOLA 4QTAA 5EYMA 5BUJA 4TRLA 3FJQE 3RAHA 3G5DA 5IEXA 3FYKX 3OWKA 1OKZA 2BCJA 2ZB1A 5JGAA 4MD7E 5IMEA 2XK7A 4IX6A 4LM5A 3IW4A 4KRCA 2BRBA 2P2IA 3V6SA 2R3OA 5I3RA 3W33A 3W16A 3EZRA 3IONA 4ANNA 2GNFA 4GYIA 3UO6A 1UNLA 4BCNA 1ZOGA 5ANJA 4B0GA 3NGAA 3H3CA 5FDXA 4O7TA 3UIBA 3ENMA 2QODA 5HQ0A 4O96A 5TO8A 3KXXA 4A9SA 2GSFA 2VO6A 3DBFA 4IX5A 2A0CX 2RG5A 3GU5A 4QTDA 3ZRMA 3UYSA 5HTCA 4MXAA 2QOLA 3R2BA 1FBNA 2OFVA 5M4IA 1H26A 3F88A 1T46A 4BICA 4M14A 4U44A 4LL0A 2IVUA 5IQIA 2B0QA 3GFWA 3ZFYA 1REJA 2BZKB 5FTQA 3F69A 3W8QA 3W10A 5JK3A 4EOIA 2IN6A 3R28A 3I5ZA 4W9XA 1ZMVA 5CENA 4E4XA 4RX9A 4KINA 4S2ZA 1OKWA 3C4FA 2GS2A 3EMGA 3QZHA 4YZBA 5FXRA 4XG4A 4C3PA 3ZO4A 3N4UA 2ZJWA 4NM7A 4U40A 4FTUA 4A07A 4X0MA 3DKFA 3P0MA 4GVAA 4FT9A 2Z2WA 2FH9A 1WBPA 1Y6BA 5BMMA 3CPCA 4EI4A 4R3RA 2QU6A 1W8CA 3NUNA 1QPJA 4ZAUA 1W83A 4U0IA 3JR1A 4C59A 2PY3A 4CXAA 5ETAA 3BBTB 4PF4A 1MRYA 3LOKA 4ZJVA 3EN5A 4B99A 5L2TA 4DEAA 2JEDA 4M13A 3IQ7A 3AG9A 5CX9A 4DTKA 4QO9A 4G17A 4QYHA 4ERWA 4DT9A 4QP2A 1I09A 2OIBA 3CGOA 4EQMA 4DTAA 3L8PA 3BEGA 4RX8A 2WMWA 3G15A 3R7IA 3G9LX 3QD0A 2R7IA 3DKOA 3F5UA 3FLNC 3CY2A 3QYZA 5E1EA 5FBOA 2JFMA 1XJDA 2E9PA 3GCVA 3MPMA 4L01A 4IBMA 5JRSA 2GNIA 2R3GA 3MYGA 1BUHA 4YC3A 5BMSA 3OY1A 3POOA 4X2GA 1J3HA 3QKLA 2I0HA 4FKLA 3CSVA 5B2LA 1VJYA 1ZYSA 3AQVA 2V22A 3C0GA 4G3CA 4HCUA 4YU2A 3OTUA 4XHKB 1UKHA 4F63A 1PXNA 5HNGA 4ONAA 1MP8A 3DB6A 3FC1X 3A7FA 4NKAA 4O2ZA 2HK5A 4O7LA 2E9UA 5D9HA 5L3AA 2WMTA 4NFMA 4MXYA 4QP1A 4BDAA 3II5A 2HCKA 4IE9A 4BI1A 3Q5ZA 2GHGA 4CZYB 2VTPA 2WMUA 3HAMA 1Q99A 5DR6A 5AR2A 3E7OA 3SX9A 1B38A 4H05A 5BVDA 3LCTA 4BKYA 5BVEA 2XS0A 5E8XA 4ZS0A 1IAJA 3Q9WA 3FMJA 1TQIA 5LOHA 4EH7A 5A4LA 3DAEA 3MFSA 4XYFA 5B2KA 2OGVA 5CZIA 4E26A 2XK3A 4WT6A 3ZO1A 4G6LA 4HGSA 4KA3A 3TKUA 2HY0A 1H8FA 1NVRA 3FAAA 2ZV7A 3PVWA 3WZEA 4D2WA 3OW4A 3BYMA 3I60A 3FQHA 4CD0A 4H3PA 2XIKA 5EQEA 2HW7A 5L4QA 4KNBA 4OW8A 4RIOA 5AAEA 5CF4A 3PXFA 4PL3A 4HVDA 3UO4A 4E5BA 3QX2A 4GSBA 2GCDA 3VO3A 1YWNA 4O83A 2C6EA 3SOCA 5M4CA 3UVRA 4RZVA 5LJJA 5LMKC 2HY81 2XNEA 4CYIA 4JLCA 4I0SA 5CU0A 4QMYA 4FNWA 2XP2A 4AZSA 5IQDA 4IB1A 2PZIA 3CBLA 2Y9QA 3CPBA 4MQ2A 4BBFA 3WZJA 4AT4A 4XMOA 3UIMA 1MRVA 2IVVA 3CD8A 3HLLA 5HG9A 4S31A 4WUAA 2HZIA 4CFNA 4EL9A 4M68A 5K4IA 3UODA 4RX5A 3QXPA 5DN3A 4ZIMA 4EH6A 2G15A 3BBWA 3HP5A 3MFRA 1X8BA 4E8AA 4RLLA 3PY1A 1VR2A 4RIXA 3LQ8A 4Q5HA 4Z16A 4FV9A 4RRVA 3P1AA 3UG2A 3KA0A 4F4PA 4F0FA 2ZM4A 5CU2A 4ZZMA 4G2FA 4IM2A 4M69B 4PX6A 4JIAA 1H1QA 2UW8A 4O27B 4EORA 3UZRA 4FEWA 2OZAA 5FWKK 3A60A 1JKKA 4C62A 2WTKC 3ZRKA 2G2IA 3NMUF 2OXYA 5EM7A 4KWPA 4BKJA 4MH7A 2QI8A 4L44A 4L7FA 3VAPA 4C37A 4AOIA 5AADA 3T3UA 4EK5A 2CN5A 1B39A 4UEUA 1IASA 1SVGA 2BTRA 4FIJA 5H2UA 2C1BA 2X6DA 5AIKA 5HEZA 4FGBA 1OMWA 5DHJA 2WTWA 3QUEA 3UNJA 2C69A 4AZEA 5A9UA 4W9WA 3VUHA 1DAWA 2WAJA 3QKKA 3O50A 4BL1A 4C4FA 5F9EA 4LOPA 4UYNA 1Z57A 1Q97A 4J97A 1GZNA 2C5XA 3ZUTA 4USFA 3QHWA 4MKCA 2QD9A 5HBEA 2QOBA 5IQFA 3OY3A 3DJ5A 2O64A 3R9DA 3ORLA 5FTGA 4OAUC 2XIRA 2PUUA 3JPVA 5DH3A 4BDIA 5EKNA 3R30A 3LW0A 4QMTA 4WD5A 3SA0A 5I5ZA 2PVHA 3QQJA 5IA5A 4WSYA 5B2MA 3LM5A 3JUHA 3NCGA 3RKBA 3KRWA 1ZY5A 4UWBA 4YJOA 4BIEA 2VO3A 3ERKA 3TCPA 4A4OA 2RFSA 3VBWA 3AT4A 5E8UA 5FDPA 3PXRA 4I21A 1G8SA 5IQHA 5DLSA 5FXQA 2UW7A 3RAIA 2IZSA 3PJ2A 4QTBA 4ZLOA 1YI3A 1W0XC 4QMLA 4EKKA 3TJDA 3OUKA 2PE1A 3BHHA 4FKUA 4L7SA 5LMAA 3NW6A 5HCYA 1ZRZA 5I9WA 2PL0A 5EQYA 3L9PA 5HE2A 1OIRA 4E5WA 2EVAA 3ATSA 1BL6A 5F20A 5HIEA 2W0JA 4ARKA 2F7ZE 3DTWA 5IA2A 4RG0A 5AMNA 4MYGA 5HIBA 2C3IB 4WNMA 2WIHA 1XBBA 5FQDC 1J1BA 4N70A 5C9CA 4O86A 4RVMA 2WMRA 3MGYA 4HVIA 2UZOA 1UNGA 4O0UA 1R3CA 3SG8A 3LFEA 3Q53A 4BBMA 3NLBA 3V5TA 3ZUVA 2R0IA 3NNVA 5DEWA 3W2SA 4RC3A 2BALA 4QMNA 2WZJA 3EQRA 3RINA 1H1WA 3FQSA 3PJ3A 1IG1A 3OCTA 1LEWA 2F4JA 3VS3A 4EUTA 3FMHA 3IKAA 2YLFA 3ZYAA 1MQBA 3COIA 2I1MA 2X8EA 5TT7A 2UW3A 4NW6A 5K5XA 3HMNA 3R0TA 4GT5A 3UZTA 5HBJA 3DBDA 4FV5A 5E91A 4CKIA 4OT6A 2P4IA 4CZUA 3NR9A 1Q8UA 2H9VA 2GPHA 2CDZA 1UV5A 1SVEA 4K18A 2QKWB 4F7LA 3W1FA 1PJKA 3ZH8A 4QYYA 3BX5A 4K11A 2QG7A 1PYXA 3QQLA 3HV4A 2CKQA 3OWLA 4BDCA 1OL2A 4R1VA 1IA8A 1JWHA 3BHYA 3LXPA 1J7UA 4FEUA 4X3FB 5ITAA 2RF9A 2WMQA 2UZEA 5FD2A 3QAME 2DYLA 3QZFA 5IG1A 3Q3BA 2QOFA 1O6KA 4BCJA 2WQEA 4C2WA 1DS5A 4ZOGA 2C1AA 5L8KA 2H96A 4UMPA 2YIQA 4MEDA 3OS3A 1YXSA 4O0SA 4EWQA 1L3RE 3GU6A 2W1CA 2YHVA 4YTIA 4XBUA 2X7OA 4NU1A 5T3QA 3R7OA 5K9IA 4G3DA 1SNXA 4GYGA 5AAFA 1FQ1B 4EK3A 4AAAA 3CE3A 2YM4A 4EBVA 2JDVA 3L9NA 2Z02A 3EWHA 2YIRA 3MH3A 3Q4ZA 4IADA 1E9HA 4D9UA 3F3TA 1OL5A 3ANRA 3GGFA 5ETCA 2FSTX 3LFAA 3POZA 4TKSA 4RIYB 3E63A 4PDPA 5EYCA 2YIYA 3NUXA 5JFWA 5EG3A 3WYYA 3F82A 5DBXA 2GMXA 5KMIA 4UYAA 3C0HA 4R5SA 3K5VA 5F94A 3Q60A 2WO6A 4F64A 3AT3A 4L53A 4IVDA 1U4DA 2HZNA 3V51A 2CCHA 3FE3A 3RPSA 5H9BA 3VVHA 3KXGA 4WG5A 5EKOA 4IWQA 4YJTA 4B7TA 2GQRA 2PTKA 3CKXA 3OTVA 1ND4A 4AFEA 4C35A 5CAPA 2CNVA 4MD9E 5CSXA 2PZPA 1VYWA 2GFSA 3IPHA 3OMVA 4FK6A 2X2KA 2VTHA 3HA8A 4YNOA 1Q5KA 2PVLA 4BY9E 4QMPA 3MIAA 3GCPA 4O0RA 3F3VA 4EK6A 3F2RA 4DFLA 3JVRA 3LFNA 3LFFA 2ESMA 2Z7SA 4P7EA 3FMMA 3OG7A 1V0OA 4G3EA 4L3JA 3F5GA 2XIZA 4EWHA 5AP1A 3Q6WA 5C4KA 4IACA 4YUQA 4C8BA 2WEIA 3QHRA 4FZFB 3Q4TA 1A9UA 4H3QA 3ORZA 5IDPA 3MV5A 2UW5A 3IGGA 4I93A 4O7NA 4ASXA 3CGFA 3PPZA 2HW6A 4TYHA 3KF4A 5L2IA 3ORXA 4L67A 3IK3A 3REPA 2Z7LA 5AX9A 4ZMFA 3CR0A 3DY7A 4ANLA 4K77A 5DE2A 4RFZA 4D28A 5FEQA 3NUPA 4GCJA 3EJ1A 3OOGA 3TJCA 1V0PA 4OTWA 3A8XA 3G90X 2QR8A 4FK3A 4YHFA 3G51A 5EHLA 4LI5A 4O1PA 5DA3A 5DVRA 4KS7A 1XWSA 2GS6A 5CU4A 4C36A 4B8MA 2WQNA 5BVOA 3DT1A 1OUYA 4XG7A 1M2PA 1YOMA 1BLXA 3QLFA 4MHAA 5EW8A 3EYGA 2XNGA 5CYIA 1Q8WA 4R3CA 5IUGA 4JNWA 5E4HA 1YDRE 3R22A 4FSUA 2R3HA 1ZYJA 1Q3DA 4USEA 4QMSA 5DT0A 4G3GA 4L3LA 2BMCA 3RCJA 5AV1A 1O6LA 2XJ0A 2CGWA 2W1DA 3R1QA 5EI6A 3RHKA 2PMIA 3CTHA 3UYTA 2VAGA 3NIEA 4EK4A 1XH9A 1R0EA 2R0UA 3EB0A 4FVRA 3RGFA 4GFMA 3SKCA 3UGCA 4BHNA 5KMKA 4CV9A 3HMMA 5BUIA 3LLTA 1LP4A 3MIYA 3MH2A 3I6UA 4M7IA 3VS4A 4BIBA 2V0DA 5J1VA 3TDWA 3TZ7A 2RKUA 1O9UA 4KIPA 2W4OA 5HD7A 1H07A 4FIFA 4J8MA 3E8CA 4UALA 2C5VA 3BEAA 3GQLA 2EU9A 5CSHA 4AZVA 1FGIA 3E64A 5GZAA 5K4JA 4DH3A 3R9NA 3HL7A 5AR4A 3WYXA 2XNBA 1FOTA 4FSWA 1TVOA 3CTQA 2RFEA 2YERA 3QTIA 4YZCA 2ITYA 3I79A 3TNHA 1Q24A 1JKSA 5TR6A 3R7EA 4FV6A 2VTQA 2OXDA 4UMQA 5ETIA 4FTQA 2NP8A 1WBNA 3V5PA 4PMPA 3QKMA 4BYJA 2PVMA 5TF9A 4RJ8A 1L8TA 1KOBA 5GNKA 1UU8A 1NW1A 2F57A 4I5MA 2R9SA 3O23A 2UW4A 2XM9A 4X6QC 5ANIA 2YZAA 3AT2A 3IOKA 3KXMA 3ROYA 5A4QA 4UMTA 4UY9A 2W5HA 2P2HA 4WSQA 3EN9A 3WIKA 4HYHA 3BWFA 4JBQA 3NYXA 2XYUA 4AUAA 1UWHA 2PZRA 3H4JA 4PWNA 5BPYA 3CD3A 3FHIA 4F0IA 1IR3A 5EDQA 5LXMA 3E8NA 3PYYA 2BRGA 3C4ZA 3TACA 1Y57A 2GQGA 4UN0C 4FKRA 4APCA 5A14A 3EL7A 2VTAA 4JR7A 3CKWA 3A8WA 3MDYA 3O51A 3DDQA 4LG4A 1W98A 4OTFA 1ZZ2A 4LUDA 2C68A 4ZEGA 5A46A 3S0OA 1P14A 3PVBA 3VUTA 3OD6X 3FSFA 4FZ7A 5HHWA 3MTFA 4FR4A 4U79A 3RTPA 3FMEA 2XNPA 4RIXB 1ZWSA 3E92A 4FSTA 1ZMWA 5M51A 4CG9A 4F9AA 2XRWA 3QD3A 4W4YA 2J4ZA 4WUNA 3NS9A 3OW3A 3P7CA 4V05A 5FG8A 2OW3A 3VW6A 2BKZA 5IUHA 4YZDA 5AP4A 4NJDA 2YWVA 3LJ0A 3PSDA 2W96B 1TQMA 4YP8A 4AU8A 3P7AA 2NRYA 3LXKA 2XKDA 2O3PA 2VTJA 3CIKA 4QMQA 3SQQA 2JKMA 4I92A 3VIDA 3WZKA 4C34A 4NTSA 4EKLA 5M4FA 3GOPA 5HLPA 3KC3A 1NY3A 5HI2A 4C3FA 3EKKA 1PXMA 3JYAA 1ZLTA 3C13A 4FTIA 5HE3A 2Z7RA 3TG1A 4G9RA 3UP7A 3BYUA 4BBEA 4IC8A 5JKGA 3DAKA 4IZ5A 3WI6A 4M15A 2A1AB 1OBGA 3COKA 3Q6UA 4C4GA 4KB8A 5ICPA 2XKEA 3WF5A 2YDIA 4D2VA 5CAUA 4M0ZA 2W06A 4PPCA 4QQJA 4CNHA 4YJVA 5ACBC 3LLAA 2OU7A 2J6MA 4FGRA 1CKPA 5L2WA 3QZIA 4L52A 1NT2A 3I7CA 1WVYA 5DT3A 3L8VA 4WO5A 3THBA 1A06A 4XV3A 3R8PA 5CTPA 1WBOA 4BCPA 5CXZA 2C5OA 4EYJA 3FSKA 3ACJA 4YC8A 1NA7A 3Q32A 3NPCA 3ORKA 1M2RA 4P4CA 4J99A 2W5AA 4AWIA 1H4LA 3SHEA 3HV3A 1WBVA 3TI1A 5EH0A 3I6WA 5H8BA 2BAQA 2VWZA 4NJ3A 3OROA 3VHKA 3EQHA 4J8NA 5AR7A 4FUXA 2B9HA 5KKRB 1MUOA 3MI9A 2WMVA 3PG3A 4X7QA 1GOLA 4BR3A 4GW8A 1ZARA 3OZ6A 2J0LA 1OL6A 3F9NA 2J0IA 4YJRA 1PKGA 4XOYA 5IH6A 1RE8A 3SLSA 3W2CA 5J9ZA 4I0RA 1STCE 3BIZA 3IDCA 4P5QA 4HPTE 4U45A 3ZOSA 2IZTA 3O0GA 4JS8A 5AR3A 1GIJA 4CMUA 5KMLA 5E8SA 4GU6A 1OIYA 3R8MA 3VS0A 5LCKA 4FV1A 2W7XA 4C61A 3MA3A 2YJRA 4E6DA 4QP6A 2CGXA 4DFYA 1YVJA 3MH1A 4EUUA 1M17A 5K5NA 2ZOQA 2B55A 3BWJA 3GC8A 2DWBA 4EOKA 5CLPA 4NYEA 3AC4A 1CM8A 4FEXA 2V7AA 4FKOA 4E93A 3DPKA 3QQFA 5IEVA 5J1WA 1J7LA 4P90A 5D10A 3UO5A 4LV5A 3KF7A 4PTCA 4WNPA 4I5CA 2V62A 3Q9ZA 1LPUA 1JNKA 1XO2B 3KRRA 1GY3A 2WTIA 4MQ1A 3RCDA 3P78A 5BYYA 3QCYA 3C4XA 2VNWA 4DH1A 1YHWA 4EQUA 2G01A 4MXXA 5AM7A 4Y5HA 1OL1A 2BROA 4XBRA 3RWQA 3DBCA 4JG8A 3HMIA 4O6EA 4BFMA 3R63A 2ACXA 3PLSA 5C8NA 4M84A 2R2PA 3W2PA 5JZJA 3TEIA 3ZLXA 2A4LA 2OZOA 5EHYA 4ITJA 4ACGA 1OZ1A 3D9VA 4V0GB 3ZDIA 4AGCA 2VO7A 4DFBA 4A06A 2O2UA 4IX4A 3HRBA 4I6BA 5D11A 4IWOA 3F3ZA 3C0IA 3CCNA 1URWA 3HX4A 4KBKA 4BDDA 5IISA 4CFXA 3PJ8A 4QP3A 2YEXA 3KK9A 3RAKA 2CJMA 2RFDA 1JLUE 3FI8A 5AR8A 4EH8A 1PY5A 2BZIB 3EQIA 2WTJA 4FKPA 2JAMA 1KE8A 3D5WA 3FZSA 2VNYA 3COHA 3LKMA 4O84A 4XS2A 4EHGA 4QP7A 4EONA 3BV3A 1RQQA 5FLFA 4JXFA 2CN8A 3AD6A 3BQRA 2QOIA 2W9ZB 3QALE 2VTSA 5KE0A 4G5JA 4F1TA 5KMNA 3UOJA 4DHFA 2R3NA 4B8LA 5ACKA 5B7VA 3SVVA 3UC4A 3N4VA 3PPJA 5AUVA 3DK6A 2O0UA 3RALA 4CEGA 2VGPA 2WNTA 3AC5A 3FKNA 3TDVA 5F1ZA 2UZVA 5GZ9A 3PA3A 1P4OA 3OCSA 4FTCA 4CRSA 2JLDA 3T8OA 4FV7A 2VV9A 4DINA 5J9YA 1OUKA 5HOAA 3DLZA 2PUNA 4F1OA 5KHWA 1WMKA 4UMRA 2EXEA 1IRKA 2C0OA 3B2TA 3R7GA 3KULB 3DNDA 2YZLA 3ZXZA 3P86A 2BAJA 5E7RA 5CSPA 4O0XA 4ZJJA 4AW5A 4WNOA 1QMZA 1SVHA 3C4WA 1UU3A 1JQHA 3EH9A 1JBPE 3HMPA 4FKTA 3NEWA 4HNFA 4Y73A 3LFQA 5CI6A 3WZDA 4K2RA 4RJ5A 3RK9A 2B54A 4FIGA 3UOHA 5FM3A 4YGAA 3NWWA 2X6EA 5DWRA 1JPAA 2Y0AA 4PDSA 1OPLA 3V5LA 4AW2A 4DGMA 1SM2A 4RT7A 4AW0A 4F6WA 4XP0A 2HYYA 2ZDUA 3U6IA 3PXQA 4TYIA 4BI2A 3MB7A 5TKDA 2B9IA 3SG9A 1HCKA 3TM0A 5IA4A 2IJMA 3FL4A 3WZUA 3E62A 1Y91A 4A9RA 1CMKE 4QT1A 3OCBA 1WFCA 3D5XA 3MBLA 3F5XA 4F70A 3EHAA 4IAFA 5HVJA 3RK7A 2Z7QA 4HPUE 4YSJA 1IAHA 2I7QA 5BYLA 4CCBA 4GKIA 3AXWA 4TYHB 4BN1A 5J79A 4RC4A 4X3FC 3F66A 3RM6A 3R02A 2W9FB 1Z5MA 4RC2A 2UVYA 3QLGA 4JI9A 5D41A 3O7LB 2JDTA 2WGJA 4J71A 3BKBA 3MY5A 3HGKA 3OF0A 4PTEA 4I94A 3TWJA 2A27A 3GU8A 2G1TA 4XLIA 3UBDA 2XK9A 3ZS5A 4ACCA 5JGBA 3VQUA 3CY3A 3GU4A 5CWZA 2BIYA 4F9YA 2WTDA 5A54A 4DF3A 3KXHA 2J5FA 4UXQA 4FKVA 3BELA 4KUJA 3KY2A 3UG1A 3AMYA 4AA5A 3ZMMA 4CFFA 4P2KA 2PK9A 2PULA 3O8PA 4IVBA 4QMZA 5BQ0A 4G16A 3N51A 2ITZA 4EOQA 4DBNA 2R3RA 5FEDA 4CYJA 2NRUA 4XRJA 3BGZA 5AIRA 4DC2A 3D14A 4GJ2A 3CQWA 3GB2A 4MNEA 5HLWA 4U42A 5EM8A 3VF9A 4A9YA 1UWJA 3TKIA 4LMUA 3LVPA 1OI9A 3ET7A 2IZRA 2O63A 4I22A 4DCAA 3QXOA 4FF8A 2Y4IB 4FZ6A 3VS7A 2QLUA 2PMLX 2RG6A 3W32A 4I5HA 2R3LA 2OXXA 3PP0A 2W17A 3ZUUA 3ULZA 4G5PA 3DGKA 5LVOA 2QURA 1WAKA 1J91A 2QO2A 1PXJA 4RA4A 3QUDA 4J53A 4U8ZA 4TZRA 3SRVB 1ZOEA 4RX7A 3NNUA 3BLRA 2YISA 2FVDA 2YITA 4AZWA 3HV6A 4CKJA 3FBVA 2QCSA 3KGAA 3R8ZA 2JIUA 4CT2A 5ETFA 4MD8E 5LVLA 4ACHA 4LRMA 3UPZA 4MX9A 3NVKI 2PMNX 3DZOA 4F99A 3B8QA 2FSOX 3KCFA 1OIUA 3A62A 3R83A 4AE6A 4F9CA 4ZSAA 4FEVA 4QPMA 3OEFX 4J96A 1H27A 4AT5A 1PKDA 3VF8A 3KMUA 3NIZA 3PPKA 3F3WA 5CEIA 5CAVA 3RVGA 1U59A 4AGUA 2XZSA 2PUIA 4OTDA 4BIDA 3CP9A 3D2IA 5LVNA 5I9ZA 2C6IA 4PP7A 2CNUA 1M52A 2B7AA 3PWYA 5AP0A 4FYNA 4MBJA 3ZCLA 3MVJA 4RBLA 4E3CA 3DDPA 3SW4A 3KXNA 3NUYA 4IFGA 2I40A 4UB7A 4ZP5A 5AM6A 3UP2A 3VS6A 4FNYA 1YW2A 3TUDA 4DBXA 2IW9A 2OF4A 4IM3A 3PP1A 3PA4A 3VBQA 3VRZA 4C33A 3FC2A 4GL9A 1S9IA 3HV5A 3U54A 1XH7A 3FPMA 1NVSA 3TTJA 3ORIA 4MK0A 4FIEA 2BRNA 4U6RA 1J1CA 5ANGA 5FGKA 5C01A 2WELA 3A4PA 4N6YA 5HU9A 3QBNA 3GC7A 4USDA 1U54A 3VUIA 3ZC5A 3NSZA 4DH7A 4TY1A 5FRIA 5DGZA 3PVUA 3FKOA 3OUNB 4HJOA 3M2WA 3DKCA 3KMWA 1T45A 2HZ4A 2PVNA 3QTSA 3BHTA 4ANSA 3LQ5A 3M1SA 4M66A 4ZSLA 4ANMA 3IS5A 3U87A 1P5EA 4N4SA 4RWJA 2C6MA 4IQ6A 4NFNA 3VUGA 5AJQA 2V5QA 3DU8A 4L43A 3V3VA 2OO8X 5JSMA 3PXKA 4S34A 5I3OA 2G2FA 2VWUA 5DNRA 4FZAB 3FDNA 5IKWA 4FT7A 4QNAA 3DTCA 4XG2A 4QPSA 3ZFMA 3CEKA 4M97A 4LMNA 3VHEA 5CS6A 5AFVA 4LOQA 2JBOA 4C4IA 4CFMA 5IA0A 3LAUA 4IFCA 3V8WA 3S95A 3VW8A 1Q4LA 3D83A 4H1JA 3A2CA 5IQAA 2H8HA 4AXAA 4F9BA 4RPVA 3EYHA 4U3ZA 3N4TA 3EIDA 1P4FA 4GUBA 5CEQA 5AV3A 4J98A 3DAJA 2ERKA 4D4SA 1FMKA 3W18A 2LAVA 4MBIA 2J7TA 3MFTA 4FV8A 2VUWA 5F4NA 3VC4A 4WNKA 3HECA 4HYUA 3F5PA 5C1QB 1H1PA 5AUUA 4F6UA 3FZRA 1ZXEA 4O0YA 2I0EA 5IDNA 3DJ7A 5KMJA 3H9FA 5CU6A 2ZAZA 4HVHA 1NXKA 3DXNA 3L8SA 5FM2A 5GIPE 3QCQA 1JSUA 4RFYA 3SOAA 4BVUA 2XBJA 2F49A 1S9JA 3JXWA 5HU3A 5A4TA 4NCTA 2Z8CA 5A4CA 1PHKA 3EQDA 5KBQA 3GBZA 2FYSA 5GIOE 2RIOA 3BE9A 1OM1A 2PVYA 3T9IA 2JD5A 4DH8A 2J0KA 4C3RA 4DFXE 5IA3A 1JSVA 4C38A 2I0YA 2QOHA 2W1EA 2YABA 1M14A 3QD2B 4FC0A 3PZHA 4FL1A 3U6JA 1XBCA 4MWIA 5GJFA 3OVVA 2CKOA 2ETMA 2BZJA 5HNBA 3H0YA 4G1WA 4PP9A 3D15A 3FZPA 3QTXA 1KE9A 1YXTA 4PMSA 4QYFA 4BDKA 4NIFA 5T68A 4MAOA 3U4UA 2W1IA 2OICA 5AUXA 4BDHA 4DCEA 1JOWB 1PYEA 2XVDA 4A4LA 5JFXA 2VWVA 3CJFA 4GMYA 3QA0A 4I6HA 2ITPA 4IW0A 4NZWB 4MXOA 4X6RA 3R9RA 1BX6A 3C4EA 4O6LA 2GHMA 4KRDA 2BRMA 3BYVA 4Y72A 4GH2A 4GVJA 5E8WA 4N6ZA 1H0VA 2WKMA 3ZFXA 2IG7A 3LMHA 5E8YA 2GQSA 1NVQA 3PDTA 2VD5A 2X7GA 2B4SB 2WU6A 3FY2A 3UIXA 4F08A 4AG8A 3R7YA 3BYSA 3ODYX 1PW2A 5K0KA 1KV1A 2R5TA 4NM3A 3ZBFA 5A6NA 2PPQA 4RVKA 2PVJA 3TV4A 2JFLA 4L8MA 4ANBA 5AP5A 3BPRA 4JRVA 4IAAA 4RJ6A 4AQCA 4CGAA 1QCFA 1H1RA 4QQTA 2IPXA 4NSTA 2X8IA 3B2WA 3IW7A 3IW8A 4RVTA 2UV2A 3QTQA 5HO6A 1PMNA 3CLYA 4Q2AA 4IAKA 3AD5A 4IWDA 3G6GA 1E1XA 1WBWA 1OKYA 3K5UA 4ZY4A 5HICA 4MXCA 4PNKA 1YDSE 1E1VA 4HVGA 1QPDA 2WHBA 2ITUA 2X7FA 4I3ZA 2YCRA 2VX0A 2VTTA 2YJSA 4Y46A 2B52A 3WILA 2OJFE 2CGUA 3PE2A 4C02A 5G1XA 4DGGA 4G9CA 4GG7A 4AGDA 1HCLA 2OH0E 3LFDA 4RJ4A 4YC6A 1JKLA 5C4LA 3V5JA 3MH0A 4AACA 4RWKA 3Q04A 5KKRC 3QF9A 4BGGA 1OPKA 4G31A 5M08A 4EJNA 5GJGA 3RAWA 2PVRA 4M67A 2DUVA 4CLIA 5EM5A 3GI3A 4NWMA 4WIHA 4O7RA 4X2KA 4R7IA 1KUTA 5HNIX 2KULA 3C5UA 3RHXA 4LV8A 3V01A 3KN6A 4UX9A 5DEYA 5H3QA 2YWPA 4E20A 3LXLA 1JKTA 3DFCB 4UWYA 4EZ5A 4LYNA 4UBAA 2W1ZA 4DAWA 4DEIA 4E73A 1Q8YA 5AEPA 2FA2A 4FNXA 4GV1A 3FUPA 4JDHA 3SDJA 4AFJA 1Y8GA 3LCSA 2R64A 4ZLZA 1LUFA 2GNJA 4NT4A 2OF2A 2P0CA 5GJDA 2ITVA 5DI1A 2J51A 3ZBXA 2BDJA 3EQPA 3QTWA 3EFWA 5BUEA 1XQZA 4YR8A 5EYKA 4HW7A 4AX8A 1APME 2CSNA 2X4FA 2XRUA 4IWPA 4OBQA 4W8DA 4E6AA 5DMZA 2KTYA 3WF6A 2EB3A 4IVCA 4LFIA 2YIXA 4BCKA 5HTBA 3ZO2A 3HV7A 3FLYA 4AGWA 5HCZA 2XF0A 1H24A 3DQXA 3E8DA 1CKIA 2W1GA 4IB3A 4NM0A 4EOMA 5DPVA 2UW0A 3NAYA 3UOKA 2JKKA 4JJRA 3RPRA 4A7CA 4DN5A 5LQFA 3F7WA 3UQGA 2B9FA 3ROCA 3DZQA 4BTJA 5J5TA 4XV9A 5H8EA 4GRBA 1CTPE 4HZRA 1M7QA 5AWMA 2V7OA 1Q61A 4FE2A 5CT0A 3S3IA 4LGHA 3H9RA 3E3PA 4WBBB 4XP2A 5D7AA 4I24A 5ANKA 4CVAA 2QLQA 3PIYA 2OG8A 4CTBA 1DI8A 1YI4A 4TN6A 4E6CA 3GFEA 2EXCX 1PMVA 1UU9A 2BHHA 2UZWE 3Q9YA 2UZTA 2DS1A 4FV0A 3G2FA 4PRJA 3VS1A 4AZFA 4BWPA 4Z3VA 4DG2E 2BKKA 3AMAA 2J5EA 3FI2A 4QMMA 2R3PA 4RWLA 4AOJA 4U41A 3RPYA 3RZFA 2Y7JA 3ZSHA 2CPKE 5AUYA 4EQCA 2R3FA 1XH4A 3KRJA 1XH5A 3BI6A 3H30A 5M44A 5AP7A 2RFNA 4EOOA 2Y4PA 2YFXA 5HX6A 4D0XA 1OVEA 2YCSA 2CLXA 3RI1A 4DFNA 3WF9A 5HG8A 1SYKA 4EHEA 1M7NA 3NYVA 3SW7A 2E2BA 4CFWA 4KS8A 4PNIA 4FTNA 4NW5A 2UVZA 3LJ2A 5ANDA 1GIHA 5HIDA 3OC1A 4FZDB 3W55A 5DFPA 4A9UA 1Q8TA 2QVSE 3VUMA 3QTZA 5AV2A 2BUJA 3AMBA 3ZLYA 5D12A 4D1XA 2EB2A 4EC9A 3UNZA 1MQ4A 4O38A 4BKZA 4AA0A 4X3JA 3FY0A 3QFVA 3NUAA 3Q9XA 4RSSA 4Y85A 2PSQA 2O8YA 1KWPA 4BWKA 3DCVA 4U7ZA 4AA4A 4FSNA 5HLNA 4KIKA 1PMEA 2YACA 3DKGA 4DH5A 5LMBA 2NNWB 4KKEA 1HOWA 3ORTA 4C7TA 1R39A 4XCUA 2WEVA 1QPEA 4CT1A 2ITNA 4AP7A 5K0XA 4W4VA 3LMIA 5EM6A 2X9FA 4BC6A 2PZYA 3DBEA 4H1MA 4QYGA 5M4UA 2VWYA 3L1SA 2BFYA 3CTJA 4A9TA 3NNXA 2W05A 2WTCA 3LXNA 3PRIA 4LRJA 4FV3A 4M0YA 1XBAA 3ELJA 3LZBA 4QMXA 4I41A 3UOLA 5BYZA 2PMOX 3EL8A 3DK3A 4S30A 3P9JA 4OTHA 3A7JA 4CV8A 4O81A 2WQMA 3BHVA 2ZV9A 3C9WA 4C4HA 3FI4A 3R21A 4QQCA 2OZAB 3CJGA 4YJSA 2ZB0A 2G9XA 4J1RA 2EWAA 5JEBA 4CZTA 4O0TA 1YOLA 3KN5A 2OKRA 3WE8A 1OITA 1I44A 4ITHA 4JX7A 4II5A 3HAVA 4W4WA 3QQKA 4EZ3A 1OECA 3VRYA 4FL3A 3M11A 5FBNC 4LL5A 3F2NA 3PIZA 2BDWA 4RIWA 3RNYA 3R8UA 1OKVA 2GHLA 2AC5A 2QG5A 3KXZA 1AD5A 2BZHB 3T3VA 3QQGA 2ITXA 3S1HA 1KE7A 1TQPA 3N9XA 5E1SA 4FX3A 2QC6A 3BYOA 4NEUA 4QTEA 1GNGA 4WA9A 3UMXA 2C47A 4EBWA 3H10A 3MTLA 4EH3A 3HUCA 2BILB 3ZO3A 3IGOA 3UIUA 5CF8A 4ZZOA 2Y4IC 3D4QA 3VJOA 2XEZA 4QMWA 1FPUA 2C6DA 5HE0A 4JL9A 2GDOA 2W5BA 2G2HA 2R3KA 1H1SA 3AC2A 2GFCA 2JC6A 3KRXA 3QUPA 4FIHA 3DOGA 2W4JA 3FHRA 4IIRA 4ASZA 4TYGA 4O7YA 1PRYA 2ZDTA 2F9GA 4GK3A 4R7HA 3NYOA 3QWJA 3WE4A 1GJOA 4YJNA 4HVSA 5BVWA 4HNIA 3VBXA 5CEPA 3TZMA 4ASDA 5E8TA 4E6QA 5CAOA 3EOCA 3G6HA 3ACKA 3MVLA 3PSBA 4HGLA 1G3NA 2XUUA 4GT3A 4FYOA 5L8LA 2X4ZA 5CI7A 2W4KA 3ORNA 2WIPA 1R78A 4U97A 4K1BA 3C50A 5HG7A 4NM5A 4L46A 4F7NA 5KX8A 4RVLA 2GNHA 4GKHA 5F95A 4D4VA 2RGPA 3C4CA 3BLHA 3V5WA 4ASEA 3P23A 2QOQA 4XG6A 5CNOA 3KK8A 4D55A 5IPJA 3O8TA 2JAVA 3QCXA 4MWHA 4XH6A 2JGZA 3R8LA 1ERKA 3MY1A 5EDPA 3UMWA 2HXLA 3A99A 4FTRA 2FSMX 1PXLA 5I9VA 1U5RA 1GZ8A 2WOUA 2BAKA 4GIIA 4B9DA 4CTCA 5JZNA 5KBRA 3K3IA 1IA9A 3FYJX 3OXZA 3QC4A 4XG9A 5CAQA 5IH4A 5KUPA 5JRQA 5FXSA 2F7XE 5IA1A 3SXSA 2GS7A 1VZOA 5M06A 2FGIA 4X21A 4YZ9A 3HRCA 5T6KA 4ZMEA 2PVFA 2IVTA 2OLCA 3Q4CA 1UNHA 4O21A 2NO3A 3AC8A 4X3FA 2R3IA 3EKNA 4IJ9A 5AP6A 3EN4A 4EHZA 2W1FA 4C4EA 2C0TA 5IQEA 3EFKA 3I81A 3MVHA 4NIFB 3DB8A 2X0GA 4EH5A 3FMLA 1BKXA 3PG1A 3MW1A 2JDSA 4FL2A 3V8TA 5CU3A 3E87A 4IM0A 4EH4A 4ZTRA 1XH8A 3AGMA 2XEYA 4FTOA 4V04A 4YURA 2ONLC 5KHXA 5JGDA 3PIXA 4OR5A 3EQFA 1R0PA 2OJ9A 5CSWA 2SRCA 4WOVA 2PYWA 1LEZA 1YKRA 2XNMA 5L6PA 3V6RA 3QX4A 3PE1A 4TWCA 2Y6MA 3TXOA 5JQ5A 3O2MA 1H28A 3BE2A 3GEQA 3QU0A 5J95A 4YBKA 4QQ5A 5E92A 4LGGA 5HGIA 5BX0A 2OI4X 2VWBA 3BV2A 4AZTA 2IVSA 4S32A 3VS2A 4BCIA 1PXPA 1CSNA 3PXZA 5DRDA 4BB4A 3GVUA 5J8IA 1AQ1A 5LWMA 1ZYDA 4A4XA 2OBJA 3AC1A 4QPAA 4R1YA 4D58A 2WQOA 4FODA 1BYGA 2BRHA 2ITQA 2XNOA 4FV2A 4U9AA 5L6WL 5GZ8A 4HGTA 4EHVA 3ZHPC 5ANOA 4O91A 3KMMA 1B6CB 4ZK5A 1ZYCA 3RJCA 2VTMA 3DK7A 3IG7A 3IW5A 4G6OA 3R01A 1KSWA
chains in the Genus database with same CATH superfamily
4DFZE 3CXWA 2R3QA 4FKJA 2I0VA 4RQVA 3FI3A 3O8UA 2VX1A 5M55A 3TNQB 4FI1A 4U5JA 5AUWA 4R3PA 5DR9A 5LMKA 2C5YA 1PXIA 1URCA 3VNTA 5AUTA 1WBSA 2ZFYA 3ORPA 4EOJA 4ZTQA 4XP3A 3FZOA 2J0JA 4CRLA 3QRIA 1F5QA 1SNUA 2FSLX 2O65A 2XM8A 4TYJA 4YZMA 4RZWA 2BR1A 2QO9A 2UW9A 5EFQA 5IQGA 1YDTE 5HO8A 3TV6A 4OTGA 3UC3A 4O7SA 2GTNA 2CLQA 2CNQA 4NL0A 3HMOA 2VTOA 1YXXA 3MS9A 3RK5A 4I5PA 4YNEA 2QOCA 4R78A 3FL5A 3PLAE 3AKJA 3ZSGA 4BTKA 4DG3E 3A7IA 4BCGA 4Z7GA 4WG3A 5AUZA 1U46A 2C3JA 4C57A 3H9OA 5CSVA 5ANEA 5EI2A 4GEOA 2AUHA 3TZ9A 5HTIA 4UV0A 3ALNA 4XG3A 2XKCA 2BVAA 1QPCA 3KEXA 4RA5A 2UVXA 2ETKA 4G3FA 4BDEA 3MJ1A 4JAJA 4DG0E 4YLLA 3EQBA 4ZSEA 4ZY6A 4JVGA 3WIGA 4C2VA 5JT2A 3IOPA 3L9MA 4D2TA 3HVCA 1YWRA 2X2MA 4KAOA 4BI0A 4Z7HA 5J7BA 4FTJA 2OH4A 3DLSA 4H36A 4CQGA 5L8JA 3SAYA 5EDRA 2BPMA 3RM7A 5CF6A 1IEPA 5AX3A 3ZSIA 2REIA 2XA4A 4BWXA 3FV8A 5A6OA 4QYEA 3TUBA 5FP6A 1DAYA 2VZ6A 3R7UA 3W2OA 4G34A 5CEOA 4ORKA 2WB8A 1H0WA 5C27A 4CSVA 1FMOE 3NNWA 1M2QA 2YAAA 4HYSA 4YLJA 2ITWA 2NYAA 5M07A 4ZTNA 4LUEA 2BFXA 4BDBA 4OTRA 3NDMA 1OBDA 3D0EA 4DTBA 3F6XA 4I0TA 4FSYA 4FMQA 2ZV8A 2F2UA 3WOWA 3U6HA 4ZTMA 5CNNA 4O1OA 3Q96A 4IDTA 3LE6A 3VQHA 2GNGA 3FMNA 5HO7A 1V0BA 3ZLSA 3SXRA 5BNJA 3MY0A 4MF0A 5DIAA 3OT3A 2YM8A 3LCDA 2Q0BA 2GTMA 4IDVA 4CFVA 2BHEA 2XIYA 4GFGA 4MNFA 4QMVA 3HUBA 4X2JA 2VN9A 5M56A 4OBPA 4E1ZA 4AE9A 3D7ZA 2IO6A 4IEBA 4R5YA 2XB7A 3KB7A 5TOZA 2HWOA 1OB3A 3HNGA 5H8GA 3UJGA 5C26A 2X9EA 3AKLA 4TWPA 3UZPA 2P55A 4K6ZA 4R6VA 5FEEA 4MBLA 5J9LA 1FVVA 3KVWA 4XV2A 4YJUA 4F09A 2V55A 1YXVA 3PFQA 4E7WA 3KVXA 4Y83A 4X2NA 3LCKA 2VTNA 3QRTA 5IZFA 3VBYA 3D94A 3KKVA 5CY3A 3GCSA 3ZZEA 3LFSA 4DHJA 4JBPA 4K9YA 2YM5A 4FUYA 1U5QA 4JBOA 1VEBA 4YPSA 4DGNA 2VWWA 1Y6AA 2JBPA 3OWJA 5LVMA 5DOSA 2ETRA 5HX8A 2HOGA 4B4LA 2A2AA 4HZSA 2EXMA 2WPAA 5HBHA 1PMUA 4BF2A 4D1ZA 3VULA 5CZHA 5B0XA 4FKQA 4IHPA 4JDKA 5EW3A 4QOXA 3UVPA 1BMKA 3PTGA 3PJ1A 3MPTA 4WRGA 5L2QA 5I0BA 2PZ5A 5FTOA 3MVMA 4O82A 2W99B 4JT3A 3JY0A 1VYZA 3LIJA 3ZM9A 4KIKB 2WMXA 3KL8A 4RFMA 4ZJIA 4EEVA 1OIQA 4FG8A 4ZTSA 4XRLA 3ORMA 4Y5QA 2YLEA 4AXCA 4M12A 4YO6A 3MESA 1W82A 3QGWA 4L68A 3QQHA 4XOZA 2AC3A 4BRXA 2WTVA 4TWOA 4WBOA 4Q9SA 2C0IA 3LPBA 4TXCA 1ST4A 1W84A 2QHNA 4MCVA 1H08A 2JDRA 4JQ8A 4JG6A 4FSRA 1P2AA 4AN9A 1RJBA 2BTSA 2P33A 3Q5IA 4RJ3A 4WKQA 4D9TA 3I7BA 4Y8DA 5L6OA 3G0EA 3GP0A 4BDJA 4FICA 2YIWA 4FOBA 5LWNA 4TPTA 1LR4A 4I4EA 4UZHA 2CGVA 3EFLA 2CCIA 4TW9A 4O7WA 1H00A 2XBAA 3FZ1A 3P7BA 1Q8ZA 4W8EA 4QP9A 5KCVA 2Q0NA 4FTAA 3MSSA 4RLKA 3ZEPA 5DRBA 1F3MC 3PY3A 5AV4A 4ALUA 4FKSA 4QP8A 3QQUA 5HKMA 3QTUA 3NVMB 4Y95A 4CQEA 3NYNA 3ZC6A 4DA5A 4RIWB 2WXVA 3R04A 4JBVA 3HA6A 4EK8A 3DXQA 4ZTHA 5EHOA 4HCTA 4OTIA 2OWBA 5BV3A 4KIOA 3MFUA 4IB5A 3SC1A 4C58A 3KU2A 4D2PA 3Q2JA 4C0TA 1KE5A 4O0VA 1BI7A 4EJ7A 3F7ZA 1YI6A 1ZYLA 4AN2A 3BQCA 3BLQA 1H25A 4JDIA 3F3UA 4X2FA 2W1HA 1SMHA 4I23A 4PPAA 3DXPA 4CFUA 3TNWA 1Q62A 3FZTA 4FG7A 3MWUA 4GIHA 3E8EA 3G9NA 3LM0A 3M42A 2ITTA 4ID7A 4IZYA 4V01A 3RPOA 1YOJA 3MPAA 4FVPA 4UZDA 3GOKA 3PA5A 4Z55A 2RSVA 3ZONA 4D5HA 3V5QA 3SXFA 4IC7A 4IX3A 1ZMUA 3GC0A 5BVFA 2XMYA 3TNPC 5KNJA 4BCQA 2IZUA 4PMMA 3DBQA 1W7HA 4FRFA 1GIIA 5C8MA 4EZ7A 4RJ7A 3D7TA 4BDGA 3DS6A 4KABA 3QRJA 3NFFB 2Z60A 5CXHA 2AQXA 4H3BA 4E4NA 3IDPA 2UZUE 2YM7A 2VU3A 4TT7A 3BL7A 4IXPA 4FSQA 3PXYA 3TIYA 1EH4A 3RBWA 2QO7A 5HVKA 4FT3A 3B8RA 3EFJA 3WARA 2NPQA 4O0WA 3LCOA 5CVGA 4CMOA 3SV0A 5DYJA 3OXIA 3QL8A 4GS6A 2ITOA 3K2LA 5JH6A 2ZM1A 3KRLA 4EH9A 2R3MA 3COMA 4PL5A 5D7VA 3S00A 3ITZA 2YN8A 4J7BA 2Q83A 4QMUA 2QONA 4I20A 3IDBA 2Y8OA 4E4MA 3OBJA 4IJPA 4TL0A 1MRUA 4NH1A 4CG8A 1YHVA 5AR5A 2WMSA 1UKIA 3ZRLA 4BYIA 2HZ0A 3CQUA 5E8ZA 3WF7A 3ZM4A 5KMMA 3G33A 4I6FA 3O7LD 2C6KA 2XK6A 2C4GA 2C6OA 4N0SA 4PV0A 1Q3WA 1FINA 4DEEA 5I9YA 3VUKA 2XK8A 3NZ0A 3RPVA 2XKFA 4YHTA 5E90A 3VN9A 1F0QA 2X1NA 1XKKA 2VGOA 2QKRA 2VX3A 4V0GA 4ZTLA 4LRKA 5FP5A 2J90A 5GHVA 2UUEA 4JX3A 4QP4A 3SD0A 2BDFA 4KIQA 1YHSA 2LGCA 2HAKA 3LJ1A 1AGWA 2CMWA 4FSMA 3EZVA 5BVKA 1BL7A 5FUTA 3W8LA 4TNBA 2E9NA 2ZMCA 4H39A 3UVQA 4AOTA 4JR3A 1W2DA 4YZNA 2UZLA 5HCXA 3RP9A 4XJ0A 3UDBA 5L2SA 2OSCA 2HENA 3NFGB 4EYMA 2XJ2A 2C3LA 3FLZA 4FKIA 1CDKA 4P5ZA 4KD1A 1DM2A 3HZTA 5C03A 3OP5A 3FPQA 3S4QA 2CKPA 3O71A 3QCSA 3VUDA 5TE0A 4YTFA 3AD4A 3NW7A 3BGQA 3U9NA 4DEDA 3NRMA 1K3AA 4ZY5A 3GENA 4NKSA 4XEYA 1TKIA 4F65A 2A19B 5EOLA 3MB6A 3E7VA 4ANQA 4R77A 3NX8A 3FEGA 4ZZNA 2X8DA 4PDOA 4FIIA 3P5KA 1XR1A 5KMOA 2I6LA 2R3JA 4DHZA 3U9CA 3BRBA 4OBOA 3MJ2A 5CVHA 3UQFA 1A48A 4AS0A 3RMFA 3R1YA 1ST0A 1FGKA 1K9AA 5HD4A 4DDGA 4BZOA 1BI8A 3KULA 1O6YA 4Q5EA 4YBJA 1WVXA 2DQ7X 3BHUA 5JMSA 4FOCA 4O2PA 2PUPA 2JIVA 3EQGA 4IZAA 5HG5A 3I0OA 4F9WA 4NK9A 5KO1A 1OPJA 3ANQA 4KKHA 3BLAA 3QYWA 3HEGA 3UPXA 4UWCA 5CT7A 4ENYA 2Y6OA 3HYHA 4TYEA 4BHZA 5CASA 3UNKA 4F6SA 5CQWA 2X81A 1XHAA 4O7VA 1UU7A 3DNEA 4IH8A 3FXWA 1JAMA 4ZSJA 4E5AX 5HORA 2YCFA 5I9XA 2JKOA 1R1WA 3ETAA 2O5KA 5I4NA 4CCUA 3FLWA 2WFYA 3LQ3A 4BGQA 4NCTC 3GCQA 2OFUA 3I5NA 3TTIA 3A4OX 3BCEA 2VWIA 4LQMA 2ZM3A 4BCFA 4DEGA 3WBLA 4KSPA 3TT0A 3PSCA 3OT8A 2IW8A 3FXZA 2EUFB 2J2IB 5GINE 3S2PA 3E3BX 3P4KA 2X39A 3QWKA 3ZEWA 5HESA 5LVPA 5DR2A 2QNJA 4PDYA 2GNLA 4N57A 4AF3A 2XJ1A 2XCHA 4DEBA 1QL6A 2QR7A 3KFAA 4QTCA 2YDJA 4PUZA 4OAVB 2WTKB 3LFBA 2IW6A 5KZ0A 1GZOA 2B53A 3C51A 4APPA 2YCQA 4EOSA 4IAIA 4PPBA 3AC3A 5M09A 3K3JA 5J5SA 2X2LA 5LARA 3LFCA 3L9LA 4PY1A 3ENHA 3AOXA 2YDKA 2IWIA 4GFOA 5IH5A 4DHIB 3WF8A 4QRCA 3ZZWA 4OLIA 2VO0A 4IB0A 4XLVA 2ZV2A 2JIIA 2UZBA 3CQEA 3VBVA 1H01A 1JSTA 1DI9A 4YJPA 5J7HA 4AXFA 4R7BA 2F2CB 4EC8A 2XYNA 3HDNA 5HVYA 4YMJA 4U43A 3HRFA 4D0WA 3Q52A 3DJ6A 3GU7A 3G0FA 4PL4A 5J87A 3R00A 4HGEA 3PJCA 3W2QA 4FG9A 4IAYA 3TUCA 3FMKA 4G6NA 3Q2MA 4RMZA 4FEQA 4BTFA 3L8XA 5EI8A 4ITIA 1XH6A 3PUPA 2VRXA 2VWXA 4OT5A 3TKHA 5BVNA 4DGOA 3UQCA 3ZTXA 4MNEB 3R73A 4M8TA 1ZZLA 2XNNA 4FT5A 1Y8YA 4GU9A 2R4BA 3GUBA 4BGHA 4O4EA 5M53A 3D2KA 3MA6A 1RW8A 4ERKA 1J7IA 2H34A 4YSMA 3FLQA 4RQKA 4U81A 4AT3A 3O17A 4DGLC 5EW9A 5AA9A 3QA8A 2WOTA 4BCOA 2HELA 5IU2A 2QOOA 2XCKA 2XH5A 5A4EA 3SRVA 2C30A 4YTHA 4I6QA 3RWPA 1Q41A 4MTAA 3GQIA 4KKGA 2WQBA 4RWIA 1YQJA 1YXUA 3HKOA 2B1PA 4IZ7A 3R6XA 2HWPA 3R2YA 4ENXA 3KCKA 2CKEA 4O22A 2JITA 3O96A 3F2AA 4L9IA 5JFVA 4KBAA 3D5UA 3AGLA 3I1AA 4FTLA 4LGDA 2QHMA 5CANA 1CKJA 4D2RA 4BZNA 4DLJA 2B9JA 3U8WA 1REKA 3FMDA 2CHLA 5CF5A 3AKKA 3FKLA 5EYDA 4BCHA 3ULIA 4JIKA 4DYMA 3SGCA 4CKRA 2P3GX 3MN3A 3BGPA 3TIZA 4FTMA 4U3YA 4YHJA 1FVRA 4QNYA 5EK7A 4M69A 5EOBA 1UVRA 3E5AA 3BZ3A 1UA2A 3R9OA 3C7QA 1PXOA 1ZOHA 3GT8A 2OJIA 3QGYA 4GT4A 2RL5A 4JAIA 3ZU7A 2OK1A 4BJJA 5AP3A 2VTRA 4I4FA 2VTLA 4Z9LA 3ODZX 2YA9A 4IMYA 4HCVA 5KZIA 3FXXA 2YAKA 4KBCA 2FUMA 3H0ZA 1WBTA 2AYPA 3A7HA 2PE0A 4GJ3A 4L00A 2UW6A 3ALOA 4B6LA 4JOAA 5IQBA 4S33A 4L45A 4FTKA 1OGUA 2WU7A 3QC9A 4PMTA 3BU3A 3RNIA 4L6QA 3OXTA 2QOKA 3DQWA 4HOKA 4YPDA 5M57A 3QZGA 4RGJA 3GNIB 4ZSGA 1WCCA 5EQPA 4YTCA 4YJQA 4D4RA 3TN8A 5JQ8A 4R8QA 2F7EE 1KV2A 3CC6A 3V8SA 4C4JA 4DT8A 5AA8A 3KREA 3R9HA 3VWAA 3CS9A 3ATTA 2FB8A 3QD4A 4EOPA 5JN2A 1U54B 5G6VA 4ALVA 4QMOA 4F1MA 3OEZA 1PF8A 4U80A 1KE6A 4XG8A 3V04A 4NTTA 3U55A 1YWVA 2ONLA 3NUSA 4YO4A 3GCUA 1Z9XA 3Q4UA 4FKGA 3OFMA 1FVTA 2XIXA 4IAZA 3R1NA 3NUUA 2WMBA 4DITA 2E9OA 4OGRA 4FV4A 5DT4A 2YM6A 2J9MA 3BU6A 4H58A 4ACDA 5IF1A 3I0QA 2OJJA 5HZNA 2QQ7A 2ZVAA 3OOMA 3QRUA 2H6DA 5IMXA 4E4LA 2OIQA 3ID6C 4FNZA 4BCMA 1ZAOA 3R8VA 3I4BA 2UZNA 1RDQE 3JVSA 3R1SA 3JS2A 3BU5A 2VTIA 4J52A 4WRSA 4ANOA 3GC9A 3PY0A 3HP2A 4IANA 4TNDA 3T9TA 2ERZE 4AN3A 3UDSA 4FSZA 5CQUA 2HIWA 4BZDA 2WD1A 2PE2A 3F61A 3K54A 4K8AA 1PXKA 1WVWA 3U51A 4ZXTA 3DA6A 5A3XA 1SZMA 5DG5A 3W2RA 4FTTA 3U4WA 3PWDA 3TL8A 4WHZA 3UE4A 3VS5A 4D4YA 4DFUA 4D5KA 4JRNA 2HXQA 2UZDA 4XUFA 4UXLA 1GAGA 4GG5A 4MF1A 5D1JA 4OTPA 3E93A 5JFSA 4ZLYA 2GU8A 3EN7A 5E9EA 3QRKA 4XV1A 2PHKA 3IECA 4PTGA 4I6LA 3HDMA 3TZ8A 1ATPE 4ACMA 4L3PA 4QD6A 2WMAA 4F7JA 2J0MB 5IEYA 2PU8A 1KOAA 1JVPP 5AAGA 5CEMA 2YM3A 3OHTA 4OUCA 4O7ZA 4GK2A 4EH2A 4F0GA 4Q9ZA 5C8KA 3C5IA 4DE4A 2OIDA 5I9UA 2OJGA 4QDVA 4NUSA 4F7SA 3NAXA 2C6TA 4HYIA 1GZKA 4L42A 4BDFA 3VJNA 4XNEA 4JQ7A 5IUIA 3ZDUA 3ZXTA 3FLSA 4FA2A 3NCZA 3D7TB 4JG7A 4MXZA 4DLIA 3GXLA 4TWNA 4PQNA 4K0YA 4YLKA 4ZS4A 2QU5A 3FWQA 2PVKA 4UMUA 3TYKA 3QTRA 3JY9A 2C6LA 3PUFC 4XX9A 4W4XA 4GUEA 4J95A 3RZBA 4BTMA 3NW5A 4CMTA 3VBTA 4D1SA 4KSQA 2C3KA 2C5NA 4FT0A 4OTQA 3C1XA 3KQ7A 4IVAA 3OWPA 3TV7A 4FBXA 1K2PA 1YRPA 2JDOA 3D5VA 3P79A 4TTHB 2PWLA 4JQEA 1VLRA 3TNIA 3OCGA 3LMGA 4AW1A 3DV3A 4LOOA 4I1ZA 4FKWA 2FO0A 5AP2A 2E9VA 4LV7A 2ZMDA 3LHJA 4CLJA 3PVGA 5LCJA 3A61A 1WZYA 1ZY4A 3EN6A 4MVFA 5E8VA 2J50A 4WG4A 4GK4A 4ALWA 5CEKA 3EQCA 3IO7A 5AV0A 3A7GA 1OL7A 3PZEA 5IQCA 2XK4A 4M3QA 2BIKB 4FVQA 3FQEA 3OBGA 3PRFA 3E88A 4K33A 3P08A 3R7VA 2ZYBA 2JKQA 4D2SA 5HE1A 3IW6A 2R7BA 3R71A 4JDJA 1G8AA 4RIYA 5CALA 1G5SA 1V1KA 3DFAA 5CVFA 3ZLWA 4DEHA 3UTOA 5K3YA 4EOLA 4QTAA 5EYMA 5BUJA 4TRLA 3FJQE 3RAHA 3G5DA 5IEXA 3FYKX 3OWKA 1OKZA 2BCJA 2ZB1A 5JGAA 4MD7E 5IMEA 2XK7A 4IX6A 4LM5A 3IW4A 4KRCA 2BRBA 2P2IA 3V6SA 2R3OA 5I3RA 3W33A 3W16A 3EZRA 3IONA 4ANNA 2GNFA 4GYIA 3UO6A 1UNLA 4BCNA 1ZOGA 1W2CA 3ML1A 5ANJA 4B0GA 3NGAA 3H3CA 5FDXA 4O7TA 3UIBA 3ENMA 2QODA 5HQ0A 4O96A 5TO8A 3KXXA 4A9SA 2GSFA 4QDEA 2VO6A 3DBFA 4IX5A 2A0CX 2RG5A 3GU5A 4QTDA 3ZRMA 3UYSA 5HTCA 4MXAA 2QOLA 3R2BA 1FBNA 2OFVA 5M4IA 1H26A 3F88A 1T46A 4BICA 4M14A 4U44A 4LL0A 2IVUA 5IQIA 2B0QA 3GFWA 3ZFYA 1REJA 2BZKB 5FTQA 3F69A 3W8QA 3W10A 5JK3A 4EOIA 2IN6A 3R28A 3I5ZA 4W9XA 1ZMVA 5CENA 4E4XA 4RX9A 4KINA 4S2ZA 1OKWA 3C4FA 2GS2A 3EMGA 3QZHA 4YZBA 5FXRA 4XG4A 4C3PA 3ZO4A 3N4UA 2ZJWA 4NM7A 4U40A 4FTUA 4A07A 4X0MA 3DKFA 3P0MA 4GVAA 4FT9A 2Z2WA 2FH9A 1WBPA 1Y6BA 5BMMA 3CPCA 4EI4A 4R3RA 2QU6A 1W8CA 3NUNA 1QPJA 4ZAUA 1W83A 4U0IA 3JR1A 4C59A 2PY3A 4CXAA 5ETAA 3BBTB 4PF4A 1MRYA 3LOKA 4ZJVA 3EN5A 4B99A 5L2TA 4DEAA 2JEDA 4M13A 3IQ7A 3AG9A 5CX9A 4DTKA 4QO9A 4G17A 4QYHA 4ERWA 4DT9A 4QP2A 1I09A 2OIBA 3CGOA 4EQMA 4DTAA 3L8PA 4O4CA 3BEGA 4RX8A 2WMWA 3G15A 3R7IA 3G9LX 3QD0A 2R7IA 3DKOA 3F5UA 3FLNC 3CY2A 3QYZA 5E1EA 5FBOA 2JFMA 1XJDA 2E9PA 3GCVA 3MPMA 4L01A 4IBMA 5JRSA 2GNIA 2R3GA 3MYGA 1BUHA 4YC3A 5BMSA 3OY1A 3POOA 4X2GA 1J3HA 3QKLA 2I0HA 4FKLA 3CSVA 5B2LA 1VJYA 1ZYSA 3AQVA 2V22A 3C0GA 4G3CA 4HCUA 4YU2A 4LDTA 3OTUA 4XHKB 1UKHA 4F63A 1PXNA 5HNGA 4ONAA 1MP8A 3DB6A 3FC1X 3A7FA 4NKAA 4O2ZA 2HK5A 4O7LA 2E9UA 5D9HA 5L3AA 2WMTA 4NFMA 4MXYA 4QP1A 4BDAA 3II5A 2HCKA 4IE9A 4BI1A 3Q5ZA 2GHGA 4CZYB 2VTPA 2WMUA 3HAMA 1Q99A 5DR6A 5AR2A 3TMOA 3E7OA 3SX9A 1B38A 4H05A 5BVDA 3LCTA 4BKYA 5BVEA 2XS0A 5E8XA 1XMMA 4ZS0A 1IAJA 3Q9WA 3FMJA 1TQIA 5LOHA 4EH7A 5A4LA 3DAEA 3MFSA 4XYFA 5B2KA 2OGVA 5CZIA 4E26A 2XK3A 4WT6A 3ZO1A 4G6LA 4HGSA 4KA3A 3TKUA 2HY0A 1H8FA 1NVRA 3FAAA 2ZV7A 3PVWA 3WZEA 4D2WA 3OW4A 3BYMA 3I60A 3FQHA 4CD0A 4H3PA 2XIKA 5EQEA 2HW7A 5L4QA 4KNBA 4OW8A 4RIOA 5AAEA 5CF4A 3PXFA 4PL3A 4HVDA 3UO4A 4E5BA 3QX2A 3W0PA 4GSBA 2GCDA 3VO3A 1YWNA 4O83A 2C6EA 3SOCA 5M4CA 3UVRA 4RZVA 5LJJA 5LMKC 2HY81 3W0NA 2XNEA 4CYIA 4JLCA 4I0SA 5CU0A 4QMYA 4FNWA 2XP2A 4AZSA 5IQDA 4IB1A 2PZIA 3CBLA 2Y9QA 3CPBA 4MQ2A 4BBFA 3WZJA 4AT4A 4XMOA 3UIMA 1MRVA 2IVVA 3CD8A 3HLLA 5HG9A 4S31A 4WUAA 2HZIA 4CFNA 4EL9A 4M68A 5K4IA 3UODA 4RX5A 3QXPA 5DN3A 4ZIMA 4EH6A 2G15A 3BBWA 3HP5A 3MFRA 1X8BA 4E8AA 4RLLA 3PY1A 1VR2A 4RIXA 3LQ8A 4Q5HA 4Z16A 4FV9A 4RRVA 3P1AA 3UG2A 3KA0A 4F4PA 4F0FA 2ZM4A 5CU2A 4ZZMA 4G2FA 4IM2A 4M69B 4PX6A 4JIAA 1H1QA 2UW8A 4O27B 4EORA 3UZRA 4FEWA 2OZAA 5FWKK 3A60A 1JKKA 4C62A 2WTKC 3ZRKA 2G2IA 3NMUF 2OXYA 5EM7A 4KWPA 4BKJA 4MH7A 2QI8A 4L44A 4L7FA 3VAPA 4C37A 4AOIA 5AADA 3W0QA 3T3UA 4EK5A 2CN5A 1B39A 4UEUA 1IASA 1SVGA 2BTRA 4FIJA 5H2UA 2C1BA 2X6DA 5AIKA 5HEZA 4FGBA 1OMWA 5DHJA 3W0MA 2WTWA 3QUEA 3UNJA 2C69A 4AZEA 5A9UA 4W9WA 3VUHA 1DAWA 2WAJA 3QKKA 3O50A 4BL1A 4C4FA 5F9EA 4LOPA 4UYNA 1Z57A 1Q97A 4J97A 1GZNA 2C5XA 3ZUTA 4USFA 3QHWA 4MKCA 2QD9A 5HBEA 2QOBA 5IQFA 3OY3A 3DJ5A 2O64A 3R9DA 3ORLA 5FTGA 4OAUC 2XIRA 2PUUA 3JPVA 5DH3A 4BDIA 5EKNA 3R30A 3LW0A 4QMTA 4WD5A 3SA0A 5I5ZA 2PVHA 3QQJA 5IA5A 4WSYA 5B2MA 3LM5A 3JUHA 3NCGA 3RKBA 3KRWA 1ZY5A 4UWBA 4YJOA 4BIEA 2VO3A 3ERKA 3TCPA 4A4OA 2RFSA 3VBWA 3AT4A 5E8UA 5FDPA 3PXRA 4I21A 1G8SA 5IQHA 5DLSA 5FXQA 2UW7A 3RAIA 2IZSA 3PJ2A 4QTBA 4ZLOA 1YI3A 1W0XC 4QMLA 4EKKA 3TJDA 3OUKA 2PE1A 3BHHA 4FKUA 4L7SA 5LMAA 3NW6A 2XAMA 5HCYA 1ZRZA 5I9WA 2PL0A 5EQYA 3L9PA 5HE2A 1OIRA 4E5WA 2EVAA 3ATSA 1BL6A 5F20A 5HIEA 2W0JA 4ARKA 2F7ZE 3DTWA 5IA2A 4RG0A 5AMNA 4MYGA 5HIBA 2C3IB 4WNMA 2WIHA 1XBBA 5FQDC 1J1BA 4N70A 5C9CA 4O86A 4RVMA 2WMRA 3MGYA 4HVIA 2UZOA 1UNGA 4O0UA 1R3CA 3SG8A 3LFEA 3Q53A 4BBMA 4AXEA 3NLBA 3V5TA 3ZUVA 2R0IA 3NNVA 5DEWA 3W2SA 4RC3A 2BALA 4QMNA 2WZJA 3EQRA 3RINA 1H1WA 3FQSA 3PJ3A 1IG1A 3OCTA 1LEWA 2F4JA 3VS3A 4EUTA 3FMHA 3IKAA 2YLFA 3ZYAA 1MQBA 3COIA 2I1MA 2X8EA 5TT7A 2UW3A 4NW6A 5K5XA 3HMNA 3R0TA 4GT5A 3UZTA 5HBJA 3DBDA 4FV5A 5E91A 4CKIA 4OT6A 2P4IA 4CZUA 3NR9A 1Q8UA 2H9VA 2GPHA 2CDZA 1UV5A 1SVEA 4K18A 2QKWB 4F7LA 3W1FA 1PJKA 3ZH8A 4QYYA 3BX5A 4K11A 2QG7A 1PYXA 3QQLA 3HV4A 2CKQA 3OWLA 4BDCA 1OL2A 4R1VA 1IA8A 1JWHA 3BHYA 3LXPA 1J7UA 4FEUA 4X3FB 5ITAA 2RF9A 2WMQA 2UZEA 5FD2A 3QAME 2DYLA 3QZFA 5IG1A 3Q3BA 2QOFA 1O6KA 4BCJA 2WQEA 4C2WA 1DS5A 4ZOGA 2C1AA 5L8KA 2H96A 4UMPA 2YIQA 4MEDA 2X0OA 1YXSA 3OS3A 4O0SA 4EWQA 1L3RE 3GU6A 2W1CA 2YHVA 4YTIA 4XBUA 2X7OA 4NU1A 5T3QA 3R7OA 5K9IA 4G3DA 1SNXA 4GYGA 5AAFA 1FQ1B 4EK3A 4AAAA 3CE3A 2YM4A 4EBVA 2JDVA 3L9NA 2Z02A 3EWHA 2YIRA 3MH3A 3Q4ZA 4IADA 1E9HA 4D9UA 3F3TA 1OL5A 3ANRA 3GGFA 5ETCA 2FSTX 3LFAA 3POZA 4TKSA 4RIYB 3E63A 4PDPA 5EYCA 2YIYA 3NUXA 5JFWA 5EG3A 3WYYA 3F82A 5DBXA 2GMXA 5KMIA 4UYAA 3C0HA 4R5SA 3K5VA 5F94A 3Q60A 2WO6A 4F64A 3AT3A 4L53A 4IVDA 1U4DA 2HZNA 3V51A 2CCHA 3FE3A 3RPSA 5H9BA 3VVHA 3KXGA 4WG5A 5EKOA 4IWQA 4YJTA 4B7TA 2GQRA 2PTKA 3CKXA 3OTVA 1ND4A 4AFEA 4C35A 5CAPA 2CNVA 4MD9E 5CSXA 2PZPA 1VYWA 2GFSA 3IPHA 3OMVA 4FK6A