4GJ2A

Tyk2 (jh1) in complex with 2,6-dichloro-n-[2-({[(1r,2r)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Non-receptor tyrosine-protein kinase TYK2
total genus 91
structure length 288
sequence length 288
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gj2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gj2A01
4PY1A 4RVLA 3QQUA 3SLSA 4BCOA 4XH6A 3DZQA 4AE6A 2H6DA 3R21A 4L44A 5J7BA 1M7NA 2QD9A 4KIQA 4OTPA 3DA6A 5HOAA 4Z3VA 5FXRA 5IH4A 2FYSA 2W96B 3N4VA 4Y73A 4J95A 2WTWA 5AUYA 2UZNA 4UX9A 4CKJA 5D7AA 3W8QA 3UMXA 3LOKA 3BU5A 3ACJA 2UZOA 3DTWA 4CCBA 4FKSA 4L6QA 4EH4A 3NAXA 5K4IA 3FKOA 2ZB0A 4JJRA 4AG8A 4W8DA 3NNUA 5CI6A 5CSPA 4HZRA 3HV3A 4ANOA 2R7BA 1ZYCA 1XR1A 4PL3A 4G9CA 4CMOA 2O0UA 2R7IA 3HMPA 2B9IA 2OIBA 4WG5A 5BYYA 1H8FA 4MCVA 3OHTA 5KNJA 1PXNA 1V1KA 2YWVA 4FUYA 1WAKA 5H8EA 2XMYA 4FKPA 1PXLA 3QF9A 4Z9LA 3R7UA 3OEFX 3HDNA 4RA5A 3ENHA 3FPMA 1XWSA 3CPCA 3O51A 4AU8A 1ZYLA 4PV0A 5IQAA 4OBOA 3S2PA 1Q62A 5BMMA 4C38A 3AD5A 3EH9A 3UIMA 5E8VA 4QMQA 3EN6A 4M84A 3BLQA 4YC8A 4TYHB 3EQDA 1A9UA 5C8MA 3P1AA 1YOMA 1G3NA 5DI1A 3OXTA 3HMIA 1FGIA 3F5UA 4DT8A 3D5VA 4ZP5A 1PF8A 4HZSA 2UW3A 3POOA 5K4JA 4WA9A 5TF9A 2YITA 4W4XA 2ZJWA 4K6ZA 4E8AA 2G9XA 4O0YA 3FAAA 5HVJA 4ACMA 4ZZOA 3FI4A 5K0XA 4YTIA 3BI6A 4AA0A 4FSYA 2Z7SA 4G34A 5CLPA 3WOWA 4FNXA 4MKCA 4CFVA 3IECA 3ZXTA 2J0MB 3NPCA 4C34A 4Y46A 3FZTA 4C59A 3V5TA 2JAMA 2BDWA 2WQBA 3DKGA 2QOQA 5CI7A 4GL9A 4G3EA 4MNEA 4M69B 4L9IA 4YR8A 5CAVA 3I5ZA 3MH0A 5CAOA 1IAJA 3KXGA 4FYOA 4LI5A 3H10A 3SHEA 2XK8A 4L7SA 4A9TA 3DBEA 4USDA 4QQTA 5GHVA 2V55A 3QC4A 4ZY5A 3T9TA 4YTFA 3IW7A 3NW7A 4QMWA 3CTHA 5AR3A 5H3QA 2GMXA 1W84A 3DFAA 3MPAA 3TV4A 3KMWA 2RF9A 3TUCA 4E5WA 4EQUA 2FB8A 4UWCA 2JBOA 2R3PA 4M97A 3ZM4A 2F57A 2VWWA 4UV0A 4ZSJA 4C4JA 4U45A 1G8SA 5CASA 5J7HA 3U6JA 5D10A 3G5DA 5AR5A 4PL5A 4Y85A 4CFMA 4F7NA 1QMZA 2RGPA 5HLNA 1Y6BA 2C47A 1VYWA 5HG7A 3C4FA 4BGGA 3NUUA 2WMBA 4N0SA 4FSZA 3PXZA 4NM3A 4GV1A 4APCA 4ASDA 5DYJA 4EH7A 5HI2A 3NYOA 4BRXA 1O9UA 4GT3A 1RJBA 4QMXA 4IVAA 1UNLA 3CGOA 3GU6A 3PFQA 2Y4PA 4PDYA 5T6KA 3M2WA 4U81A 4YBJA 5D7VA 3VVHA 5BUJA 3FLZA 4RWIA 2BALA 1F3MC 3GI3A 2I40A 4O0TA 1V0OA 3UVQA 1UU8A 3O2MA 1YDSE 2EUFB 3IDPA 4XRJA 4BKYA 4Y8DA 3NX8A 3W2SA 4ZTRA 1Q8TA 4XOZA 3ZRLA 3IW8A 2GNIA 4QP2A 1L3RE 2YAKA 4FF8A 4DGNA 4KRDA 4OT5A 3LXNA 4LV5A 2B55A 1R1WA 4C3RA 5J5TA 5KHXA 5IUHA 1WVWA 1YXSA 3PJ3A 4ONAA 1VR2A 4FSQA 1K9AA 1KWPA 3KA0A 3DNEA 2GFCA 5I9UA 3HA8A 3QTIA 3CR0A 4GG7A 2XBAA 3GP0A 4RLLA 5EK7A 5GJFA 3EQIA 2UZEA 5LCJA 3QKMA 3K54A 3NR9A 3P78A 5JFWA 5L8JA 5C8KA 2CPKE 2GQSA 3TIZA 4FKGA 5M4FA 4RIWA 5I9WA 5B2MA 1WBOA 2RFSA 4OTFA 2JAVA 3FZSA 3UYTA 5AUUA 3CP9A 4F6UA 3SGCA 1OUYA 3WZUA 3WE4A 4C4FA 4CRLA 4GCJA 4CGAA 2ZDTA 4FEXA 4YJTA 5G6VA 2Y6MA 3AQVA 2VX1A 3R9DA 4TYHA 4F4PA 5JQ8A 5M4CA 4UZHA 4XG7A 3B8RA 4DFYA 4FTUA 4HVSA 5E8YA 3MJ2A 4YLKA 3SKCA 1KE9A 1YI3A 5LWMA 3UQCA 2OK1A 2QR7A 1L8TA 1FBNA 4IWQA 4EH8A 5EW9A 2JDRA 3G2FA 3Q2JA 5KMNA 1BKXA 4LRMA 1H08A 4L68A 2QOIA 4AOJA 5HBJA 3SX9A 5KCVA 3PSCA 2BZHB 2XCKA 4NM0A 4U6RA 3OP5A 4BYJA 3HRBA 4RRVA 4BHZA 3C4CA 3I6WA 2A19B 3PSDA 1M14A 4AZFA 4E6CA 3UGCA 1OECA 1JNKA 3C50A 4FNYA 4NIFA 3PZHA 5HNBA 3GCQA 3KCFA 2W0JA 4XHKB 3PPKA 2F2UA 3F7ZA 3DJ5A 2CCIA 3DBQA 4JL9A 5J9ZA 2JKMA 1XBAA 5E8XA 4ZTMA 2J2IB 1R0EA 2J9MA 4I5HA 2BKKA 4FSRA 3U6IA 4AFJA 3FQSA 5AUZA 1H1RA 3I1AA 4U40A 3KXXA 4ENYA 3P4KA 4WG4A 1FVRA 2VWUA 2UZBA 3IDCA 3OBGA 2FH9A 4R7BA 1TKIA 1BYGA 4C02A 3S1HA 4TL0A 3MV5A 2QOKA 5CAQA 4CFNA 5I0BA 1ZY5A 2ZM3A 3KL8A 3W32A 2UW8A 4F65A 2UUEA 2NPQA 2W4JA 3FDNA 4G6LA 2XEYA 1URWA 3S3IA 3WI6A 5ANEA 3G9NA 4R3PA 2J0LA 5EI2A 4M8TA 1G8AA 5HO8A 4NM5A 2QKRA 4QQJA 4Z7HA 2BHHA 2IN6A 4YO4A 3VAPA 1ZYJA 5DBXA 1R3CA 2JITA 2IO6A 3RMFA 4AZVA 2J5FA 2DYLA 3O50A 5EM7A 5EYKA 4NTSA 1H0WA 3SW4A 2XKEA 3TTJA 2JKKA 4EK3A 3C13A 4DFUA 4NWMA 4FIEA 4D0WA 1WBWA 3T3VA 2C1AA 4JDIA 4UN0C 2XRWA 3BHYA 2W4KA 4I1ZA 3EZVA 3LXKA 4DHFA 3D2IA 4QMOA 3R71A 2YLEA 4GIHA 5AM7A 4AACA 4E6DA 4HVHA 5DG5A 2OLCA 4Y83A 3TUDA 4NW6A 5A4CA 4O7ZA 2P4IA 2HWPA 5FEDA 4AW1A 3AMYA 5ICPA 3Q2MA 4JDKA 1J7IA 4IFCA 4IB3A 1WFCA 4L00A 3QCYA 3H0YA 4QTBA 2BFYA 3WF6A 4A4OA 4M12A 4BC6A 2PZRA 3IOPA 3SRVB 5M51A 1M17A 4U8ZA 5DR9A 2XS0A 2QOFA 4M0YA 3BQRA 4RJ6A 4UY9A 3OCGA 1GIJA 3P86A 3PSBA 3R9OA 3OWPA 1FOTA 4OUCA 3DB8A 4RGJA 1GZKA 2BRBA 3K5VA 4BCNA 3BEAA 2ONLC 4YTHA 4A9SA 3HV6A 3GUBA 3DLZA 2ZV2A 4WBBB 4IX6A 4NUSA 3UNKA 3PXRA 4I23A 4Y5QA 4DGGA 2O3PA 1CM8A 3F61A 3UTOA 3VUDA 5J1WA 2JD5A 3P7BA 4ALUA 3VQHA 2IW6A 4DTAA 5GINE 3OZ6A 4O83A 2I1MA 3VBXA 4PX6A 4YPDA 3TWJA 4HCTA 5JEBA 5E92A 4YJSA 4FI1A 3KCKA 3TL8A 1Q8ZA 4HVIA 2YDKA 4QMYA 5FBOA 5A4TA 4J8MA 2IVSA 2WZJA 3PIYA 1SVGA 5HEZA 1MQBA 1OITA 5FRIA 3GCSA 3LZBA 4L45A 1BMKA 3ORNA 4RJ3A 5HIBA 5BUEA 2W99B 3LFFA 5IEXA 2O2UA 3OW4A 4L42A 5C26A 2XNPA 5IZFA 4Q5HA 3BPRA 1JLUE 2UZVA 2IVUA 4QTDA 4Z7GA 3ORKA 4V05A 4BTJA 1H28A 2X4FA 1ATPE 4PP9A 2GS7A 3W8LA 5M57A 3RZFA 4OLIA 1I09A 1K3AA 3P08A 5I9YA 4O7SA 1UV5A 4Y5HA 5KMIA 5IKWA 2ZM4A 4BKZA 3KB7A 3JUHA 5JGAA 3KVXA 2UW6A 4ERWA 4QMMA 4XBUA 2R3FA 3EN7A 5CSXA 3ZONA 4YJVA 4LG4A 3BRBA 1PXOA 1LPUA 3DB6A 4YPSA 5E1EA 4FIGA 4WD5A 1GAGA 2QHNA 5BYZA 3OBJA 3BYSA 3R7EA 3NS9A 4BBEA 4EK8A 4RC2A 1A06A 4GEOA 4E7WA 5AUTA 3UBDA 3QXOA 3DT1A 3UODA 5I4NA 4BDCA 4OBQA 3ZFMA 3FY2A 4O0SA 3F3VA 3OFMA 3QAME 4DH5A 4UZDA 4FKUA 4IM2A 3DXQA 4EOMA 1YI6A 5IA1A 2RFDA 5CU0A 5IA0A 4YU2A 1ZARA 2QI8A 3HP5A 1YW2A 4JG6A 2ITYA 4BTMA 4CLIA 4PNKA 4QYFA 4LRKA 1ZYDA 3LCOA 3LFDA 3RVGA 1G5SA 4EOSA 1RQQA 1Q99A 3GXLA 4E5BA 4KIOA 1KE6A 3OCTA 1NY3A 2IW9A 3QZHA 3ZFXA 3CJFA 4ITIA 3CGFA 5HQ0A 3TNHA 4XX9A 3NWWA 1ZOGA 3EL7A 1XH6A 3QQGA 2GS2A 3REPA 3PRFA 3Q04A 3FEGA 3UO5A 4BTKA 2XVDA 3LLTA 2Y7JA 4O2PA 4LOOA 4FTOA 5J9YA 4FIJA 5CZHA 2J0KA 2ZB1A 1JVPP 4XP0A 4RA4A 4LV8A 2QOLA 4EJNA 2ONLA 3ZYAA 5A4QA 3GU4A 4FL3A 4XG9A 4BCQA 5HE1A 2C0OA 3R28A 5AP4A 3WIKA 3AT3A 4KIKA 4XCUA 2QOCA 3NIEA 1Q4LA 4IAYA 2VAGA 4XV2A 2YCRA 4XV9A 3F2AA 3W55A 3G6HA 3Q4TA 1YOLA 2HXLA 2X6DA 3U8WA 2UZTA 4Z16A 1UNGA 3LAUA 4I0TA 5GJDA 4AZWA 2CKEA 4YJRA 3V8SA 5HX6A 4K18A 4O2ZA 4IDVA 3HNGA 4ZS4A 3MPMA 3E87A 4O7WA 2C5NA 2PVKA 3A60A 3PRIA 3PIZA 3L8VA 4K9YA 3TN8A 2R3KA 4D1SA 4NKAA 5HO6A 2JFLA 3UOKA 3U9NA 4Q9ZA 3DAKA 2BHEA 2UZWE 3FLSA 2WQEA 3A7HA 2OICA 2BFXA 3QTSA 4RIYB 4NCTA 3ZLWA 3AC5A 3LJ2A 2XYNA 4ANNA 4CZUA 1RE8A 2BAJA 2XNGA 4X2KA 3BHTA 5FM3A 2Y8OA 4IB0A 4L46A 4D2SA 3KRXA 3BWJA 2PZ5A 2P2IA 5HO7A 3VJNA 5EOBA 4YSJA 3QWKA 4EK6A 4DCAA 4L53A 1WBNA 5E8UA 4CCUA 1ND4A 3MGYA 3BQCA 3W2QA 3RAHA 3E88A 4ZTNA 4F7LA 4K1BA 4GVAA 3ZDUA 3V5JA 4D58A 4MQ1A 4F99A 1W98A 1F0QA 4GYGA 3D14A 3QLFA 3V5PA 2P55A 3FL4A 3BGQA 1H26A 4FKIA 2Z02A 3KRJA 2GNGA 4I4FA 4QP9A 1E9HA 2I6LA 3VJOA 3W1FA 4EYMA 4JBVA 2VV9A 4FV9A 1WVXA 2ITNA 2BIYA 2Z7QA 4B9DA 5L3AA 4GUEA 3V5QA 4R77A 5E90A 4H3BA 5CSWA 4FKQA 4TWOA 2PVRA 3F3UA 3I7CA 3HYHA 4KBKA 4HVDA 2WU7A 4EH6A 4O1OA 2WMQA 3SG8A 1OL2A 5AX9A 3KVWA 3TZ8A 4TZRA 3ORZA 2WU6A 4DC2A 4H58A 5AR4A 4WSQA 3NW5A 3C4EA 3LPBA 4JG8A 4WIHA 3E7VA 3E64A 3Q9WA 4NTTA 3R7IA 4KIKB 5DOSA 2PUPA 5LMKC 4TYIA 1PXPA 2SRCA 3DU8A 5CEKA 4KD1A 3H9RA 3D15A 3FKLA 3QQLA 4IAZA 4R1VA 5E8ZA 4CRSA 4P90A 2VU3A 1ZMVA 4HCUA 2WTVA 3TDVA 3PY0A 2W5BA 3VNTA 4KB8A 3A7IA 4AN9A 5EG3A 1ZZLA 3ID6C 3H4JA 1XKKA 4KSPA 2IZUA 5J8IA 3VRYA 4AW0A 3BYMA 3NYVA 1REKA 1V0BA 4FTTA 2YM7A 2UZUE 4YBKA 3R9HA 2CLXA 1H4LA 2HZ0A 5LXMA 4CYIA 4F0GA 3DTCA 3CKXA 3KXHA 4S32A 4EH5A 5CEMA 5CWZA 3QTWA 4V04A 3VS6A 3Q3BA 3HVCA 4D5KA 2X8DA 4IZAA 4R78A 1UVRA 1J7UA 2C6DA 2ITUA 4F9AA 3EQBA 5BPYA 2YEXA 4UMPA 4NIFB 3G6GA 2XJ0A 3VS0A 5EKOA 3PE2A 5CQWA 1YRPA 3QUPA 4DFXE 2I7QA 1B39A 3PIXA 4XG8A 4CZYB 2YERA 3MB7A 2UV2A 3ANRA 4W9XA 1CKIA 4K8AA 5HTBA 4Q5EA 2E9OA 2VWVA 4G3GA 3EQFA 5AV4A 4BDBA 1GZOA 2WTKC 4S2ZA 5HGIA 3EYGA 3QQHA 2J0IA 4F1OA 5IA2A 3TEIA 3OVVA 5GNKA 2R3QA 4RFYA 4FGRA 1XH5A 4R8QA 3TI1A 2BROA 3DAEA 4UYAA 5IPJA 3EMGA 4KINA 4FG9A 2RG6A 3RPRA 1OL5A 4FZAB 3IW4A 5BQ0A 5AM6A 3LCKA 4AE9A 3DS6A 5B2KA 4D55A 2QOOA 3O8TA 4O0RA 2X2MA 3R8MA 4KS8A 2QLQA 2ETRA 3EIDA 4KSQA 4P7EA 4AAAA 4FL2A 3O0GA 2FSMX 5ETFA 5M08A 3PY3A 3I81A 2O65A 2VO3A 2XIXA 4MNEB 5FEEA 2ITVA 2OF2A 3NVKI 4WG3A 3AD6A 1K2PA 3Q60A 4HYIA 3R7OA 3WBLA 4A7CA 5KUPA 2A4LA 4MWHA 3TNPC 3P23A 4FTLA 4AN2A 1IAHA 3CQEA 3FQEA 4ZTSA 2IG7A 1OGUA 2BZJA 1XJDA 3QHRA 4RC3A 4D5HA 5KBQA 1SNUA 4OAVB 4WNPA 1FMOE 1WMKA 4MD9E 3WYYA 2PTKA 1YWVA 3VUKA 3LFBA 2QR8A 4FV0A 5ACKA 5FTQA 1JWHA 4DEBA 5BVOA 3NCZA 3IONA 3IW5A 2DWBA 1S9JA 5HZNA 1PHKA 3NYXA 4I6HA 4X2NA 4MXAA 3FY0A 4MXCA 3ENMA 2PZIA 2QHMA 3UP7A 3CBLA 3QQJA 1KE8A 4HW7A 4U9AA 1H1PA 1HOWA 5JRSA 3P7CA 4EC9A 5B0XA 2CMWA 1QCFA 2ZMCA 3BLRA 2H34A 3KXMA 1YDRE 4U79A 3LCSA 3U4UA 3UNJA 3ZEPA 1E1VA 2XNNA 4NL0A 5A6OA 2HYYA 3OTVA 1U46A 2C5VA 2C6MA 3DK6A 4LRJA 1MUOA 1JBPE 3N9XA 3ZO4A 4TNBA 2R3GA 3E7OA 2JEDA 4FZDB 5CTPA 2EB3A 2IVVA 3BZ3A 2BRNA 4BCFA 3CC6A 2WEIA 5FEQA 4B0GA 4C36A 3UOHA 3R1SA 3ZSGA 2PPQA 1H1WA 5I9XA 4FV5A 4W8EA 1Q97A 2J51A 5KMLA 1J7LA 4IMYA 1BLXA 2VTTA 4NH1A 3KRRA 3PXFA 3GFEA 5EYCA 1YXXA 3TG1A 2O63A 2E9VA 3U9CA 4LQMA 4M69A 4XLIA 4EHGA 3CEKA 2QQ7A 2CKOA 4RJ8A 4FVRA 4F9YA 4H3PA 3F2RA 4AS0A 4DITA 3BHUA 3E3PA 5IEVA 3RHXA 2KTYA 1LR4A 4MVFA 4Y95A 3A8WA 2VD5A 3VC4A 3EFLA 4ERKA 2RFNA 4KBAA 4FEVA 4BR3A 4DTBA 4RSSA 2YN8A 2OIQA 3MBLA 4L67A 3LQ8A 4IEBA 3QX4A 5ANIA 3UOLA 4FL1A 2YIRA 3GC8A 3MH2A 4X3FA 3TJDA 3TZMA 3ZBXA 2CKPA 3ALNA 2C5YA 5LVOA 2GU8A 4ZTQA 1WVYA 5LCKA 1DM2A 4LOPA 3VBYA 3WZJA 3ZTXA 5EM8A 1YKRA 2BUJA 2QODA 4RZVA 3ZUTA 3TUBA 4DEEA 2XM9A 2YCSA 5L6WL 4XUFA 4I5MA 4QP3A 4WNOA 2BILB 4K77A 4KIPA 5KX8A 2BR1A 5DNRA 4GFOA 4K11A 3ORIA 4RJ5A 4B7TA 1YWRA 4LGHA 3RINA 4UWBA 2OWBA 5H8BA 3K5UA 4O86A 2VUWA 4AT4A 4NU1A 4MX9A 5F9EA 4AN3A 3FMHA 1XBCA 2C6TA 3R00A 4PDSA 2W1ZA 4ID7A 4EOPA 3VS4A 4LL0A 4ZY4A 1JKKA 3DOGA 4BZDA 4USFA 2QURA 3E92A 4FG8A 2BDFA 5KMMA 1IA9A 3I5NA 2PUUA 5ACBC 4F6WA 4KWPA 4CFUA 2BMCA 2V7OA 3EQRA 3MH1A 3PVGA 4WSYA 5K9IA 2J50A 3CKWA 4GT4A 3DBFA 3MN3A 3QZGA 4X6QC 2Z7LA 2VTSA 4EL9A 5KMJA 2OZAA 3R30A 4RX7A 4YJNA 1IASA 4M66A 2EU9A 3QRJA 4YJOA 4ACCA 3NW6A 4AA5A 2EXCX 4EOLA 2C6LA 3A99A 2WAJA 4C57A 2VTRA 2XIRA 4FSMA 3MVHA 2C30A 4F08A 4CTCA 1GNGA 5BVKA 2X39A 4YC6A 2F49A 3I79A 3P5KA 4O27B 4L3LA 3KMMA 4EOKA 4ZJVA 2C6KA 2UW9A 4NJ3A 2OZAB 3QQFA 4TYGA 1APME 3HAVA 3SXSA 3JVSA 3N51A 3ZEWA 4JBQA 3NUSA 4CFWA 3FPQA 2R5TA 5ANGA 5CNOA 2WMUA 5KZIA 1EH4A 5AP5A 5JFVA 3WYXA 3S00A 3ATSA 3RPOA 3SG9A 3VS3A 4PP7A 4O1PA 4MWIA 3Q5IA 4Y72A 4A9UA 4FTQA 3FZ1A 2E9NA 4G16A 1Q8WA 5J9LA 2LGCA 1BUHA 2GHGA 4QRCA 4IC8A 1JKLA 2BRHA 5DT4A 3R02A 4BCMA 4C33A 3GU5A 4DFBA 5CF4A 3RK7A 5HHWA 5TO8A 2F2CB 3U51A 5L2IA 1PKDA 3NGAA 2P3GX 4DG2E 4D2VA 5I3OA 3VUGA 1SZMA 4BZOA 3EOCA 3CY3A 4RIWB 3RWQA 2XP2A 2YWPA 2HZIA 4TWPA 4X7QA 4B8LA 3AT4A 3GENA 1LEZA 4UXQA 2GS6A 5I3RA 4YP8A 4CQEA 3FMNA 4HGSA 4G1WA 5HE3A 3VF9A 3SC1A 3TM0A 1Y6AA 2XIYA 1M2PA 3ALOA 3I60A 4Q9SA 4RIXA 4BYIA 5EDQA 4FSUA 5LMBA 2UVXA 3CQWA 3FLQA 3O8PA 5JT2A 4E3CA 3R8VA 4L43A 3NUYA 4ASZA 1X8BA 3FZRA 4CV8A 5C4LA 4CG8A 1Q5KA 3EJ1A 2PU8A 3IGOA 4DEGA 3RWPA 3LCTA 3QQKA 1O6KA 1GY3A 2VN9A 3M11A 4I5CA 5TOZA 4RX9A 2P33A 3ITZA 2I0EA 4DFLA 2Z2WA 3IW6A 1HCKA 2XKCA 2YJSA 5C03A 4MXZA 5JKGA 4PTGA 4A4LA 5HCZA 1QPCA 3L9LA 4DLJA 2F7XE 2C6IA 4HCVA 4X2JA 5FLFA 3RI1A 4BI2A 3FI2A 2B9FA 4TW9A 1PRYA 4DAWA 1WBTA 5CT0A 4G5JA 4U42A 3Q6WA 4APPA 4QMNA 5AA8A 2GQRA 2CSNA 2VTIA 4C3PA 4EJ7A 4TPTA 4FKLA 3EYHA 2W1CA 4ALWA 1PXMA 3TDWA 3OCBA 3KXNA 5D41A 4IWOA 3D7TB 2W7XA 3MTFA 2OI4X 4KKHA 4V0GB 4ZLOA 2CKQA 4ZIMA 4BKJA 2HWOA 4XP2A 5JMSA 4EORA 2GDOA 4AF3A 4J99A 4JBPA 3PP0A 4IXPA 3QUEA 2OF4A 2OIDA 4FTNA 2VTQA 4V01A 2VWXA 2WB8A 3VULA 4UXLA 2R3LA 1KOAA 5HVKA 4J53A 2WMSA 2VTMA 4IWPA 3AD4A 3KXZA 4X6RA 4C3FA 5DT0A 2WMRA 4CTBA 4E6AA 4O0XA 2XH5A 4C2WA 1PXJA 2XEZA 3C4WA 3COKA 4OGRA 5DMZA 3ULZA 3SAYA 3POZA 2R3HA 2WIHA 3QD3A 3BX5A 3WIGA 4JLCA 1YDTE 2RIOA 3GU7A 3F3WA 4A06A 3S0OA 4ZZNA 3CQUA 4LUEA 2QOHA 4MD8E 5BVEA 2W5AA 4I5PA 3RPSA 1QL6A 3CE3A 5CU4A 3T8OA 4MBLA 3TNQB 1KOBA 4QP7A 5FBNC 1ZOHA 3BHVA 3R1NA 1H0VA 2HW7A 4FC0A 5AX3A 4BDDA 3HAMA 4FK3A 2JKOA 3AXWA 5AR7A 5IA5A 3V3VA 3H9OA 1YXUA 4EOOA 3LQ3A 2WMTA 5A4LA 3GC7A 3ODYX 3VBWA 4E26A 3UZTA 4DT9A 1OMWA 4FTJA 3Q4ZA 4JG7A 5HG5A 2QOBA 5AR2A 1FQ1B 1W8CA 5AEPA 2ZDUA 3LFCA 5E4HA 1JQHA 3KGAA 3NLBA 2DQ7X 1OKWA 3FMJA 3QRUA 5K5NA 3CJGA 3EKKA 3IKAA 4QYHA 3QU0A 4EK5A 2PVMA 4AXAA 4BDJA 2GNHA 2OJGA 4MF0A 4NYEA 3F88A 4E4NA 4GKIA 3ZSHA 3ET7A 1OZ1A 4CMTA 3ELJA 4FTRA 4QP8A 2JDSA 5EQPA 2XF0A 3HA6A 5GZ8A 4DG0E 4BDAA 2I0YA 4X21A 4D4SA 3W2CA 2VTLA 2QO7A 2BIKB 2X9FA 3FHRA 3O17A 4IX5A 2BRGA 3THBA 1PJKA 2UW0A 2R4BA 4JXFA 3EQHA 5GZAA 3NIZA 5AMNA 3SOCA 3SV0A 4ZLYA 3FKNA 1U54B 2UW7A 3CCNA 1GZNA 3R8UA 4NEUA 4QMPA 3LVPA 4AOIA 2WHBA 1W0XC 2ITQA 4BCJA 3QTXA 4EH9A 3Q4CA 3Q5ZA 2JLDA 5HU9A 3LXLA 1OPLA 4XG6A 3GVUA 5CEOA 4IWDA 2FA2A 4N6YA 4RVTA 4C2VA 3MJ1A 4FV2A 3LM5A 4E4XA 4EH2A 4QO9A 3IGGA 4QNYA 2ZV8A 1IEPA 2QC6A 3OMVA 3ORXA 4MD7E 3UC4A 2LAVA 3L9MA 3UO4A 3P9JA 4CNHA 4U7ZA 4EWHA 1P14A 3T9IA 4RQVA 2ZV9A 4BICA 5A4EA 2B0QA 2PK9A 3MB6A 4FK6A 3PG1A 5L2WA 2ZV7A 3KRLA 3A7FA 1Y57A 2IVTA 4RPVA 2Q0BA 5IH5A 4WRSA 4WBOA 5LARA 5E7RA 3H3CA 3QD2B 3PXQA 4TNDA 3QRTA 4C7TA 2IZSA 4USEA 2AC5A 2PUNA 3D0EA 4O21A 2ACXA 5C27A 5CX9A 3E5AA 3ZOSA 2EXEA 4S33A 4IE9A 4RIOA 3ZHPC 3QXPA 3TZ7A 4IACA 5EI6A 1ZLTA 5HLPA 4DFZE 3BE9A 3SD0A 3IK3A 1Y8GA 4AA4A 4B99A 4CSVA 4L8MA 5CSVA 2WMAA 3C51A 3MFSA 5ANJA 1FMKA 3N4UA 2A1AB 4FTKA 4FZFB 1KV1A 3C7QA 4JDHA 1XH7A 4ZSLA 3HUCA 2WFYA 4FSWA 2OW3A 2J4ZA 4ZEGA 1RDQE 5M44A 3FC1X 4D4VA 4QPSA 2GCDA 4ZSGA 4PWNA 2JIVA 3AGLA 3FL5A 3V8WA 5E9EA 2JDTA 4FKWA 4QP4A 3AC2A 3MFRA 3R6XA 3PE1A 4QPMA 5HCYA 3E8CA 1Y8YA 2GHLA 2W17A 3QBNA 4WUAA 1U5RA 5FP5A 1QPEA 2QKWB 3BCEA 4LL5A 2FSOX 3FMMA 3NUPA 4OTGA 5EDRA 4E6QA 4FMQA 4L7FA 4AZSA 3D5WA 2C6EA 1PMEA 1ZMUA 2RFEA 4BWKA 3DXPA 4DBXA 1J1CA 5JRQA 4W9WA 1OL7A 4DCEA 3ZLXA 2G2FA 4N70A 2X8IA 3WZDA 2C3KA 3EN9A 2B7AA 5FWKK 2ESMA 1XBBA 3CTJA 5A46A 3OOGA 2C3LA 4QP6A 3G15A 2WO6A 3B2WA 5FQDC 4C8BA 1I44A 1Q3DA 2XYUA 3FE3A 1RW8A 2OFVA 4DH8A 2Y6OA 3E93A 5LJJA 2HAKA 5CAPA 5IQHA 3CXWA 3N4TA 4EOJA 4W4WA 4RMZA 2OU7A 4YZBA 4M15A 4RIYA 1U59A 2FUMA 3EFWA 4NK9A 5EHOA 3ODZX 3ROYA 5AP2A 2C68A 2QONA 4F09A 4I93A 5AP6A 4GT5A 4F6SA 4CEGA 3QGWA 3LW0A 5ANOA 1YHVA 2PE0A 3II5A 1H07A 1ZXEA 4CYJA 5IU2A 2UVYA 2UW4A 3RM7A 2EXMA 3UZPA 2PE2A 4I92A 4D4RA 3W33A 3JR1A 4GW8A 4OW8A 2VTAA 4AW2A 4N6ZA 3DXNA 4PUZA 2WNTA 3BGZA 5AP1A 3RAWA 3W2RA 2HENA 3OW3A 3TCPA 1OBDA 5M55A 2Q83A 1KSWA 3I0QA 4IX3A 4FIIA 5AUWA 2WELA 2GNLA 4KAOA 4KNBA 5HD7A 2YIXA 2E9UA 4QMVA 3R8ZA 3PDTA 2BPMA 4QD6A 2F7ZE 5CNNA 4XG3A 5JGDA 4R7IA 2NRYA 5CENA 5AAGA 1H25A 3BE2A 4OT6A 5BVFA 4FKRA 4PDOA 5CVGA 5AV0A 5DEWA 4I20A 4BDIA 5LVMA 3LFQA 5BVNA 3EHAA 2REIA 2YLFA 3D5XA 3E8DA 4JX3A 4G6OA 2YAAA 5JQ5A 3I4BA 2ITWA 2OJJA 1PY5A 3LFEA 4ANBA 3PJCA 3DKOA 2BTRA 4DF3A 4ZOGA 3BELA 5A6NA 2R64A 3TNIA 5B2LA 5CVHA 4ANMA 3VO3A 3DY7A 4MBJA 4FV1A 3GCVA 3UPZA 3QHWA 4ZMEA 4GSBA 4HNFA 2XK6A 2B9HA 2OJ9A 2GTNA 2ITXA 2UW5A 3RPVA 3COIA 1R0PA 5LVPA 4FVQA 4AGWA 2R3MA 2XZSA 2W1EA 2OXDA 2FGIA 1TVOA 5D11A 2C6OA 3GB2A 2I0VA 2CJMA 3PJ1A 3FV8A 5FXQA 4MXYA 4MAOA 4DGOA 5BUIA 4YZ9A 2VTJA 5C01A 3VBVA 3PPZA 4IIRA 3EL8A 1CDKA 3SA0A 1T45A 5CEQA 5E8SA 2EVAA 5J87A 2JDOA 3SRVA 4B8MA 2VGPA 3SW7A 1ZZ2A 4G9RA 2PMLX 3W16A 2XJ2A 5E8WA 4EONA 1DI9A 3FUPA 1CKJA 5L4QA 5A3XA 4AFEA 4PTCA 3ZM9A 2CN8A 2XUUA 4AQCA 2W1FA 4IAFA 4IH8A 2VTNA 4PMMA 4JQEA 2R3OA 3R7YA 4DLIA 1V0PA 4FG7A 4GRBA 5TR6A 3C0HA 2GTMA 3OCSA 5D1JA 3B2TA 4CFXA 4HYHA 2JFMA 4IVBA 5CS6A 4TTHB 3R9RA 2XK3A 3BYOA 3EN5A 3QYWA 2C4GA 4UMTA 5HNGA 4BDGA 4ZXTA 5CU6A 5IA3A 5C1QB 3HV7A 3QRIA 2YJRA 3GOKA 4IB5A 3SOAA 5LQFA 1JPAA 1DAWA 4FBXA 5J95A 2X2KA 4AZEA 1OUKA 4MTAA 5HLWA 2R3RA 2HK5A 2IZTA 4QPAA 2YM5A 3QKLA 5DH3A 4P4CA 3E63A 1M7QA 2NRUA 2XIZA 3FI3A 3FMLA 3JPVA 2C0IA 3A7JA 4GU9A 4JQ7A 3W2PA 1OBGA 3PA4A 4FA2A 4UMUA 4AGUA 3VS5A 3ZZWA 3KN6A 3GGFA 3WZEA 4S34A 2YM6A 3A2CA 4HPUE 3M1SA 4FKVA 5LVNA 3AC4A 3DPKA 4PPAA 4XG2A 4UBAA 2X2LA 4PL4A 3DFCB 5H9BA 4HYSA 5JSMA 2HXQA 2XKDA 4O6EA 3ZO2A 3VS7A 1U5QA 3RK9A 1Q3WA 4CKIA 1GZ8A 4HOKA 5LOHA 4RFMA 2XM8A 4RLKA 1OI9A 4UWYA 3TZ9A 3ANQA 3NYNA 2OG8A 3F3ZA 3DJ7A 4CKRA 3JXWA 3R2YA 2QO2A 1NVQA 3GU8A 5KMOA 4FZ6A 4RVMA 4EHZA 3L8XA 2J6MA 5IQCA 4J97A 4J1RA 4EK4A 1XO2B 3NCGA 1KE5A 2VWBA 4YNEA 1M2RA 2PWLA 4WRGA 3AMAA 1GOLA 5KMKA 2H9VA 4HGEA 4AX8A 2ZMDA 3CD8A 2WTIA 3BYUA 1UWJA 5IA4A 1ZMWA 1ZAOA 1NVRA 4NFMA 4PTEA 4G2FA 3V8TA 2YM4A 4H1MA 2Z8CA 2CGXA 3PWDA 2OFUA 4FODA 4KKGA 2GNFA 4GIIA 4O84A 4PDPA 3V04A 3FXXA 4QMLA 5EI8A 3UIBA 4FVPA 4ANSA 3F3TA 5FP6A 1QPJA 3BEGA 4JR7A 5J5SA 3NSZA 3O7LD 4R5YA 5CQUA 4GU6A 4K33A 3O71A 3D7ZA 5I9VA 3UQFA 3V5LA 4UYNA 4YMJA 1WBVA 3OT8A 5IMEA 2XRUA 3UOJA 1UU9A 2P0CA 3PJ8A 4YURA 3SXFA 5EQEA 1JSUA 1OM1A 3OWKA 4NKSA 4O22A 4X2FA 2QG7A 4YZNA 3IG7A 3Q32A 4QYYA 2BAQA 5FDXA 2X0GA 4AGCA 4HGLA 1VEBA 4BHNA 2BTSA 1JSVA 4M13A 5AUVA 1DS5A 5G1XA 4L01A 4ZSAA 2XA4A 2XK9A 4RG0A 1DI8A 4BGQA 4GUBA 4M14A 2GNJA 3Q9XA 4IAIA 4MH7A 5EW3A 5L6PA 5EQYA 1NXKA 2ITTA 2XB7A 3PG3A 4D2WA 3DJ6A 3DQWA 4PPBA 3QFVA 3AG9A 3PVUA 2PE1A 1WCCA 3QCQA 3OWJA 1JKSA 3MA6A 4JT3A 4X3JA 1WZYA 2ETMA 4HGTA 4I3ZA 3HMMA 2WQMA 3PZEA 5LVLA 3MVLA 3VF8A 4FUXA 3VS2A 3ZRMA 3JVRA 4DTKA 3RTPA 2Z7RA 2W1HA 3E8EA 3GEQA 3P0MA 4DGMA 3F9NA 3G90X 3CSVA 1Y91A 5F20A 3KULB 4BIEA 2YHVA 4IFGA 4UEUA 4PQNA 2YIQA 5EDPA 4C62A 3QALE 4BGHA 3C5IA 4JI9A 3LQ5A 2YZAA 2WQOA 4NFNA 2E2BA 2VNWA 3PA3A 3LE6A 3H0ZA 1FVTA 1XH8A 4U44A 3QA0A 4BF2A 5HU3A 4FT7A 1W7HA 2XCHA 4FT9A 3KRWA 2XNOA 4PNIA 4M3QA 2VWIA 5I5ZA 4EYJA 5ITAA 4EZ7A 5DR6A 5DVRA 5M09A 2CNVA 3LHJA 5AJQA 4A07A 4RC4A 4EOIA 3VUTA 3ZCLA 4J98A 3SXRA 4WOVA 2X9EA 1SYKA 4IJPA 5M4IA 3QLGA 4I4EA 3K2LA 2V5QA 3D7TA 2AYPA 1IG1A 5AV1A 2GPHA 5CZIA 4AT3A 3FBVA 4E93A 1ZY4A 4RT7A 3ZC6A 1YI4A 1XH9A 5HESA 3RKBA 3WZKA 4K2RA 5M53A 5AUXA 4WUNA 1FGKA 2BDJA 4TXCA 5GIOE 3DDQA 1UU7A 3DLSA 5DN3A 3FI8A 3QRKA 1PMUA 1ERKA 3O8UA 3F5GA 3C0GA 5C8NA 3UZRA 3PJ2A 5CVFA 4R7HA 4E4LA 2YIYA 5L8KA 3QGYA 4TN6A 3CLYA 4WNMA 5T3QA 4BDEA 4EBVA 3BBWA 4FIHA 4DEHA 3KREA 2JIUA 3Q9ZA 4G5PA 4LFIA 5DHJA 2YFXA 4DH7A 5CF8A 5IISA 1F5QA 4FTCA 2QU5A 4X0MA 3LFNA 4AT5A 3DKFA 2Y9QA 4R5SA 5TE0A 4EUTA 5EKNA 5FDPA 1OIRA 2OBJA 4O6LA 2O8YA 4GK2A 5AIRA 2B1PA 1Q41A 4JIAA 4YJUA 4ZS0A 3V6RA 3MVJA 4P5QA 5AADA 3WF8A 3RALA 4KABA 4FKJA 4FX3A 2BAKA 2PZPA 1OKZA 2W1DA 3BU6A 3R04A 4LM5A 3VWAA 4UALA 3TNWA 2WMVA 4HPTE 4ZAUA 1CTPE 1M2QA 3R1YA 4O96A 2CHLA 5DIAA 4C4GA 5EM6A 3UIUA 1AQ1A 4EH3A 3WF7A 3HEGA 1TQMA 4Q2AA 4BDFA 4ORKA 2YM3A 4RIXB 3VW8A 3HDMA 4A4XA 1PMNA 3FLYA 3U54A 4OAUC 3KFAA 3I7BA 3M42A 3UIXA 2X7FA 5C4KA 3HL7A 1MRUA 4BI1A 3OY1A 3C1XA 5H2UA 3ERKA 4JS8A 3E8NA 3QWJA 4BTFA 5LMKA 4R6VA 4W4VA 3E62A 2AUHA 4O82A 4BCGA 3PLSA 3FJQE 4I6BA 4U41A 2VO0A 4EZ3A 3W10A 4FNZA 4BBMA 4FYNA 3K3IA 1UKHA 3EKNA 3OF0A 5JFXA 3DNDA 2WTJA 3KC3A 4NM7A 2UVZA 4C61A 4IANA 4MHAA 3VHEA 3FYJX 4XRLA 3FMDA 1S9IA 4AP7A 4FEUA 1U4DA 1YOJA 4GK3A 2NNWB 2ERZE 1YQJA 5DPVA 5IQBA 2RG5A 4NCTC 1B6CB 3R2BA 3A61A 2JC6A 3A4PA 2OKRA 3MWUA 4IDTA 4RBLA 5TKDA 3VW6A 5CF6A 4QQ5A 1UWHA 4LMNA 2W06A 4QT1A 5ANDA 3EQGA 2VO6A 1OVEA 3G0FA 2VO7A 2OJFE 5E91A 1UA2A 5HE2A 4EI4A 4ENXA 4ACDA 1Q8YA 4ZTLA 3R8LA 4FTAA 2RKUA 3LCDA 4UB7A 3DZOA 3FWQA 5AAFA 2FVDA 4F64A 5DRDA 3R73A 2OSCA 3NZ0A 1LUFA 4KA3A 4GS6A 3ZUVA 2WOTA 3UO6A 4FZ7A 4XJ0A 2PY3A 3NUXA 3TXOA 3COHA 3FMEA 2QLUA 3D4QA 3CD3A 2PVHA 4NW5A 4XEYA 1CKPA 3F66A 3TKUA 3UJGA 2I0HA 3A4OX 4XLVA 3RK5A 3UPXA 5BNJA 3BKBA 4J7BA 3R83A 4PMTA 2VNYA 3DDPA 3AOXA 2X1NA 4FTMA 4IM0A 3QTQA 4CXAA 4ITHA 3KU2A 4LYNA 4CMUA 4CV9A 3COMA 4RQKA 3QCSA 2HCKA 4EUUA 4F1MA 2AC3A 3NRMA 1OIQA 1OIYA 2ZM1A 4IZYA 3D5UA 1JKTA 4JRNA 4ZTHA 2B52A 4KKEA 5E8TA 3UQGA 3CPBA 3QCXA 5BVWA 4D0XA 3C0IA 4RFZA 4D28A 3A62A 4FV3A 1ZYSA 2CGWA 2F4JA 1VYZA 4IB1A 4MYGA 4E20A 1NA7A 5KO1A 4FSNA 3ZFYA 4H05A 1DAYA 3A7GA 5HKMA 3VBQA 2QNJA 2OXYA 3DQXA 5IEYA 1OKVA 2CGUA 3A8XA 3MY0A 3NNWA 2BZIB 3PYYA 4GH2A 2X4ZA 4AGDA 5HORA 4G31A 2B9JA 4QP1A 5ETCA 4O81A 2O5KA 3ZLYA 1UNHA 4I24A 4QMUA 4D1XA 5IQIA 2ZYBA 2JKQA 3RAIA 4IM3A 4O7VA 4JOAA 1VZOA 3LKMA 3MYGA 5J1VA 4LGDA 2OJIA 5CXHA 4EQCA 1P5EA 2J5EA 3KF4A 4ZJJA 4GK4A 5GZ9A 2KULA 5FTGA 1R78A 2YDIA 1WBSA 3E3BX 3GT8A 3H30A 4OTDA 5IH6A 3QUDA 1SMHA 5FG8A 4DINA 2WPAA 4FV8A 2JIIA 3MSSA 3VUIA 1PMVA 1P4FA 4YO6A 5HTCA 3RP9A 4JX7A 3UNZA 2VWYA 1OL1A 5HG8A 3VQUA 4D2TA 1U54A 2ITOA 3OTUA 1PXKA 1YHWA 3IO7A 5L6OA 2CDZA 3G33A 4II5A 3KF7A 3HUBA 5D9HA 1YXVA 3OY3A 3PWYA 4BI0A 2NO3A 3W2OA 2V0DA 1O6YA 1P2AA 3UYSA 1LP4A 2X8EA 4EOQA 3F2NA 4JIKA 4ZY6A 3RZBA 4MQ2A 4F70A 5HIEA 4BY9E 4OTWA 4OTIA 4ANLA 4EKLA 5HVYA 4F9WA 2J7TA 2YABA 3JY0A 2C5XA 4O7NA 4BCHA 2OH0E 3D9VA 4M68A 4MXOA 5EHLA 3OT3A 3UMWA 3R9NA 3NEWA 4I41A 4IAKA 4XMOA 2IWIA 3MFUA 1HCLA 5KBRA 3Q52A 4RWJA 5F4NA 2Q0NA 3BWFA 3EZRA 5AV3A 4GYIA 3QTRA 3S4QA 4CT2A 3FC2A 3LMGA 4YJQA 4CFFA 1VJYA 3MY5A 5HE0A 2R3JA 2BKZA 2VX3A 4ZMFA 4H36A 3JY9A 3UVPA 5D12A 3BGPA 4LUDA 5EYDA 3EWHA 3RM6A 4CT1A 4U3ZA 1MQ4A 5CALA 1BL6A 1SVEA 2VGOA 2C5OA 1NW1A 4FT3A 4BFMA 2XNBA 4P2KA 3SQQA 4Z55A 4D2RA 3NNVA 4QYGA 2XNMA 1GIIA 2W5HA 3BIZA 4LGGA 3OROA 4FIFA 2V22A 4OTRA 3MIYA 4P5ZA 2HY81 4B4LA 3BLHA 5C9CA 4WKQA 4YJPA 5CU3A 3V6SA 2PUIA 2VTOA 5IQEA 4I94A 1B38A 2PL0A 5DGZA 3ZLSA 3HP2A 4I21A 4DFNA 4U5JA 4XV3A 4O91A 1Z57A 2ETKA 4IX4A 3RCJA 4IW0A 4TT7A 4DBNA 4ACGA 1OPKA 2PMIA 3L9PA 2WEVA 3DAJA 1CSNA 3CY2A 4ZLZA 2UZLA 3AT2A 3PPJA 5JZNA 1BI7A 2WXVA 2F9GA 4X2GA 3OWLA 4G6NA 4C35A 2WKMA 3QYZA 4FNWA 1H1SA 4DYMA 5IDPA 3I0OA 5KE0A 2QO9A 4JDJA 2VRXA 2PZYA 1NVSA 3LMIA 4G3CA 4I0SA 4IHPA 5EYMA 2IZRA 2V7AA 3KQ7A 5IMXA 4IC7A 5ETAA 5I9ZA 1PXIA 4CLJA 2WIPA 4EEVA 1FPUA 3ZC5A 3GBZA 2ZVAA 3TIYA 3V51A 3P7AA 4DG3E 2PVYA 5JGBA 3MPTA 5A54A 5CU2A 2VZ6A 4J8NA 4BDHA 3TJCA 4BIBA 2G15A 4MBIA 4F0FA 3DK7A 3BHHA 5AIKA 3UG1A 3OEZA 3ZZEA 4YHJA 3QC9A 3UG2A 3EFJA 3GCUA 2CLQA 1PKGA 3HV4A 5LMAA 2QU6A 2C0TA 3IDBA 4I22A 4YZDA 5EOLA 5ANKA 3PXKA 3MTLA 3MESA 3OOMA 4LOQA 5BMSA 3VIDA 4DH1A 4FV6A 3H9FA 4FR4A 4F9CA 5IQGA 4C0TA 3EQCA 5DLSA 3R7VA 4C4HA 3LM0A 4M0ZA 5L2TA 2HW6A 3EB0A 5AV2A 3TT0A 4O7TA 4JBOA 3PVWA 4ASEA 2EWAA 4D4YA 4DE4A 2ZOQA 5AR8A 2Y4IB 3LXPA 4FV7A 2ITZA 3FHIA 4FKTA 4MNFA 1OPJA 4DEAA 4PMPA 3KK9A 5K0KA 1W83A 4ITJA 1OL6A 3VUMA 4FEWA 5CANA 2HZ4A 2HOGA 4HNIA 4WT6A 4X3FC 5JK3A 4O7YA 4C58A 1AGWA 2YIWA 5E1SA 1ZOEA 4A9RA 4FEQA 3OXIA 4IVDA 2VTPA 4R3RA 2UZDA 4UMQA 3QTZA 4ASXA 4I6QA 3V5WA 4JNWA 4QQCA 4MK0A 4FV4A 3FYKX 3HRFA 1BI8A 2W1GA 3R1QA 4E4MA 4J52A 4AOTA 3DBCA 2GFSA 3QD0A 2XNEA 3WE8A 3K3JA 3ZS5A 4F9BA 5CT7A 5JN2A 4YC3A 4PMSA 4YUQA 1A48A 4R3CA 4CD0A 4TY1A 2XIKA 2R0UA 2YACA 4O0WA 3FQHA 5HIDA 3LJ0A 3U4WA 3LFSA 5CAUA 1YHSA 1JOWB 5J79A 3G9LX 3PY1A 1LEWA 3LJ1A 2XK7A 5CY3A 4O7LA 3IS5A 1R39A 4BDKA 2PVJA 3TKIA 3KKVA 3P79A 2IPXA 3S95A 3U6HA 2EB2A 4JRVA 2W9ZB 5IUGA 1STCE 3HV5A 3PXYA 1JAMA 2G01A 2GSFA 3U87A 2H8HA 3TACA 5AA9A 2YDJA 4TYEA 2WMXA 2R3IA 4G3FA 4PRJA 4FTIA 5AWMA 4QTCA 3L1SA 2B54A 3F6XA 3DCVA 3PTGA 5AP3A 4BL1A 4DN5A 3VN9A 5CF5A 4GKHA 1P4OA 3QX2A 2J0JA 3QZFA 4QOXA 3I6UA 3KMUA 4NSTA 1BL7A 4PF4A 3IPHA 4TYJA 5DEYA 5AAEA 3R7GA 4RZWA 4FOCA 4ARKA 4JAIA 3HKOA 2PVFA 4FT5A 3BV3A 1SM2A 3R0TA 3SDJA 2YM8A 3GC0A 3UDBA 4C37A 2G2HA 2Y0AA 3DBDA 5EH0A 3V01A 3W18A 4YLJA 3ZBFA 3G0EA 4MF1A 4WNKA 3RJCA 3WF5A 4BCKA 5IF1A 5AP0A 4NZWB 3HGKA 5A9UA 3NVMB 4D2PA 1Z9XA 5DE2A 2RSVA 2Z60A 2WMWA 4X3FB 3Q96A 4CVAA 5DA3A 3ZH8A 2QCSA 4RWKA 2YISA 3OXZA 3HMNA 3FXZA 4LMUA 5KHWA 4FE2A 1O6LA 2CNUA 4FOBA 3VHKA 4EWQA 5K3YA 2Y4IC 3MFTA 3QKKA 4GJ3A 2WTCA 3MI9A 4IZ7A 3G51A 3ORPA 4TWNA 3AC1A 2CN5A 5HD4A 2PSQA 3FXWA 3ROCA 3PVBA 2ERKA 3OS3A 5HNIX 5HCXA 5L8LA 5DFPA 2JDVA 3Q6UA 3PLAE 4EQMA 5A14A 4WHZA 1SNXA 2YA9A 4S30A 4EKKA 2W9FB 3OD6X 4F1TA 1XH4A 3QTUA 5IQFA 3FMKA 3FSFA 5FGKA 3RPYA 5IDNA 1AD5A 3HX4A 2OGVA 4UMRA 1NT2A 2JGZA 1JSTA 4U0IA 4O7RA 2OXXA 2WD1A 3CIKA 2BVAA 4NT4A 5KKRB 3L9NA 1ZWSA 2F7EE 4XYFA 1FINA 3UC3A 3C4ZA 3TV6A 1GJOA 4YZMA 4QMTA 4RJ4A 2G1TA 4IVCA 4ZK5A 3WILA 5GIPE 3ZO3A 4AUAA 3VBTA 3QA8A 4J96A 4AZTA 5AFVA 3ZUUA 3NNXA 3HMOA 3GQIA 4N4SA 2X7OA 5M56A 5FUTA 3F7WA 2OZOA 2X7GA 1J3HA 4GVJA 3WF9A 4RX8A 1W82A 1Q24A 3EQPA 3FZOA 4FSTA 4IJ9A 4QTEA 2PULA 1GIHA 3OC1A 4XS2A 5DR2A 2P2HA 4ANQA 4GMYA 4F63A 3O23A 5HBEA 4O38A 2WGJA 3MDYA 4EBWA 5HG9A 4KS7A 3UE4A 4L52A 4TKSA 3ULIA 2VX0A 4IBMA 3GCPA 4M67A 4EHVA 4D9TA 2R2PA 2VWZA 3GFWA 1Q61A 3IOKA 5CYIA 3IQ7A 3HZTA 4ZJIA 5JH6A 4JQ8A 3RHKA 4V0GA 1YWNA 3NAYA 5T68A 3SVVA 3RCDA 4QMZA 4OBPA 4BCIA 3JS2A 3PP1A 5GJGA 2QG5A 3RNYA 4EHEA 4BVUA 2NP8A 2R0IA 4S31A 3T3UA 3MS9A 5B7VA 4FKOA 3NDMA 4NJDA 2X81A 4I6FA 5JZJA 2A0CX 3FZPA 3U55A 2A27A 2PMNX 3UP2A 4BIDA 2DS1A 4O0VA 5F94A 4C4EA 5KKRC 2XKFA 2B4SB 2W4OA 3ZU7A 1SVHA 4CG9A 2WTKB 3F82A 4QMSA 1URCA 3DGKA 4RJ7A 4U97A 4XNEA 4PPCA 1J1BA 3CS9A 5M06A 4G17A 2FSTX 4CZTA 5TT7A 4XV1A 3R63A 2XK4A 4BWXA 4QNAA 3HRCA 4BZNA 1PYEA 1UKIA 1ZRZA 2DUVA 2OH4A 4RVKA 4B6LA 2JBPA 2HELA 5FXSA 3MY1A 3O96A 5KZ0A 1E1XA 2WTDA 2H96A 5F1ZA 5AP7A 4ZSEA 3MW1A 5H8GA 1IR3A 4QYEA 3LLAA 4DA5A 5F95A 4N57A 5M4UA 3HECA 3QD4A 4XOYA 5EM5A 5IQDA 4IAAA 4GJ2A 4YHFA 4CQGA 5BYLA 5M07A 4M7IA 4F7SA 3L8PA 2HZNA 3AC8A 3GNIB 1OIUA 4YTCA 3MIAA 2IJMA 2W05A 4OR5A 1UU3A 4IADA 5HX8A 3KY2A 3OUKA 3R8PA 2J90A 2WQNA 4K0YA 1YVJA 5EW8A 3RBWA 4JVGA 1Z5MA 3GOPA 3KULA 2X6EA 3KK8A 4H3QA 1H27A 2XJ1A 3L8SA 5IG1A 3AMBA 5IUIA 1H01A 4MEDA 1T46A 4QTAA 3RNIA 5CEPA 2C1BA 2YCFA 1H00A 4TWCA 3LMHA 4KUJA 2A2AA 4AW5A 3C5UA 4ACHA 5ETIA 5FD2A 2FSLX 1TQIA 2ITPA 5BX0A 2B53A 3D94A 3LIJA 3ORLA 4HJOA 3BBTB 4ALVA 2PYWA 3ETAA 3ZSIA 3BYVA 4GFMA 5CXZA 1MRYA 3KEXA 4JR3A 2GQGA 4U3YA 4RX5A 2XBJA 4U43A 5FM2A 4C4IA 4E5AX 2CNQA 4BCPA 3ORMA 3BV2A 2O64A 2VTHA 3TTIA 3RAKA 3B8QA 3O7LB 2GHMA 3LFAA 2YCQA 1REJA 2R3NA 4O0UA 3Q9YA 1IRKA 3NUNA 3R22A 2IW8A 1M52A 4FGBA 3C9WA 2HIWA 3DK3A 4YGAA 3MVMA 1MRVA 3CTQA 2CGVA 3HLLA 3F69A 4H39A 2QVSE 1MP8A 4OTHA 2PVLA 4XG4A 4JAJA 4E1ZA 4E73A 5HICA 4F7JA 2WOUA 4I0RA 4FT0A 3GQLA 4IZ5A 5CSHA 2CCHA 2C3JA 4XBRA 5DWRA 4DGLC 4KBCA 4BN1A 1FVVA 2PMOX 1XQZA 2R9SA 3GC9A 1TQPA 3KN5A 4GFGA 3RGFA 5LWNA 1YXTA 3NUAA 4H1JA 3PA5A 4J71A 4HYUA 2PHKA 4KRCA 3VUHA 3F5PA 4FICA 3ATTA 1KE7A 2YZLA 4HVGA 3AC3A 2ZAZA 4L3JA 3FLNC 4YSMA 5L2QA 5DRBA 4YZCA 3VRZA 2PVNA 4AWIA 4A9YA 4XP3A 2HY0A 3ACKA 4U80A 2RL5A 3EFKA 4DEDA 4GG5A 1KV2A 2V62A 4L3PA 5EHYA 3BU3A 5CEIA 2C3IB 4EC8A 3DV3A 1H24A 3QZIA 1XHAA 1J91A 3VS1A 2BZKB 2C69A 2OO8X 3F5XA 3FLWA 4DH3A 3ZRKA 4OTQA 3ZDIA 5JFSA 4BB4A 3OUNB 3FSKA 3AGMA 3EN4A 5K5XA 3TKHA 3MH3A 4YNOA 1OB3A 3NMUF 4TRLA 4G3DA 3D83A 2FO0A 3DKCA 4D9UA 4W4YA 5BVDA 5L2SA 3D2KA 3OG7A 3ZXZA 1PYXA 5DT3A 3R01A 5HTIA 4YHTA 2W1IA 4D1ZA 1CMKE 1PW2A 4R1YA 4DEIA 1QPDA 4BWPA 3QL8A 1IA8A 4RWLA 3Q4UA 4YLLA 1OKYA 1KUTA 1BX6A 5FTOA 4MXXA 4F0IA 4IQ6A 4WO5A 3WARA 3ZO1A 3JYAA 1Q8UA 1H1QA 3C4XA 1WBPA 3MA3A 3PUPA 4ZZMA 4EZ5A 2G2IA 5HBHA 2BCJA 2E9PA 3UVRA 3ORTA 3TV7A 3ZMMA 2BRMA 4BBFA 3Q53A 5EFQA
chains in the Genus database with same CATH superfamily
4PY1A 4RVLA 3QQUA 3SLSA 4BCOA 4XH6A 3DZQA 4AE6A 2H6DA 3R21A 4L44A 5J7BA 1M7NA 2QD9A 4KIQA 4OTPA 3DA6A 5HOAA 4Z3VA 5FXRA 5IH4A 2FYSA 2W96B 3N4VA 4Y73A 4J95A 2WTWA 5AUYA 2UZNA 4UX9A 4CKJA 5D7AA 4O4FA 3W8QA 3UMXA 3LOKA 3BU5A 3ACJA 2UZOA 4DHJA 3DTWA 4CCBA 4FKSA 4L6QA 4EH4A 3NAXA 5K4IA 3FKOA 2ZB0A 4JJRA 4AG8A 4W8DA 3NNUA 5CI6A 5CSPA 4HZRA 3HV3A 4ANOA 2R7BA 1ZYCA 1W2DA 1XR1A 4PL3A 4G9CA 4CMOA 2O0UA 2R7IA 3HMPA 2B9IA 2OIBA 4WG5A 5BYYA 1H8FA 4MCVA 3OHTA 5KNJA 1PXNA 1V1KA 2YWVA 4FUYA 1WAKA 5H8EA 2XMYA 4FKPA 1PXLA 3QF9A 4Z9LA 3R7UA 3OEFX 3HDNA 4RA5A 3ENHA 3FPMA 1XWSA 3CPCA 3O51A 4AU8A 1ZYLA 4PV0A 5IQAA 4OBOA 3S2PA 1Q62A 5BMMA 4C38A 3AD5A 3EH9A 3UIMA 5E8VA 4QMQA 3EN6A 4M84A 3BLQA 4YC8A 4TYHB 3EQDA 1A9UA 5C8MA 3P1AA 1YOMA 1G3NA 5DI1A 3OXTA 3HMIA 1FGIA 3F5UA 4DDIA 3D5VA 4ZP5A 1PF8A 4HZSA 4DT8A 2UW3A 3POOA 5K4JA 4WA9A 5TF9A 2YITA 4W4XA 2ZJWA 4K6ZA 4E8AA 2G9XA 4O0YA 3FAAA 5HVJA 4ACMA 4ZZOA 3FI4A 5K0XA 4YTIA 3BI6A 4AA0A 4FSYA 2IEWA 2Z7SA 4G34A 5CLPA 3WOWA 4FNXA 4MKCA 4CFVA 3IECA 3ZXTA 2J0MB 3NPCA 4C34A 4Y46A 3FZTA 4C59A 3V5TA 2JAMA 2BDWA 2WQBA 3DKGA 2QOQA 5CI7A 4GL9A 4G3EA 4MNEA 4M69B 4L9IA 4YR8A 5CAVA 3I5ZA 3MH0A 5CAOA 1IAJA 3KXGA 4FYOA 4LI5A 3H10A 3SHEA 2XK8A 4L7SA 4A9TA 3DBEA 4USDA 4QQTA 5GHVA 2V55A 3BL9A 3QC4A 4ZY5A 3T9TA 4YTFA 3IW7A 3NW7A 4QMWA 3CTHA 5AR3A 5H3QA 2GMXA 1W84A 3DFAA 3MPAA 3TV4A 3KIOC 3KMWA 2RF9A 3TUCA 4E5WA 4EQUA 2FB8A 4UWCA 2JBOA 2R3PA 4M97A 3ZM4A 2F57A 2VWWA 4UV0A 4ZSJA 4C4JA 4U45A 1G8SA 5CASA 5J7HA 2IF8A 3U6JA 5D10A 3G5DA 5AR5A 4PL5A 4Y85A 4CFMA 4F7NA 1QMZA 2RGPA 5HLNA 1Y6BA 2C47A 1VYWA 5HG7A 3C4FA 4BGGA 3NUUA 2WMBA 4N0SA 4FSZA 3PXZA 4NM3A 4GV1A 4APCA 4ASDA 5DYJA 4EH7A 5HI2A 3NYOA 4BRXA 1O9UA 4GT3A 1RJBA 4QMXA 4IVAA 1UNLA 3CGOA 3GU6A 3PFQA 2Y4PA 4PDYA 5T6KA 3M2WA 4U81A 4YBJA 5D7VA 3VVHA 5BUJA 3FLZA 4I6LA 4RWIA 2BALA 1F3MC 3GI3A 2I40A 4O0TA 1V0OA 3UVQA 1UU8A 3O2MA 1YDSE 2EUFB 3IDPA 4XRJA 4BKYA 4Y8DA 3NX8A 3W2SA 4ZTRA 1Q8TA 4XOZA 3ZRLA 3IW8A 2GNIA 4QP2A 1L3RE 2YAKA 4FF8A 4DGNA 4KRDA 4OT5A 3LXNA 4LV5A 2B55A 1R1WA 4C3RA 5J5TA 5KHXA 5IUHA 1WVWA 1YXSA 3PJ3A 4ONAA 1VR2A 4FSQA 1K9AA 1KWPA 3KA0A 3DNEA 2GFCA 5I9UA 3HA8A 3QTIA 3CR0A 4GG7A 2XBAA 3GP0A 4RLLA 5EK7A 5GJFA 3EQIA 2UZEA 5LCJA 3QKMA 3K54A 3NR9A 3P78A 5JFWA 5L8JA 5C8KA 2CPKE 2GQSA 3TIZA 4FKGA 5M4FA 4RIWA 5I9WA 5B2MA 1WBOA 2RFSA 4OTFA 2JAVA 3FZSA 3UYTA 5AUUA 3CP9A 4F6UA 3SGCA 1OUYA 3WZUA 3WE4A 4C4FA 4CRLA 4GCJA 4CGAA 2ZDTA 4FEXA 4YJTA 5G6VA 2Y6MA 3AQVA 2VX1A 3R9DA 4TYHA 4F4PA 5JQ8A 5M4CA 4UZHA 4XG7A 3B8RA 4DFYA 4FTUA 4HVSA 5E8YA 3MJ2A 4YLKA 3SKCA 1KE9A 1YI3A 5LWMA 3UQCA 2OK1A 2QR7A 1L8TA 1FBNA 4IWQA 4EH8A 5EW9A 2JDRA 3G2FA 3Q2JA 5KMNA 1BKXA 4LRMA 1H08A 4L68A 2QOIA 4AOJA 5HBJA 3SX9A 5KCVA 3PSCA 4AXDA 2BZHB 2XCKA 4NM0A 4U6RA 3OP5A 4BYJA 3HRBA 4RRVA 4BHZA 3C4CA 3I6WA 1W2FA 2A19B 3PSDA 1M14A 4AZFA 4E6CA 3UGCA 1OECA 1JNKA 3C50A 4FNYA 4NIFA 3PZHA 5HNBA 3GCQA 3KCFA 2W0JA 4XHKB 3PPKA 2F2UA 3F7ZA 3DJ5A 3PUFC 2CCIA 3DBQA 4JL9A 5J9ZA 2JKMA 1XBAA 5E8XA 4ZTMA 2J2IB 1R0EA 2J9MA 4I5HA 2BKKA 4FSRA 3U6IA 4AFJA 3FQSA 5AUZA 1H1RA 3I1AA 4U40A 3KXXA 4ENYA 3P4KA 4WG4A 1FVRA 2VWUA 2AQXA 2UZBA 3IDCA 3OBGA 2FH9A 4R7BA 1TKIA 1BYGA 4C02A 3S1HA 4TL0A 3MV5A 2QOKA 5CAQA 4CFNA 5I0BA 1ZY5A 2ZM3A 3KL8A 3W32A 2UW8A 4F65A 2UUEA 2NPQA 2W4JA 3FDNA 4G6LA 2XEYA 1URWA 3S3IA 3WI6A 5ANEA 3G9NA 4R3PA 2J0LA 5EI2A 4M8TA 1G8AA 5HO8A 4NM5A 2QKRA 4QQJA 4Z7HA 2BHHA 2IN6A 4YO4A 3VAPA 1ZYJA 5DBXA 1R3CA 2JITA 2IO6A 3RMFA 4AZVA 2J5FA 2DYLA 3O50A 5EM7A 5EYKA 4NTSA 3W0NA 1H0WA 3SW4A 2XKEA 3TTJA 2JKKA 4EK3A 3C13A 4DFUA 4NWMA 4FIEA 4D0WA 1WBWA 2XANA 3T3VA 2C1AA 4JDIA 4UN0C 2XRWA 3BHYA 2W4KA 4I1ZA 3EZVA 3LXKA 4DHFA 3D2IA 4QMOA 3R71A 2YLEA 4GIHA 5AM7A 4AACA 4E6DA 4HVHA 5DG5A 2OLCA 4Y83A 3TUDA 4NW6A 5A4CA 4O7ZA 2P4IA 2HWPA 5FEDA 4AW1A 3AMYA 5ICPA 3Q2MA 4JDKA 1J7IA 4IFCA 4IB3A 1WFCA 4L00A 3QCYA 3H0YA 4QTBA 2BFYA 3WF6A 4A4OA 4M12A 4BC6A 2PZRA 3IOPA 3SRVB 5M51A 2A98A 1M17A 4U8ZA 5DR9A 2XS0A 2QOFA 4M0YA 3BQRA 4RJ6A 4UY9A 3OCGA 1GIJA 3P86A 3PSBA 3R9OA 3OWPA 1FOTA 4OUCA 3DB8A 4RGJA 1GZKA 2BRBA 3K5VA 4BCNA 3BEAA 2ONLC 4YTHA 4A9SA 3HV6A 3GUBA 3DLZA 2ZV2A 4WBBB 4IX6A 4NUSA 3UNKA 3PXRA 4I23A 4Y5QA 4DGGA 2O3PA 1CM8A 3F61A 3UTOA 3VUDA 5J1WA 2JD5A 3P7BA 4ALUA 3VQHA 2IW6A 4DTAA 5GINE 3OZ6A 4O83A 2I1MA 3VBXA 4PX6A 4YPDA 3TWJA 4HCTA 5JEBA 4DHIB 5E92A 4YJSA 4FI1A 3KCKA 3TL8A 1Q8ZA 4HVIA 2YDKA 4QMYA 5FBOA 5A4TA 4J8MA 2IVSA 2WZJA 3PIYA 1SVGA 5HEZA 1MQBA 1OITA 5FRIA 3GCSA 3LZBA 4L45A 1BMKA 3ORNA 4RJ3A 5HIBA 5BUEA 2W99B 3LFFA 5IEXA 2O2UA 3OW4A 4L42A 5C26A 2XNPA 5IZFA 4Q5HA 3BPRA 1JLUE 2UZVA 2IVUA 4QTDA 4Z7GA 3ORKA 4V05A 4BTJA 1H28A 2X4FA 1ATPE 4PP9A 2GS7A 3W8LA 5M57A 3RZFA 4OLIA 1I09A 1K3AA 3P08A 5I9YA 4O7SA 1UV5A 4Y5HA 5KMIA 5IKWA 2ZM4A 4BKZA 3KB7A 3JUHA 5JGAA 3KVXA 2UW6A 4ERWA 4QMMA 4XBUA 2R3FA 3EN7A 5CSXA 3ZONA 3PFYA 4YJVA 4LG4A 3BRBA 1PXOA 1LPUA 3DB6A 4YPSA 5E1EA 4FIGA 2AEGA 4WD5A 1GAGA 2QHNA 5BYZA 3OBJA 3BYSA 3R7EA 3NS9A 4BBEA 4EK8A 4RC2A 1A06A 4GEOA 4E7WA 5AUTA 3UBDA 3QXOA 3DT1A 3UODA 5I4NA 4BDCA 4OBQA 3ZFMA 3FY2A 2X0PA 4O0SA 3F3VA 3OFMA 3QAME 4DH5A 4UZDA 4FKUA 4IM2A 3DXQA 4EOMA 1YI6A 5IA1A 2RFDA 4DHZA 5CU0A 5IA0A 4YU2A 1ZARA 2QI8A 3HP5A 1YW2A 4JG6A 2ITYA 4BTMA 4CLIA 4PNKA 4QYFA 4LRKA 1ZYDA 3LCOA 3LFDA 3RVGA 1G5SA 4EOSA 1RQQA 1Q99A 3GXLA 4E5BA 4KIOA 1KE6A 3OCTA 1NY3A 2IW9A 3QZHA 3ZFXA 3CJFA 4ITIA 3CGFA 5HQ0A 3TNHA 4XX9A 3NWWA 1ZOGA 3EL7A 1XH6A 3QQGA 2GS2A 4FRFA 3REPA 3PRFA 3Q04A 3FEGA 3UO5A 4BTKA 2XVDA 3LLTA 2Y7JA 4O2PA 4LOOA 4FTOA 5J9YA 4FIJA 5CZHA 2J0KA 2ZB1A 1JVPP 4XP0A 4RA4A 4LV8A 2QOLA 4EJNA 2ONLA 3ZYAA 5A4QA 3GU4A 4FL3A 4XG9A 4BCQA 5HE1A 2C0OA 3R28A 5AP4A 3WIKA 3AT3A 4KIKA 4XCUA 2QOCA 3NIEA 1Q4LA 4IAYA 2VAGA 4XV2A 2YCRA 4XV9A 3F2AA 3W55A 3G6HA 3Q4TA 1YOLA 2HXLA 2X6DA 3U8WA 2UZTA 4Z16A 1UNGA 3LAUA 4I0TA 5GJDA 4AZWA 2CKEA 4YJRA 3V8SA 5HX6A 4K18A 4O2ZA 4IDVA 3HNGA 4ZS4A 3MPMA 3E87A 4O7WA 2C5NA 2PVKA 3A60A 3PRIA 3PIZA 3L8VA 4K9YA 3TN8A 2R3KA 4D1SA 4NKAA 5HO6A 2JFLA 3UOKA 3U9NA 4Q9ZA 3DAKA 2BHEA 2UZWE 3FLSA 2WQEA 3A7HA 2OICA 2BFXA 3QTSA 4RIYB 4NCTA 3ZLWA 3AC5A 3LJ2A 2XYNA 4ANNA 4CZUA 1RE8A 2BAJA 2XNGA 4X2KA 3BHTA 5FM3A 2Y8OA 4IB0A 4L46A 4D2SA 3KRXA 3BWJA 4LDTA 2PZ5A 2P2IA 5HO7A 3VJNA 5EOBA 4YSJA 3QWKA 4EK6A 4DCAA 4L53A 1WBNA 3VONA 5E8UA 4CCUA 1ND4A 3MGYA 3BQCA 3W2QA 3RAHA 3E88A 4ZTNA 4F7LA 4K1BA 4GVAA 3ZDUA 3V5JA 4D58A 4MQ1A 4F99A 3UDTA 1W98A 1F0QA 4GYGA 3D14A 3QLFA 3V5PA 2P55A 3FL4A 3BGQA 1H26A 1VLRA 4FKIA 2Z02A 3KRJA 2GNGA 4I4FA 4QP9A 1E9HA 2I6LA 3VJOA 3W1FA 4EYMA 4JBVA 2VV9A 4FV9A 1WVXA 2ITNA 2BIYA 2Z7QA 4B9DA 5L3AA 4GUEA 3V5QA 4R77A 3W0QA 5E90A 4H3BA 5CSWA 4FKQA 4TWOA 2PVRA 3F3UA 3I7CA 3HYHA 4KBKA 4HVDA 2WU7A 4EH6A 4O1OA 2WMQA 3SG8A 1OL2A 5AX9A 3KVWA 3TZ8A 4TZRA 3ORZA 2WU6A 4DC2A 4H58A 5AR4A 4WSQA 3NW5A 3C4EA 3LPBA 4JG8A 4WIHA 3E7VA 3E64A 3Q9WA 4NTTA 3R7IA 4KIKB 5DOSA 2PUPA 5LMKC 4TYIA 1PXPA 2SRCA 3DU8A 5CEKA 4KD1A 3H9RA 3D15A 3FKLA 3QQLA 4IAZA 4R1VA 5E8ZA 4CRSA 4P90A 2VU3A 1ZMVA 4HCUA 2WTVA 3TDVA 3PY0A 2W5BA 3VNTA 4KB8A 3A7IA 4AN9A 5EG3A 1ZZLA 3ID6C 3H4JA 1XKKA 4KSPA 2IZUA 5J8IA 3VRYA 4AW0A 3BYMA 3NYVA 1REKA 1V0BA 4FTTA 2YM7A 2UZUE 4YBKA 3R9HA 2CLXA 2XAOA 1H4LA 2HZ0A 5LXMA 4CYIA 4F0GA 3DTCA 3CKXA 3KXHA 4S32A 4EH5A 5CEMA 5CWZA 3QTWA 4V04A 3VS6A 3Q3BA 3HVCA 4D5KA 2X8DA 4IZAA 4R78A 1UVRA 1J7UA 2C6DA 2ITUA 4F9AA 3EQBA 5BPYA 2YEXA 4UMPA 4NIFB 3G6GA 2XJ0A 3VS0A 5EKOA 3PE2A 5CQWA 1YRPA 3QUPA 4DFXE 2I7QA 1B39A 3PIXA 4XG8A 4CZYB 2YERA 3MB7A 2UV2A 3ANRA 4W9XA 1CKIA 4K8AA 5HTBA 4Q5EA 2E9OA 2VWVA 4G3GA 3EQFA 5AV4A 4BDBA 1GZOA 2WTKC 4S2ZA 5HGIA 3EYGA 3QQHA 2J0IA 4F1OA 5IA2A 3TEIA 3OVVA 5GNKA 2R3QA 4RFYA 4FGRA 1XH5A 4R8QA 3TI1A 2BROA 3DAEA 4UYAA 5IPJA 3EMGA 4KINA 4FG9A 2RG6A 3RPRA 1OL5A 4FZAB 3IW4A 5BQ0A 5AM6A 3LCKA 4AE9A 3DS6A 5B2KA 4D55A 2QOOA 3O8TA 4O0RA 2X2MA 3R8MA 4KS8A 2QLQA 2ETRA 3EIDA 4DDGA 4KSQA 4P7EA 4AAAA 4FL2A 3O0GA 2FSMX 5ETFA 5M08A 3PY3A 3I81A 2O65A 2VO3A 2XIXA 4MNEB 5FEEA 2ITVA 2OF2A 3NVKI 4WG3A 3AD6A 1K2PA 3Q60A 4HYIA 3R7OA 3WBLA 4A7CA 5KUPA 2A4LA 4MWHA 3TNPC 3P23A 4FTLA 4AN2A 1IAHA 3CQEA 3FQEA 4ZTSA 2IG7A 1OGUA 2BZJA 1XJDA 3QHRA 4RC3A 4D5HA 5KBQA 1SNUA 4OAVB 4WNPA 1FMOE 1WMKA 4MD9E 3WYYA 2PTKA 1YWVA 3VUKA 3LFBA 2QR8A 4FV0A 5ACKA 5FTQA 1JWHA 4DEBA 5BVOA 3NCZA 3IONA 3IW5A 2DWBA 1S9JA 5HZNA 1PHKA 3NYXA 4I6HA 4X2NA 4MXAA 3FY0A 4MXCA 3ENMA 2PZIA 2QHMA 3UP7A 3CBLA 3QQJA 1KE8A 4HW7A 4U9AA 1H1PA 1HOWA 5JRSA 3P7CA 4EC9A 5B0XA 2CMWA 1QCFA 2ZMCA 3BLRA 2H34A 3KXMA 1YDRE 4U79A 3LCSA 3U4UA 3UNJA 3ZEPA 1E1VA 2XNNA 4NL0A 5A6OA 2HYYA 3OTVA 1U46A 2C5VA 2C6MA 3DK6A 2X0QA 2X0OA 1MUOA 1JBPE 3N9XA 4LRJA 4TNBA 3ZO4A 2R3GA 3E7OA 2JEDA 4FZDB 5CTPA 2EB3A 2IVVA 3BZ3A 2BRNA 4BCFA 3CC6A 2WEIA 5FEQA 4B0GA 4C36A 3UOHA 3R1SA 3ZSGA 2PPQA 2XARA 1H1WA 5I9XA 4FV5A 4W8EA 1Q97A 2J51A 5KMLA 1J7LA 4IMYA 1BLXA 2VTTA 4NH1A 3KRRA 3PXFA 3GFEA 5EYCA 1YXXA 3TG1A 2O63A 2E9VA 3U9CA 4LQMA 4M69A 4XLIA 4EHGA 3CEKA 2QQ7A 2CKOA 4RJ8A 4FVRA 1G8JA 4F9YA 4H3PA 3F2RA 4AS0A 4DITA 3BHUA 3E3PA 5IEVA 3RHXA 2KTYA 1LR4A 4MVFA 4Y95A 3A8WA 2VD5A 3VC4A 3EFLA 4ERKA 2RFNA 4KBAA 4FEVA 4BR3A 4DTBA 4RSSA 2YN8A 2OIQA 3MBLA 4L67A 3LQ8A 4IEBA 3QX4A 5ANIA 3UOLA 4FL1A 2YIRA 3GC8A 3MH2A 4X3FA 3TJDA 3TZMA 3ZBXA 2CKPA 3ALNA 2C5YA 5LVOA 2GU8A 4ZTQA 1WVYA 5LCKA 1DM2A 4LOPA 3VBYA 3WZJA 3ZTXA 5EM8A 1YKRA 2BUJA 2QODA 4RZVA 3ZUTA 3TUBA 4DEEA 2XM9A 2YCSA 5L6WL 4XUFA 4I5MA 4QP3A 4WNOA 2BILB 4K77A 4KIPA 5KX8A 2BR1A 5DNRA 4GFOA 4K11A 3ORIA 4RJ5A 4B7TA 1YWRA 4LGHA 3RINA 4UWBA 2OWBA 5H8BA 3K5UA 4O86A 2VUWA 4AT4A 4NU1A 4MX9A 5F9EA 4AN3A 3FMHA 1XBCA 2C6TA 3R00A 4PDSA 2W1ZA 4ID7A 4EOPA 3VS4A 4LL0A 4ZY4A 1JKKA 3DOGA 4BZDA 4USFA 2QURA 3E92A 4FG8A 2BDFA 5KMMA 1IA9A 3I5NA 2PUUA 5ACBC 4F6WA 4KWPA 4CFUA 2BMCA 2V7OA 3EQRA 3MH1A 3PVGA 4WSYA 5K9IA 2J50A 3CKWA 4GT4A 3DBFA 3MN3A 3QZGA 4X6QC 2Z7LA 2VTSA 4EL9A 5KMJA 2OZAA 3R30A 4RX7A 4YJNA 1IASA 4M66A 2EU9A 3QRJA 4YJOA 4ACCA 3NW6A 4AA5A 2EXCX 4EOLA 2C6LA 3A99A 2WAJA 4C57A 2VTRA 2XIRA 4FSMA 3MVHA 2C30A 4F08A 4CTCA 1GNGA 5BVKA 2X39A 4YC6A 2F49A 3I79A 3P5KA 4O27B 4L3LA 3KMMA 4EOKA 4ZJVA 2C6KA 2UW9A 4NJ3A 2OZAB 3QQFA 4TYGA 1APME 3HAVA 3SXSA 3JVSA 3N51A 3ZEWA 4JBQA 3NUSA 4CFWA 3FPQA 2R5TA 5ANGA 5CNOA 2WMUA 5KZIA 1EH4A 5AP5A 5JFVA 3WYXA 3S00A 3ATSA 3RPOA 3SG9A 3VS3A 4PP7A 4O1PA 4MWIA 3Q5IA 4Y72A 4A9UA 4FTQA 3FZ1A 2E9NA 4G16A 1Q8WA 5J9LA 2LGCA 1BUHA 2GHGA 4QRCA 4IC8A 1JKLA 2BRHA 5DT4A 3R02A 4BCMA 4C33A 3GU5A 4DFBA 5CF4A 3RK7A 5HHWA 5TO8A 2F2CB 3U51A 5L2IA 1PKDA 3NGAA 2P3GX 4DG2E 4D2VA 5I3OA 3VUGA 1SZMA 4BZOA 3EOCA 3CY3A 4RIWB 3RWQA 2XP2A 2YWPA 2HZIA 4TWPA 4X7QA 4B8LA 3AT4A 3GENA 1LEZA 4UXQA 2GS6A 5I3RA 4YP8A 4CQEA 3FMNA 4HGSA 4G1WA 5HE3A 3VF9A 3SC1A 3TM0A 1Y6AA 2XIYA 1M2PA 3ALOA 3I60A 4Q9SA 4RIXA 4BYIA 5EDQA 4FSUA 5LMBA 2UVXA 3CQWA 3FLQA 3O8PA 5JT2A 4E3CA 3R8VA 4L43A 3NUYA 4ASZA 1X8BA 3FZRA 4CV8A 5C4LA 4CG8A 1Q5KA 3EJ1A 2PU8A 3IGOA 4DEGA 3RWPA 3LCTA 3QQKA 1O6KA 1GY3A 2VN9A 3M11A 4I5CA 5TOZA 4RX9A 2P33A 3ITZA 2I0EA 4DFLA 2Z2WA 3IW6A 1HCKA 2XKCA 2YJSA 5C03A 4MXZA 5JKGA 4PTGA 4A4LA 5HCZA 3AKJA 1QPCA 3L9LA 4DLJA 2F7XE 2C6IA 4HCVA 4X2JA 5FLFA 3RI1A 4BI2A 3FI2A 2B9FA 4TW9A 1PRYA 4DAWA 1WBTA 5CT0A 4G5JA 4U42A 3Q6WA 4APPA 4QMNA 5AA8A 2GQRA 3NFFB 2CSNA 2VTIA 4C3PA 3O5AA 4EJ7A 4TPTA 4FKLA 3EYHA 2W1CA 4ALWA 1PXMA 3TDWA 3OCBA 3KXNA 5D41A 4IWOA 3D7TB 2W7XA 3MTFA 2OI4X 4KKHA 4V0GB 4ZLOA 2CKQA 4ZIMA 4BKJA 2HWOA 4XP2A 5JMSA 4EORA 2GDOA 4AF3A 4J99A 4JBPA 3PP0A 4IXPA 3QUEA 2OF4A 2OIDA 4FTNA 2VTQA 4V01A 2VWXA 2WB8A 3VULA 4UXLA 4QDVA 2R3LA 1KOAA 5HVKA 4J53A 2WMSA 2VTMA 4IWPA 3AD4A 3KXZA 4X6RA 4C3FA 5DT0A 2WMRA 4CTBA 4E6AA 4O0XA 2XH5A 4C2WA 1PXJA 2XEZA 3C4WA 3COKA 4OGRA 5DMZA 3ULZA 3SAYA 3POZA 2R3HA 2WIHA 3QD3A 3BX5A 3WIGA 4JLCA 1XMMA 5BV3A 1YDTE 2RIOA 3GU7A 3F3WA 4A06A 3S0OA 4ZZNA 3CQUA 4LUEA 2QOHA 4MD8E 5BVEA 2W5AA 4I5PA 3RPSA 1QL6A 3CE3A 5CU4A 3T8OA 4MBLA 3TNQB 1KOBA 4QP7A 5FBNC 1ZOHA 3BHVA 3R1NA 1H0VA 2HW7A 4FC0A 5AX3A 4BDDA 3HAMA 4FK3A 2JKOA 3AXWA 5AR7A 5IA5A 3V3VA 3H9OA 1YXUA 4EOOA 3LQ3A 2WMTA 5A4LA 3GC7A 3ODYX 3VBWA 4E26A 3UZTA 4DT9A 1OMWA 4FTJA 3Q4ZA 4JG7A 5HG5A 2QOBA 5AR2A 1FQ1B 1W8CA 5AEPA 2ZDUA 3LFCA 5E4HA 1JQHA 3KGAA 3NLBA 2DQ7X 1OKWA 3FMJA 3QRUA 5K5NA 3CJGA 3EKKA 3IKAA 4QYHA 3QU0A 4EK5A 2PVMA 4AXAA 4BDJA 2GNHA 2OJGA 4MF0A 4NYEA 3F88A 4E4NA 4GKIA 3ZSHA 3ET7A 1OZ1A 4CMTA 3ELJA 4FTRA 4QP8A 2JDSA 5EQPA 2XF0A 3HA6A 5GZ8A 1TZDA 4DG0E 4BDAA 2I0YA 4X21A 4D4SA 3W2CA 2VTLA 2QO7A 2BIKB 2X9FA 3FHRA 3O17A 4IX5A 2BRGA 3THBA 1PJKA 2UW0A 2R4BA 4JXFA 3EQHA 5GZAA 3NIZA 5AMNA 3SOCA 3SV0A 4ZLYA 3FKNA 1U54B 2UW7A 3CCNA 1GZNA 3R8UA 4NEUA 4QMPA 3LVPA 4AOIA 2WHBA 1W0XC 2ITQA 4BCJA 4LV7A 3QTXA 4EH9A 3Q4CA 3Q5ZA 2JLDA 5HU9A 3LXLA 1OPLA 4XG6A 3GVUA 5CEOA 4IWDA 2FA2A 4N6YA 4RVTA 4C2VA 3MJ1A 4FV2A 3LM5A 4E4XA 4EH2A 4QO9A 3IGGA 4QNYA 2ZV8A 1IEPA 2QC6A 3OMVA 3ORXA 4MD7E 3UC4A 2LAVA 3L9MA 3UO4A 4AAYA 3P9JA 4CNHA 4U7ZA 4EWHA 1P14A 3T9IA 4RQVA 2ZV9A 4BICA 5A4EA 2B0QA 2PK9A 3MB6A 4FK6A 3PG1A 5L2WA 2ZV7A 3KRLA 3A7FA 1Y57A 2IVTA 4RPVA 2Q0BA 5IH5A 4WRSA 4WBOA 5LARA 5E7RA 3H3CA 3QD2B 3PXQA 4TNDA 3QRTA 4C7TA 2IZSA 4USEA 2AC5A 2PUNA 3D0EA 4O21A 2ACXA 5C27A 5CX9A 3E5AA 3ZOSA 2EXEA 4S33A 4IE9A 4RIOA 3ZHPC 3QXPA 3TZ7A 4IACA 5EI6A 1ZLTA 5HLPA 4DFZE 3W0RA 3BE9A 3SD0A 4F78A 3IK3A 1Y8GA 4AA4A 4B99A 4CSVA 4L8MA 5CSVA 2WMAA 3C51A 3MFSA 5ANJA 1FMKA 3N4UA 2A1AB 4FTKA 4FZFB 1KV1A 3C7QA 4JDHA 1XH7A 4ZSLA 3HUCA 2WFYA 4FSWA 2OW3A 2J4ZA 4ZEGA 1RDQE 5M44A 3FC1X 4D4VA 4QPSA 2GCDA 4ZSGA 4PWNA 2JIVA 3AGLA 3FL5A 3V8WA 5E9EA 2JDTA 4FKWA 4QP4A 3AC2A 3MFRA 3R6XA 3PE1A 4QPMA 5HCYA 3E8CA 1Y8YA 2GHLA 2W17A 3QBNA 4WUAA 1U5RA 5FP5A 1QPEA 2QKWB 3BCEA 4LL5A 2FSOX 3FMMA 3NUPA 4OTGA 5EDRA 4E6QA 4FMQA 4L7FA 4AZSA 3D5WA 2C6EA 1PMEA 1ZMUA 2RFEA 4BWKA 3DXPA 4DBXA 1J1CA 4BJJA 5JRQA 4W9WA 1OL7A 4DCEA 3ZLXA 2G2FA 4N70A 2X8IA 3WZDA 2C3KA 3EN9A 2B7AA