4GJ4A

The crystal structure of the soluble guanylate cyclase pas alpha domain from manduca sexta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
b'IGVASFAKAFPWHFITDKRLELVQLGAGFMRLFGTHLATHGSSLGTYFRLLRPRGVPLDFREILKRVNTPFMFALKMPGSTALAEGLEIKGQMVFAAESDSLLFVGSPFLDGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Alpha subunit PAS domain from soluble guanylyl cyclase.
pubmed doi rcsb
molecule keywords Soluble guanylyl cyclase alpha-1 subunit
source organism Manduca sexta
molecule tags Lyase
total genus 24
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gj4A00
4GJ4A 2P04A 2P08A
chains in the Genus database with same CATH superfamily
1LSWA 3MQ0A 1GA9A 1V9ZA 2H0TA 4HJ6A 1KGGA 1Y4OA 2J80A 3IH8A 4DXBA 2FH5A 4B88A 3IQAA 1ES5A 1N9NA 3EQVA 3MXRA 4F3LB 2QJ7A 4IVKA 2Z2LB 4HH2A 4WF0A 3M6BA 5AJGA 3ULFA 2G2WA 2P04A 1P0ZA 4B93A 4EQIA 3SS4A 5E2HA 3S4XA 3FYZA 1FSWA 4G3WA 2CMNA 4L9GA 3CI6A 4WBGA 4OOMA 4OONA 3VE3A 2QJ5A 3M2KA 2PD8A 2Y2MA 3BRMA 1ES4A 5I5LA 4YINA 1MY8A 3TSGA 3KYZA 5TR7A 2ZJ9A 3F1PA 4GOGA 2Y4AA 3Q7ZA 1FIKA 2XEPA 3M6HA 1NZUA 3KSFA 4ZJ2A 2V1AA 1LI9A 4M3KA 1ZG6A 3LY3A 3ITBA 3T1XA 5HX9A 2WKQA 3LIFA 4DDYA 3SH7A 3F1OA 4K0WA 2EA9A 4JGPA 4JXSA 3ITAA 4OH0A 1MC0A 3CZDA 5CTNA 3GRJA 4X68A 2OSUA 4N9KA 2ZMAA 3BFGA 3HL9A 1IKGA 5E43A 4S2OA 2XR0A 1K6RA 2WZZA 4N9LA 2FZ0A 4BQMA 4UHUA 4IBXA 4EUZA 3NDEA 2EFXA 3H7WA 3SH8A 2FFFB 2BTFP 3UPNA 3JVUA 5HDSA 5M18A 2EX8A 1K0KA 2YKFA 4ZJ3A 3S22A 3Q7VA 4OQGA 4EV4A 1XJ4A 2CC1A 3OPPA 1KDSA 5EOEA 3ICYA 1NY0A 3BLSA 1OTIA 3PBOA 4IHQA 3FZCA 1BZAA 3PBQA 4RA7A 5HL6A 4KZ8A 4CLCD 2ZLYA 1L0EA 3BY8A 3VOLA 4JF5A 4CLCB 2H0YA 3UB8A 2XFSA 3CITA 3HBRA 4BD1A 3TE8A 2B02A 1K56D 3GR2A 2EWVA 2RL3A 3N4IA 3MKEA 4NXBA 4RYEA 5HW3A 5JYOA 3GV9A 4GD6A 5CGSA 1PI4A 1MBLA 1IKIA 4QB8A 1N9OA 3D4FA 5E2EA 1RGZA 2WUQA 4LPZA 4NEED 4HI4A 3ZNYA 1BUEA 3ZG8B 5FASA 1LSVA 1NRJA 2PDRA 1JWPA 2KLIA 3HLDA 3B3XA 4GJ4A 2LB5A 1RGYA 1KGEA 3HVFA 3VP2A 5L10A 3RXXA 3IX3A 4FSFA 5IT5A 2WKPA 4G3VA 4XT2B 4DE1A 3IWOA 3ZNTA 5FAOA 1G5UA 4DXCA 5DKLA 3GQZA 4KZ9A 3IHBA 2VV6A 3G32A 4PM7A 3EEAA 4HJ3A 4DJ3A 4PPRA 1K57C 5EV0A 2V20A 4I3JA 4DJ2A 4Y5FA 4OVDA 2J8YA 4LGWA 2Y59A 2R78A 4JPMA 3MQQA 1NLZA 2W3EA 1DJAA 2Y2HA 4BLMA 2DNSA 4FH2A 4QWOA 3V3SA 3OBFA 2PR5A 1EI5A 4C75A 4A5RA 2V1ZA 3KYQA 4DE3A 3N7WA 2A2LA 1PNEA 2WGIA 4S2MA 2GJ3A 4EBNA 3BQ8A 1Z09A 3SZTA 2XLNA 4C3QA 3DTIA 1VETA 3H9WA 3B33A 3P7NA 4R3JA 3UN7A 2HPBA 3GDIA 4FD8A 4EBPA 1S0WA 3P01A 4JBFA 3VFFA 4IUKA 3GTCA 2ACGA 3R7WB 3IF6A 3A3DA 3KSIA 3BQAA 2V8FA 2D01A 3PR6A 2XK1A 1KE4A 2HGVA 2Y8HA 4E3JA 3LIDA 3NJAA 5DFXA 3KX0X 4OPQA 2HDRA 4PM5A 4RX3A 3E0YA 3HJIA 3O3VA 3BLMA 1TS6A 2Y91A 5F1GA 3MZFA 2H5SA 3RTYA 4PKYG 1KE0A 3DTEA 1E3UD 2L0WA 1FR1A 4Y2FA 2INWA 3LR5A 4BL2A 3C4PA 2XQZA 2WKEA 3F1NB 2PBDP 1EW0A 4E6WA 5FEGA 4OQ0A 5HWVA 4LENA 3S7PA 3G34A 4IUHA 3RXWA 2W3GA 4S2PA 1SCWA 4I5SA 4Q0IA 1S67L 5KSCA 1XJ6A 3P09A 3VMAA 3EQUA 4GKUA 2VV7A 5HWWA 5A90A 5HZHA 2BLSA 2QMIA 2ZM8A 5EM0A 2YKHA 3F1PB 5TFQA 3CPTB 2Q0OA 4H6JB 4E3MA 2Y2LA 4RQ9A 4MN6A 3SS5A 3CHWP 2VGLM 5HD5A 4GLQA 4QY6A 5FSRA 1H8MA 5CRFA 4X6TA 3N8LA 2Q9MA 1PWCA 1T18A 4E3LA 3BW6A 2BASA 5CEBA 4GHIA 3DAVA 3F1OB 3BJNA 1HTZA 4U0XA 4KQOA 3K3CA 1KOUA 1ZTUA 3UB6A 1DRMA 2PBYA 5HDDA 3BFDA 3LEZA 3FKWA 4LV1A 4E3KA 3KSGA 5C5KA 4WELA 4BENA 1V9YA 3EOIA 4EWFA 4PHTA 3V67A 4MBFA 4OP8A 5AQAA 2ZQCA 4QPRA 1K25A 2IA2A 2W1TB 1W63M 1W63Q 3NHQA 3C4OA 3OCNA 3UE6A 4LLOB 5L09A 3DBAA 4ZAMA 5HAPA 2V0WA 2V8CA 3S1YA 1WYCA 5DF9A 2ZC5B 3DW0A 3W4PA 5IHVA 4Y3IA 5F5YA 5CHUA 4R23A 3BFFA 1W8QA 1AWIA 3QP2A 3DTMA 2B95A 1BYWA 3AGFA 1LI0A 1EROA 2VK3A 3G35A 5DJUA 4GS9A 3EWKA 3VP3A 1LT0A 3BFCA 2PR6A 4WYYA 4L9FA 3IX4A 4XUXA 2OV5A 3CUEC 2O9AA 3FC7A 3OZHA 2L1MA 3G30A 4S2NC 1OJ5A 4UEYA 2HJ9C 2HV1A 1G6OA 4OLDA 4KG2A 5G4ZA 1RP5A 2W3FA 1CF0A 1CJFA 1STZA 4JXGA 2EFUA 2Y2JA 3GVBA 3T4OA 3RJUA 1KGFA 1KE3A 1K54A 5HDCA 5EVIA 1N9LA 4UQIS 1ERQA 4X55A 4E04A 1BLHA 2ZQ8A 2P08A 2WKRA 4NKPA 2J3TC 1PYYA 3HLEA 3VV4A 1ES2A 1IYSA 4LRZE 4R4SA 2XD1A 5DF7A 1YMSA 5KMWA 1EWZA 1HZOA 2PD7A 2QZ6A 1KDWA 2OOLA 3N6IA 4GDNA 4EESA 2W1RA 4LV0A 4EETB 3IS2B 3E4QA 1CI8A 3QHYA 4KUKA 5J7EA 2ZL1B 4ZBEA 4YWZA 2GDNA 1FILA 1PFLA 3UDFA 2Y2PA 4B4XA 3VOZA 4WZ5C 1H8ZA 3DWKA 5AQ7A 1PI5A 1NYYA 3H82A 4HNBA 1LL9A 4FUWA 3UY6A 1F5MA 1WYBA 3Q1FA 3A0VA 4C6YA 1YKDA 4UAAA 3UDIA 4LRYC 1XA7A 5LBRA 4MBHA 3IBJA 1JNUA 4MN7A 2JKRI 3GECA 1YLZA 2XA7M 3VSKA 5EM1A 3FWLA 3RFBA 4WZ4A 3RH8B 1JTDA 4HQAA 1QMEA 4ZJ1A 3S7NA 3BYDA 3K2NA 3ZDJA 4EEPA 4KQDA 5GLDA 4HY8A 1I5QA 4OKPA 2XDMA 2I72A 4DKIA 2IWDA 3SH9A 4GCZA 1ALQA 1XJ3A 2Y2KA 2V0UA 2EXBA 3O87A 3VFHA 4O01A 3BFEA 1K54C 4RVAA 2JKTI 2VZWA 5GHXA 4LV2A 2GZAA 4BBVA 5KIZA 5DTSA 4U0TA 3T4SA 1DP6A 4HP9A 4D2OA 1IYQA 5AVEA 4P6ZM 1TDGA 2ZBBA 1TF1A 4Y17A 4WL9A 5TGFA 1K6SA 5DKKA 3IXGA 3V50A 3NC8A 3UE3A 4P85A 4HIAA 2XA7S 2AVXA 3QP5A 2QHKA 1CI9A 3FV7A 3V3RA 2HDQA 2I9VA 3IT9A 3W2ZA 1MXOA 3CWFA 2W3HA 2X02A 1KVLA 5GLBA 2K7SA 4KG5A 3MXSA 4GN2A 2M7VA 1TVFA 3NCKA 3UB9A 3CMZA 2FFYA 1HD8A 3FPVA 5HD3A 5EUAA 4HP4A 3OC2A 3UB5P 3OLOA 1G68A 2J3TD 1YLJA 1LLBA 2OWHA 1XJ2A 1Y54A 2VGJA 3UE1A 2C6WB 4DF6A 3VP0A 2ZC3B 1Z6FA 3EEHA 4Q0JA 1OTBA 1O07A 5FQ9A 4P6ZS 2VJWA 5CECA 3UMDA 4ZDXA 1IOUA 2WZXA 1I2SA 2JKRM 3T12B 2E8IA 4N92A 2BG1A 2PAVP 1G6AA 1BTLA 4I38A 4PKYA 4DMZA 5GLCA 4R70A 5FQMA 1FR6A 2GX5A 5FI6A 3MSHA 2ZC6B 3HLGA 1YMXA 5JYPA 4HOIA 1IYPA 3V39A 3ISGA 1K4FA 1X0OA 2B5RA 2KOIA 3O5YA 4ME4A 5CEDA 4ETZA 2KDKA 2O99A 4EXOA 3L9KA 4KENB 1UGUA 2JKTM 5F1FA 1MKIA 1JWZA 1VHMA 3BM6A 2HDSA 1BLPA 5TBMA 4R3AA 5FAPA 3NY4A 4ARZA 2JKFA 4UA7A 1XA1A 4GS9B 4MNRA 2ZD8A 3MJQA 5L07A 1VEUA 5EPHA 1XFQA 1ZG4A 4CJNA 2DCFA 4B9OA 5FATA 4ID4A 4S2IA 5GL9A 5E2GA 1N4OA 1OTDA 4KQRA 2WKHA 3NBLA 1YLYA 2XSSA 5K5BA 5DFYA 1YSQA 5CXWA 3T4LA 1OT9A 4LCMA 2X01A 4Q8IA 4JF4A 3NI9A 1MPLA 4BJPA 4WEKA 5TJJA 4IBRA 1TS0A 1TD5A 4WMCD 5HARA 2O0YA 1MWTA 3A3EA 4FH4A 4BMWA 1OTEA 3PYPA 4LRXC 2P9VA 4O7DA 4X1MA 4QJGA 1VM1A 5EECA 2ZQAA 1NYMA 5F6AA 1S4SA 4NK3A 3E2LA 3NOUC 1FCMA 1IFQA 3AGEA 3PAGA 2P7JA 4CQHA 1L0FA 3T1RA 2QYBA 4WEJA 1XP4A 1K4EA 2R9WA 3HCYA 1Y28A 5GLAA 1W7FA 3ZCZA 4K0XA 1UWPX 2JC7A 3IBRA 1CEGA 4N1XA 4PM8A 2G2UA 5GHZA 4CLCE 4KZAA 4P0MA 1MWUA 3HREA 5A92A 2A24A 3U2AA 2V1BA 3D72A 4Z1WA 1F2KA 4F94A 5EE8A 2X71A 1W5DA 2ZQ7A 5CTMA 1ACFA 4O8GA 4X53A 4Y13A 2VV8A 3CG5A 4GW9A 4EW7A 3HUNA 3IH9A 4HH3A 4QD4A 3FG8A 1OPXA 4OPZA 4EERA 5A93A 5HAQA 4H8RA 3PTEA 1OMEA 3UPPA 4QU3A 3JYIA 1T1AA 1K55A 5AVFA 2Z6DA 2DMWA 4G3KA 3MR0A 1TS7A 3C7UA 4JGRA 5FL3A 2W3DA 3OPLA 3M2JA 3K3DA 3LO7A 1DP9A 5G18A 3C5AA 3ZG5A 1OT6A 1TDLA 3W4OA 2ZM2A 4NETA 2V9AA 1O7EA 3TRCA 3QP4A 4OPRA 3IF6C 2WAEA 4DE0A 3KSHA 4CLCA 3G2YA 3SW1A 4JGQA 5J4EA 4I3IA 1MKMA 5GHYA 3Q82A 1NZOA 1GCEA 3B47A 5FEFA 3H7WB 3N8SA 4S2JA 2VGKA 3MS6A 1ESUA 4ZRRA 4JXWA 1UWNX 1S4RA 1GSWA 1YPRA 2VGLS 1K56A 3KYEA 4MCWA 1E4DA 4WM9A 3Q7VB 3PBTA 3JPUA 1LHYA 2OLVA 4GZBA 4YNRA 2K2NA 1T19A 1WE4A 1KVMA 3IHAA 1YT4A 4FTXA 4Z9QA 3CAXA 5CX7A 2DRWA 4CPKA 4XT2A 4K91A 4P87A 1GSVA 1Q2QA 2WGVA 3I7JA 1CEFA 1YLTA 5L8MA 3LICA 2WAFA 1XPBA 2PYPA 3IXHA 1S66L 2C5WB 4JKTA 4X25A 3BECA 3IWQA 5EFWA 4ESPA 1BLCA 3LI9A 3NIAA 1SZVA 3C8CA 3HUMA 3Q07A 1T1BA 3VSLA 5F69A 1HVBA 4MBKA 4GD8A 1LSXA 2Y79A 3T1SA 2Y55A 2VLGA 1JWVA 2RCXA 1ZKJA 3MBZA 5EOOA 1S1ZA 3G31A 3LFVA 3GSGA 5DF8A 4HJ4A 2HF6A 4KZ3A 3HUOA 4PM9A 3VOYA 4R1GA 3CLOA 4NXEA 4NXFA 3LIEA 3MQOA 2P74A 3G4PA 3IX8A 5G4YA 1IELA 1XGIA 3ZG0A 4BL3A 5J8XA 3R7WA 3WRZA 4S2KA 1YSPA 3WRTA 3ZG7B 3WS5A 1D1JA 3WS1A 3TW8A 1H0MA 3C2WA 1P97A 4EEUA 4HBUA 1YLPA 2EXAA 2W27A 1FOFA 3LI8A 3C30A 3QNCA 1YAXA 4X69A 1YLWA 2EWWA 2EX2A 1S6RA 3SS3A 2WGWA 5F83A 1XGJA 4DE2A 4FOFA 3LYXA 2J9OA 1PRQA 2PHYA 1P9WA 1IEMA 2K31A 2QPNA 3NECA 1E3UA 3F1NA 1U60A 4I3AA 2PYRA 2PRFA 5FI2A 5KZHA 1VETB 4BBTA 3UPOA 1PZPA 4HESA 3TG9A 4II7A 4KZ6A 3U4LP 2Q9NA 3IF6B 1ONGA 2GNXA 2P9VB 3P98A 2HZ5A 5M19A 3MKFA 4OOYA 3WS0A 1DJBA 2XFTA 3CPTA 4KZBA 4H6JA 5HWTA 3B42A 4R6LA 2O9CA 3T4TA 5EVIC 1F98A 1BT5A 1ZC2A 2PT7A 5AQBA 4RX2A 3BEBA 1LL5A 3PBNA 1L0DA 4M4XA 4QHCA 2XD5A 2J9PA 3L7HA 2Y2NA 3DWZA 2QWSA 4BD0A 4E3IA 3IWIA 1TS8A 1GHIA 4MEZA 5HSQA 1YQSA 1N9BA 5E2FA 3T4QA 4EUVA 1SKOA 1E25A 3UB7A 4XUZA 5FAQA 2A24B 3HJKA 2KX6A 4MLLA 2H28A 1NWZA 1K57A 2ZOHA 2W1TA 3MZEA 1D7EA 1NLYA 1BLSA 5A91A 3LCEA 5IS1A 2ZQ9A 4WN5A 1MWRA 4HEFA 3PAEA 4U3TA 2M7UA 2HP9A 4IJGA 4NG2A 3OPRA 5FQKA 1FQGA 2B18A 3FKVA 4GHIB 3VE4A 4OQIA 4R3BA 2Z6CA 1OJGA 5I94A 2EX6A 4AFIA 1CK3A 1PWDA 1YM1A 5CGWA 4KZ5A 5HPIA 2MJ6A 2D02A 3HLWA 2WADA 4KZ7A 3TOIA 3LEQA 3QP8A 3ZVWA 3MFDA 1DY6A 1ZHHB 2OAP1 5CHMA 3ZGAB 4OLGA 3LR0A 2HDUA 3VP1A 3ZQ5A 1SHVA 3MF0A 4FCFA 1M40A 5DVAA 4BWIA 1NRFA 5IU1A 4EU0A 5FA7A 1PZOA 1NXYA 1JVJA 4IEDA 2R9XA 1J3WA 4QY5A 4ZTKA 3UMEA 4NXGA 1XXMA 1ERMA 4PAUA 3UNWA 2JCHA 4PM6A 1D06A 1P9RA 2E8JA 3WWXA 2UV0E 2XGNA 2OAQ1 4KUOA 3QNBA 3A3JA 1L0GA 2ZM0A 2XH9A 5D3OA 3MFXA 3FPWA 2HJEA 3A3FA 3T4JA 2OLUA 4D60A 1VB6A 2H10A 1S1YA 5DTTA 4Q0HA 2PU2A 4LV3A 4O0PA 3IS2A 4E3OA 3MXQA 2ZL1A 1J9MA 4X56A 2JKGA 2IWBA 5F82A 3T1QB 5CGXA 3GMWA 1T1CA 2Z2MB 5EVID 1TEMA 5FQJA 3V5MA 4DRTA 3O88A 1H3QA 4F3LA 2ZMVA 3OOVA 1H5XA 5EVIB 1W79A 1PW1A 1BSGA 4I39A 4EBLA 2Y2OA 4Y7PA 5L2FA 3WS2A 3UE0A 5BOHA 4OPYA 3EGXC 1VQQA 4R38A 1MZUA 5HL1A 1SDEA 3G2ZA 2HP6A 3PHYA 4IVIA 4OOLA 3NDGA 3C38A 4LFUA 2O9BA 3A3IA 5DJTA 2WKIA 3W4QA 4XXRA 3HLFA 5CERA 4DDSA 2V2FF 1JTGA 5DTKA 5MC7A 3NOTC 4P6BA 3H82B 2JN7A 3QP1A 1HLUP 1L2SA 3G6OA 3LUQA 5KSHA 2PU4A 2Y2IA 3S7OA 1PW8A 4PMAA 2XRNA 3T50A 4Y0UA 4GB7A 2XROA 5FI7A 2WK0A 2WGWB 1L3LA 5FDHA 3WS4A 1PIOA 1M6KA 3NOPC 5CHJA 1A0KA 1BULA 2LB9A 2Y2QA 3ZHHA 5J3WA 3UO9A 4R0QA 2VEAA 3LIBA 1DJCA 4OP5A 1MWSA 2JBFA 1Q2PA 4JGOA 1ES3A 4HHDA 1PWGA 3A0RA 4L0LA 3T4KA 3IF5A 4JXVA 3CUEA 4E6XA 3CJMA 3D3OA 3BWLA 3O86A 4KQQA 4S2NA 1XKZA 4EQ1A 3MZDA 2NUPC 1NJ4A 1XX2A 1DP8A 1XFNA 4L9EA 4X1LA 4ETXA 2Y2GA 3QP6A 2EX9A 3S7QA 3LY4A 4KG6A 3N8RA 2XF3A 2J7VA 3OPHA 4WLAA 5F68A 3NULA 1ONHA 3R4KA 1IYOA 1CQAA 3C7VA 1SKOB 3PBRA 4MN5A 5AQ9A 3ZYTA 4OQHA 3DTKA 1SKFA 2M1CA 2UWXA 2ZC4B 4MDZA 2VX8A 4MMNA 1I2WA 3HLBA 4JLFA 4UA6A 2L4RA 5FDSA 1FCOA 3ZVTA 4WZ5A 4LCLA 5M1AA 4GDBA 1G28A 5FQQA 3EGDC 3ZG9B 3E2KA 3LR4A 2QKPA 1WA9A 3OCLA 3BY9A 1C3BA 4UQIM 1F9IA 2WYXA 3JVVA 4KZ4A 1GSXA 1K38A 1OTAA 1GHPA 1H8YA 3IXBA 4S2LA 4R4RA 2HP5A 4E3NA 2ZC7A 3E4OA 5HPFA 1QMFA 4DN0A 1ESIA 4GNUA 1GHMA 3AGDA 4JF6A 3E98A 4WUJA 4Y15A 3A0SA 2W0NA 2IWCA 2JE5A 3SOIA 1K55C 3D9YA 3Q81A 2J3WA 3TJZC 4B4ZA 2A3UA 2ZMFA 1LL8A 2VKSA 3VP4A 3LR3A 4Y0OA 1SDNA 3PXPA 4HBTA 1FSYA 2A49A 2VA0A 1FCNA 5HAIA 5U47A 1W8YA 1ODVA 3LGOA 4YOFA 2G7UA 1AXBA 3LIAA 3KO6A 4UA9A 2ZQDA 1GA0A 3MMHA 5EVEA 5EVLA 4BBUA 2JHEA 3IXDA 5HFOA 4K08A 4CLCC 3W8KA 4Y0TA 3ZFZA 2NUTC 5A8BA 5TBMB 4ARZB 4N1HA 3HLCA 5FQIA 3PBSA 4WMCA 2OWJA 1VEUB 2ZOIA 1RCJA 3E4PA 3UDXA 4YFMA
chains in the Genus database with same CATH topology
4IJGA 4PHTA 1LSWA 3V67A 2B18A 3MQ0A 4GHIB 1V9ZA 3VE4A 4HJ6A 2J80A 2Z6CA 4BJPA 1OJGA 4QPRA 4WEKA 2FH5A 2IA2A 2W1TB 5TJJA 1TS0A 1TD5A 2O0YA 1W63M 1W63Q 3NHQA 4AFIA 4BMWA 1OTEA 3PYPA 5HPIA 3OCNA 3UE6A 4LRXC 2MJ6A 1N9NA 2D02A 3EQVA 4LLOB 4F3LB 2QJ7A 4HH2A 4WF0A 3DBAA 5AJGA 1ZHHB 2OAP1 3ULFA 2V0WA 3LR0A 2P04A 1P0ZA 4B93A 3ZQ5A 5DF9A 3MF0A 4G3WA 5F6AA 1S4SA 2CMNA 4L9GA 3CI6A 4OOMA 3NOUC 4BWIA 1IFQA 4Y3IA 5IU1A 5F5YA 4EU0A 3VE3A 2QJ5A 2PD8A 2P7JA 4CQHA 5I5LA 2QYBA 4WEJA 3KYZA 1BYWA 3HCYA 1Y28A 3UMEA 3F1PA 4NXGA 1UWPX 3IBRA 4PAUA 5DJUA 4GS9A 3EWKA 1D06A 1LT0A 1P9RA 3KSFA 2PR6A 4L9FA 4CLCE 2OAQ1 3CUEC 4KUOA 2V1AA 2O9AA 3FC7A 2A24A 3U2AA 2V1BA 2L1MA 3D72A 4Z1WA 2WKQA 3LIFA 3FPWA 3MFXA 1OJ5A 2HJEA 4UEYA 2HJ9C 2HV1A 1G6OA 3T4JA 3F1OA 5G4ZA 1VB6A 2W3FA 2EA9A 1STZA 1S1YA 4JGPA 1MC0A 4O8GA 4Q0HA 3T4OA 4O0PA 2VV8A 3IS2A 3MXQA 5HDCA 4GW9A 4EW7A 4HH3A 1N9LA 4UQIS 3FG8A 1OPXA 4EERA 4E04A 2P08A 2WKRA 1T1AA 2J3TC 4NKPA 5AVFA 2Z6DA 2DMWA 3VV4A 4G3KA 4LRZE 1T1CA 3MR0A 1TS7A 2PD7A 4JGRA 2OOLA 4EESA 2FZ0A 5FL3A 2W3DA 3K3DA 2W1RA 1DP9A 4EETB 1H3QA 3IS2B 3H7WA 3E4QA 4F3LA 2ZMVA 3OOVA 4KUKA 5J7EA 4YWZA 4I39A 1OT6A 3JVUA 5HDSA 2V9AA 2YKFA 3TRCA 3KSHA 1XJ4A 4CLCA 3SW1A 4JGQA 3H82A 5J4EA 3EGXC 1MKMA 4I3IA 4HNBA 4R38A 3ICYA 1MZUA 3B47A 3PHYA 4OOLA 1OTIA 3PBOA 3H7WB 4IHQA 3C38A 3PBQA 1F5MA 2O9BA 5HL6A 4ZRRA 5DJTA 4CLCD 1UWNX 1S4RA 1GSWA 2VGLS 4MCWA 3BY8A 3VOLA 3A0VA 1YKDA 5MC7A 3PBTA 4CLCB 3NOTC 4LRYC 3UB8A 3H82B 5LBRA 3IBJA 2JN7A 1JNUA 3CITA 4MN7A 4YNRA 2K2NA 3TE8A 1T19A 2B02A 3G6OA 2JKRI 3GECA 2EWVA 2XA7M 3LUQA 5KSHA 3S7OA 3RFBA 3RH8B 4NXBA 4HQAA 2XRNA 3S7NA 3T50A 3CAXA 3K2NA 5CX7A 4EEPA 1N9OA 4KQDA 4XT2A 4HY8A 1GSVA 4LPZA 2XROA 4NEED 4HI4A 5L8MA 3LICA 2PYPA 1S66L 1LSVA 1NRJA 4GCZA 2PDRA 2KLIA 1XJ3A 2V0UA 3NOPC 4GJ4A 2LB5A 5EFWA 4O01A 3LI9A 2JKTI 3C8CA 4FSFA 5IT5A 2VZWA 2LB9A 2WKPA 4G3VA 4XT2B 1T1BA 5J3WA 2GZAA 2VEAA 3LIBA 4BBVA 5F69A 5KIZA 5DKLA 3T4SA 4JGOA 1DP6A 4HP9A 2VV6A 5AVEA 4HHDA 3EEAA 4HJ3A 4DJ3A 1LSXA 4P6ZM 3A0RA 2ZBBA 4L0LA 2Y79A 1TF1A 3T4KA 3CUEA 3D3OA 4WL9A 2VLGA 4I3JA 4DJ2A 3BWLA 4Y5FA 5DKKA 1S1ZA 2R78A 3UE3A 4EQ1A 4HIAA 2XA7S 3MQQA 2NUPC 1DP8A 2QHKA 3LFVA 1XFNA 1NLZA 4L9EA 2W3EA 4ETXA 4HJ4A 2HF6A 2I9VA 3CLOA 4NXEA 3W2ZA 4NXFA 3LIEA 3MQOA 3OBFA 3CWFA 3S7QA 2PR5A 5G4YA 2W3HA 2K7SA 2M7VA 3KYQA 3R7WA 4WLAA 5F68A 3UB9A 1YSPA 2A2LA 3R4KA 3FPVA 3TW8A 5HD3A 3PBRA 2GJ3A 4MN5A 3C2WA 1P97A 4HP4A 4EEUA 3OC2A 3ZYTA 3BQ8A 2M1CA 3OLOA 2J3TD 2W27A 3H9WA 3B33A 4MDZA 2OWHA 1XJ2A 2VX8A 3LI8A 4MMNA 3P7NA 3GDIA 3C30A 3P01A 1YAXA 2L4RA 4IUKA 3EEHA 3R7WB 4Q0JA 1OTBA 2EWWA 4P6ZS 3KSIA 3BQAA 2VJWA 2D01A 3PR6A 1G28A 4FOFA 2HGVA 2Y8HA 3LYXA 3EGDC 2PHYA 1P9WA 3LIDA 2K31A 3LR4A 3F1NA 3UMDA 3NJAA 5DFXA 2QKPA 1WA9A 4I3AA 2PYRA 3OCLA 3BY9A 4BBTA 3KX0X 4UQIM 1IOUA 2JKRM 1F9IA 3E0YA 3HJIA 4II7A 3JVVA 1TS6A 1GSXA 4PKYG 3RTYA 1OTAA 2L0WA 4I38A 4PKYA 4DMZA 4Y2FA 4R70A 2GNXA 2GX5A 2INWA 3LR5A 3E4OA 3F1NB 5HPFA 4HOIA 1EW0A 4H6JA 5HWTA 5HWVA 3B42A 3S7PA 4R6LA 4IUHA 4DN0A 1X0OA 2O9CA 3T4TA 2KOIA 3O5YA 2W3GA 4ME4A 1F98A 4I5SA 4Q0IA 1S67L 4ETZA 2PT7A 2KDKA 2O99A 4EXOA 1UGUA 3E98A 1XJ6A 4WUJA 3A0SA 2W0NA 3PBNA 3EQUA 2JKTM 4M4XA 2VV7A 5HWWA 2J3WA 5HZHA 3TJZC 2ZMFA 1LL8A 2VKSA 3LR3A 2YKHA 3PXPA 3F1PB 1VHMA 2QWSA 4H6JB 5TBMA 2VA0A 4R3AA 4ARZA 4GS9B 4RQ9A 4MN6A 1TS8A 2VGLM 1ODVA 5HD5A 4YOFA 4GLQA 5HSQA 2G7UA 3T4QA 4EUVA 1H8MA 3MJQA 3LIAA 3KO6A 3UB7A 1XFQA 2A24B 1T18A 3HJKA 2KX6A 3MMHA 3BW6A 4BBUA 2JHEA 4B9OA 2BASA 2H28A 1NWZA 4GHIA 4K08A 4CLCC 3F1OB 3BJNA 2NUTC 2ZOHA 5A8BA 2W1TA 4KQOA 5TBMB 3K3CA 4ARZB 1D7EA 1KOUA 1NLYA 1OTDA 1ZTUA 3UB6A 5IS1A 1DRMA 5HDDA 4WN5A 3PBSA 2XSSA 5K5BA 2OWJA 3KSGA 5C5KA 5DFYA 2ZOIA 4WELA 2M7UA 1V9YA 1YSQA 3T4LA 3E4PA 1OT9A 3EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJ4 A;  2P04 A;  2P08 A; 
#chains in the Genus database with same CATH topology
 1LSW A;  3MQ0 A;  1GA9 A;  1V9Z A;  2H0T A;  4HJ6 A;  1KGG A;  1Y4O A;  2J80 A;  3IH8 A;  4DXB A;  2FH5 A;  4B88 A;  3IQA A;  1ES5 A;  1N9N A;  3EQV A;  3MXR A;  4F3L B;  2QJ7 A;  4IVK A;  2Z2L B;  4HH2 A;  4WF0 A;  3M6B A;  5AJG A;  3ULF A;  2G2W A;  2P04 A;  1P0Z A;  4B93 A;  4EQI A;  3SS4 A;  5E2H A;  3S4X A;  3FYZ A;  1FSW A;  4G3W A;  2CMN A;  4L9G A;  3CI6 A;  4WBG A;  4OOM A;  4OON A;  3VE3 A;  2QJ5 A;  3M2K A;  2PD8 A;  2Y2M A;  3BRM A;  1ES4 A;  5I5L A;  4YIN A;  1MY8 A;  3TSG A;  3KYZ A;  5TR7 A;  2ZJ9 A;  3F1P A;  4GOG A;  2Y4A A;  3Q7Z A;  1FIK A;  2XEP A;  3M6H A;  1NZU A;  3KSF A;  4ZJ2 A;  2V1A A;  1LI9 A;  4M3K A;  1ZG6 A;  3LY3 A;  3ITB A;  3T1X A;  5HX9 A;  2WKQ A;  3LIF A;  4DDY A;  3SH7 A;  3F1O A;  4K0W A;  2EA9 A;  4JGP A;  4JXS A;  3ITA A;  4OH0 A;  1MC0 A;  3CZD A;  5CTN A;  3GRJ A;  4X68 A;  2OSU A;  4N9K A;  2ZMA A;  3BFG A;  3HL9 A;  1IKG A;  5E43 A;  4S2O A;  2XR0 A;  1K6R A;  2WZZ A;  4N9L A;  2FZ0 A;  4BQM A;  4UHU A;  4IBX A;  4EUZ A;  3NDE A;  2EFX A;  3H7W A;  3SH8 A;  2FFF B;  2BTF P;  3UPN A;  3JVU A;  5HDS A;  5M18 A;  2EX8 A;  1K0K A;  2YKF A;  4ZJ3 A;  3S22 A;  3Q7V A;  4OQG A;  4EV4 A;  1XJ4 A;  2CC1 A;  3OPP A;  1KDS A;  5EOE A;  3ICY A;  1NY0 A;  3BLS A;  1OTI A;  3PBO A;  4IHQ A;  3FZC A;  1BZA A;  3PBQ A;  4RA7 A;  5HL6 A;  4KZ8 A;  4CLC D;  2ZLY A;  1L0E A;  3BY8 A;  3VOL A;  4JF5 A;  4CLC B;  2H0Y A;  3UB8 A;  2XFS A;  3CIT A;  3HBR A;  4BD1 A;  3TE8 A;  2B02 A;  1K56 D;  3GR2 A;  2EWV A;  2RL3 A;  3N4I A;  3MKE A;  4NXB A;  4RYE A;  5HW3 A;  5JYO A;  3GV9 A;  4GD6 A;  5CGS A;  1PI4 A;  1MBL A;  1IKI A;  4QB8 A;  1N9O A;  3D4F A;  5E2E A;  1RGZ A;  2WUQ A;  4LPZ A;  4NEE D;  4HI4 A;  3ZNY A;  1BUE A;  3ZG8 B;  5FAS A;  1LSV A;  1NRJ A;  2PDR A;  1JWP A;  2KLI A;  3HLD A;  3B3X A;  4GJ4 A;  2LB5 A;  1RGY A;  1KGE A;  3HVF A;  3VP2 A;  5L10 A;  3RXX A;  3IX3 A;  4FSF A;  5IT5 A;  2WKP A;  4G3V A;  4XT2 B;  4DE1 A;  3IWO A;  3ZNT A;  5FAO A;  1G5U A;  4DXC A;  5DKL A;  3GQZ A;  4KZ9 A;  3IHB A;  2VV6 A;  3G32 A;  4PM7 A;  3EEA A;  4HJ3 A;  4DJ3 A;  4PPR A;  1K57 C;  5EV0 A;  2V20 A;  4I3J A;  4DJ2 A;  4Y5F A;  4OVD A;  2J8Y A;  4LGW A;  2Y59 A;  2R78 A;  4JPM A;  3MQQ A;  1NLZ A;  2W3E A;  1DJA A;  2Y2H A;  4BLM A;  2DNS A;  4FH2 A;  4QWO A;  3V3S A;  3OBF A;  2PR5 A;  1EI5 A;  4C75 A;  4A5R A;  2V1Z A;  3KYQ A;  4DE3 A;  3N7W A;  2A2L A;  1PNE A;  2WGI A;  4S2M A;  2GJ3 A;  4EBN A;  3BQ8 A;  1Z09 A;  3SZT A;  2XLN A;  4C3Q A;  3DTI A;  1VET A;  3H9W A;  3B33 A;  3P7N A;  4R3J A;  3UN7 A;  2HPB A;  3GDI A;  4FD8 A;  4EBP A;  1S0W A;  3P01 A;  4JBF A;  3VFF A;  4IUK A;  3GTC A;  2ACG A;  3R7W B;  3IF6 A;  3A3D A;  3KSI A;  3BQA A;  2V8F A;  2D01 A;  3PR6 A;  2XK1 A;  1KE4 A;  2HGV A;  2Y8H A;  4E3J A;  3LID A;  3NJA A;  5DFX A;  3KX0 X;  4OPQ A;  2HDR A;  4PM5 A;  4RX3 A;  3E0Y A;  3HJI A;  3O3V A;  3BLM A;  1TS6 A;  2Y91 A;  5F1G A;  3MZF A;  2H5S A;  3RTY A;  4PKY G;  1KE0 A;  3DTE A;  1E3U D;  2L0W A;  1FR1 A;  4Y2F A;  2INW A;  3LR5 A;  4BL2 A;  3C4P A;  2XQZ A;  2WKE A;  3F1N B;  2PBD P;  1EW0 A;  4E6W A;  5FEG A;  4OQ0 A;  5HWV A;  4LEN A;  3S7P A;  3G34 A;  4IUH A;  3RXW A;  2W3G A;  4S2P A;  1SCW A;  4I5S A;  4Q0I A;  1S67 L;  5KSC A;  1XJ6 A;  3P09 A;  3VMA A;  3EQU A;  4GKU A;  2VV7 A;  5HWW A;  5A90 A;  5HZH A;  2BLS A;  2QMI A;  2ZM8 A;  5EM0 A;  2YKH A;  3F1P B;  5TFQ A;  3CPT B;  2Q0O A;  4H6J B;  4E3M A;  2Y2L A;  4RQ9 A;  4MN6 A;  3SS5 A;  3CHW P;  2VGL M;  5HD5 A;  4GLQ A;  4QY6 A;  5FSR A;  1H8M A;  5CRF A;  4X6T A;  3N8L A;  2Q9M A;  1PWC A;  1T18 A;  4E3L A;  3BW6 A;  2BAS A;  5CEB A;  4GHI A;  3DAV A;  3F1O B;  3BJN A;  1HTZ A;  4U0X A;  4KQO A;  3K3C A;  1KOU A;  1ZTU A;  3UB6 A;  1DRM A;  2PBY A;  5HDD A;  3BFD A;  3LEZ A;  3FKW A;  4LV1 A;  4E3K A;  3KSG A;  5C5K A;  4WEL A;  4BEN A;  1V9Y A;  3EOI A;  4EWF A;  4PHT A;  3V67 A;  4MBF A;  4OP8 A;  5AQA A;  2ZQC A;  4QPR A;  1K25 A;  2IA2 A;  2W1T B;  1W63 M;  1W63 Q;  3NHQ A;  3C4O A;  3OCN A;  3UE6 A;  4LLO B;  5L09 A;  3DBA A;  4ZAM A;  5HAP A;  2V0W A;  2V8C A;  3S1Y A;  1WYC A;  5DF9 A;  2ZC5 B;  3DW0 A;  3W4P A;  5IHV A;  4Y3I A;  5F5Y A;  5CHU A;  4R23 A;  3BFF A;  1W8Q A;  1AWI A;  3QP2 A;  3DTM A;  2B95 A;  1BYW A;  3AGF A;  1LI0 A;  1ERO A;  2VK3 A;  3G35 A;  5DJU A;  4GS9 A;  3EWK A;  3VP3 A;  1LT0 A;  3BFC A;  2PR6 A;  4WYY A;  4L9F A;  3IX4 A;  4XUX A;  2OV5 A;  3CUE C;  2O9A A;  3FC7 A;  3OZH A;  2L1M A;  3G30 A;  4S2N C;  1OJ5 A;  4UEY A;  2HJ9 C;  2HV1 A;  1G6O A;  4OLD A;  4KG2 A;  5G4Z A;  1RP5 A;  2W3F A;  1CF0 A;  1CJF A;  1STZ A;  4JXG A;  2EFU A;  2Y2J A;  3GVB A;  3T4O A;  3RJU A;  1KGF A;  1KE3 A;  1K54 A;  5HDC A;  5EVI A;  1N9L A;  4UQI S;  1ERQ A;  4X55 A;  4E04 A;  1BLH A;  2ZQ8 A;  2P08 A;  2WKR A;  4NKP A;  2J3T C;  1PYY A;  3HLE A;  3VV4 A;  1ES2 A;  1IYS A;  4LRZ E;  4R4S A;  2XD1 A;  5DF7 A;  1YMS A;  5KMW A;  1EWZ A;  1HZO A;  2PD7 A;  2QZ6 A;  1KDW A;  2OOL A;  3N6I A;  4GDN A;  4EES A;  2W1R A;  4LV0 A;  4EET B;  3IS2 B;  3E4Q A;  1CI8 A;  3QHY A;  4KUK A;  5J7E A;  2ZL1 B;  4ZBE A;  4YWZ A;  2GDN A;  1FIL A;  1PFL A;  3UDF A;  2Y2P A;  4B4X A;  3VOZ A;  4WZ5 C;  1H8Z A;  3DWK A;  5AQ7 A;  1PI5 A;  1NYY A;  3H82 A;  4HNB A;  1LL9 A;  4FUW A;  3UY6 A;  1F5M A;  1WYB A;  3Q1F A;  3A0V A;  4C6Y A;  1YKD A;  4UAA A;  3UDI A;  4LRY C;  1XA7 A;  5LBR A;  4MBH A;  3IBJ A;  1JNU A;  4MN7 A;  2JKR I;  3GEC A;  1YLZ A;  2XA7 M;  3VSK A;  5EM1 A;  3FWL A;  3RFB A;  4WZ4 A;  3RH8 B;  1JTD A;  4HQA A;  1QME A;  4ZJ1 A;  3S7N A;  3BYD A;  3K2N A;  3ZDJ A;  4EEP A;  4KQD A;  5GLD A;  4HY8 A;  1I5Q A;  4OKP A;  2XDM A;  2I72 A;  4DKI A;  2IWD A;  3SH9 A;  4GCZ A;  1ALQ A;  1XJ3 A;  2Y2K A;  2V0U A;  2EXB A;  3O87 A;  3VFH A;  4O01 A;  3BFE A;  1K54 C;  4RVA A;  2JKT I;  2VZW A;  5GHX A;  4LV2 A;  2GZA A;  4BBV A;  5KIZ A;  5DTS A;  4U0T A;  3T4S A;  1DP6 A;  4HP9 A;  4D2O A;  1IYQ A;  5AVE A;  4P6Z M;  1TDG A;  2ZBB A;  1TF1 A;  4Y17 A;  4WL9 A;  5TGF A;  1K6S A;  5DKK A;  3IXG A;  3V50 A;  3NC8 A;  3UE3 A;  4P85 A;  4HIA A;  2XA7 S;  2AVX A;  3QP5 A;  2QHK A;  1CI9 A;  3FV7 A;  3V3R A;  2HDQ A;  2I9V A;  3IT9 A;  3W2Z A;  1MXO A;  3CWF A;  2W3H A;  2X02 A;  1KVL A;  5GLB A;  2K7S A;  4KG5 A;  3MXS A;  4GN2 A;  2M7V A;  1TVF A;  3NCK A;  3UB9 A;  3CMZ A;  2FFY A;  1HD8 A;  3FPV A;  5HD3 A;  5EUA A;  4HP4 A;  3OC2 A;  3UB5 P;  3OLO A;  1G68 A;  2J3T D;  1YLJ A;  1LLB A;  2OWH A;  1XJ2 A;  1Y54 A;  2VGJ A;  3UE1 A;  2C6W B;  4DF6 A;  3VP0 A;  2ZC3 B;  1Z6F A;  3EEH A;  4Q0J A;  1OTB A;  1O07 A;  5FQ9 A;  4P6Z S;  2VJW A;  5CEC A;  3UMD A;  4ZDX A;  1IOU A;  2WZX A;  1I2S A;  2JKR M;  3T12 B;  2E8I A;  4N92 A;  2BG1 A;  2PAV P;  1G6A A;  1BTL A;  4I38 A;  4PKY A;  4DMZ A;  5GLC A;  4R70 A;  5FQM A;  1FR6 A;  2GX5 A;  5FI6 A;  3MSH A;  2ZC6 B;  3HLG A;  1YMX A;  5JYP A;  4HOI A;  1IYP A;  3V39 A;  3ISG A;  1K4F A;  1X0O A;  2B5R A;  2KOI A;  3O5Y A;  4ME4 A;  5CED A;  4ETZ A;  2KDK A;  2O99 A;  4EXO A;  3L9K A;  4KEN B;  1UGU A;  2JKT M;  5F1F A;  1MKI A;  1JWZ A;  1VHM A;  3BM6 A;  2HDS A;  1BLP A;  5TBM A;  4R3A A;  5FAP A;  3NY4 A;  4ARZ A;  2JKF A;  4UA7 A;  1XA1 A;  4GS9 B;  4MNR A;  2ZD8 A;  3MJQ A;  5L07 A;  1VEU A;  5EPH A;  1XFQ A;  1ZG4 A;  4CJN A;  2DCF A;  4B9O A;  5FAT A;  4ID4 A;  4S2I A;  5GL9 A;  5E2G A;  1N4O A;  1OTD A;  4KQR A;  2WKH A;  3NBL A;  1YLY A;  2XSS A;  5K5B A;  5DFY A;  1YSQ A;  5CXW A;  3T4L A;  1OT9 A;  4LCM A;  2X01 A;  4Q8I A;  4JF4 A;  3NI9 A;  1MPL A;  4BJP A;  4WEK A;  5TJJ A;  4IBR A;  1TS0 A;  1TD5 A;  4WMC D;  5HAR A;  2O0Y A;  1MWT A;  3A3E A;  4FH4 A;  4BMW A;  1OTE A;  3PYP A;  4LRX C;  2P9V A;  4O7D A;  4X1M A;  4QJG A;  1VM1 A;  5EEC A;  2ZQA A;  1NYM A;  5F6A A;  1S4S A;  4NK3 A;  3E2L A;  3NOU C;  1FCM A;  1IFQ A;  3AGE A;  3PAG A;  2P7J A;  4CQH A;  1L0F A;  3T1R A;  2QYB A;  4WEJ A;  1XP4 A;  1K4E A;  2R9W A;  3HCY A;  1Y28 A;  5GLA A;  1W7F A;  3ZCZ A;  4K0X A;  1UWP X;  2JC7 A;  3IBR A;  1CEG A;  4N1X A;  4PM8 A;  2G2U A;  5GHZ A;  4CLC E;  4KZA A;  4P0M A;  1MWU A;  3HRE A;  5A92 A;  2A24 A;  3U2A A;  2V1B A;  3D72 A;  4Z1W A;  1F2K A;  4F94 A;  5EE8 A;  2X71 A;  1W5D A;  2ZQ7 A;  5CTM A;  1ACF A;  4O8G A;  4X53 A;  4Y13 A;  2VV8 A;  3CG5 A;  4GW9 A;  4EW7 A;  3HUN A;  3IH9 A;  4HH3 A;  4QD4 A;  3FG8 A;  1OPX A;  4OPZ A;  4EER A;  5A93 A;  5HAQ A;  4H8R A;  3PTE A;  1OME A;  3UPP A;  4QU3 A;  3JYI A;  1T1A A;  1K55 A;  5AVF A;  2Z6D A;  2DMW A;  4G3K A;  3MR0 A;  1TS7 A;  3C7U A;  4JGR A;  5FL3 A;  2W3D A;  3OPL A;  3M2J A;  3K3D A;  3LO7 A;  1DP9 A;  5G18 A;  3C5A A;  3ZG5 A;  1OT6 A;  1TDL A;  3W4O A;  2ZM2 A;  4NET A;  2V9A A;  1O7E A;  3TRC A;  3QP4 A;  4OPR A;  3IF6 C;  2WAE A;  4DE0 A;  3KSH A;  4CLC A;  3G2Y A;  3SW1 A;  4JGQ A;  5J4E A;  4I3I A;  1MKM A;  5GHY A;  3Q82 A;  1NZO A;  1GCE A;  3B47 A;  5FEF A;  3H7W B;  3N8S A;  4S2J A;  2VGK A;  3MS6 A;  1ESU A;  4ZRR A;  4JXW A;  1UWN X;  1S4R A;  1GSW A;  1YPR A;  2VGL S;  1K56 A;  3KYE A;  4MCW A;  1E4D A;  4WM9 A;  3Q7V B;  3PBT A;  3JPU A;  1LHY A;  2OLV A;  4GZB A;  4YNR A;  2K2N A;  1T19 A;  1WE4 A;  1KVM A;  3IHA A;  1YT4 A;  4FTX A;  4Z9Q A;  3CAX A;  5CX7 A;  2DRW A;  4CPK A;  4XT2 A;  4K91 A;  4P87 A;  1GSV A;  1Q2Q A;  2WGV A;  3I7J A;  1CEF A;  1YLT A;  5L8M A;  3LIC A;  2WAF A;  1XPB A;  2PYP A;  3IXH A;  1S66 L;  2C5W B;  4JKT A;  4X25 A;  3BEC A;  3IWQ A;  5EFW A;  4ESP A;  1BLC A;  3LI9 A;  3NIA A;  1SZV A;  3C8C A;  3HUM A;  3Q07 A;  1T1B A;  3VSL A;  5F69 A;  1HVB A;  4MBK A;  4GD8 A;  1LSX A;  2Y79 A;  3T1S A;  2Y55 A;  2VLG A;  1JWV A;  2RCX A;  1ZKJ A;  3MBZ A;  5EOO A;  1S1Z A;  3G31 A;  3LFV A;  3GSG A;  5DF8 A;  4HJ4 A;  2HF6 A;  4KZ3 A;  3HUO A;  4PM9 A;  3VOY A;  4R1G A;  3CLO A;  4NXE A;  4NXF A;  3LIE A;  3MQO A;  2P74 A;  3G4P A;  3IX8 A;  5G4Y A;  1IEL A;  1XGI A;  3ZG0 A;  4BL3 A;  5J8X A;  3R7W A;  3WRZ A;  4S2K A;  1YSP A;  3WRT A;  3ZG7 B;  3WS5 A;  1D1J A;  3WS1 A;  3TW8 A;  1H0M A;  3C2W A;  1P97 A;  4EEU A;  4HBU A;  1YLP A;  2EXA A;  2W27 A;  1FOF A;  3LI8 A;  3C30 A;  3QNC A;  1YAX A;  4X69 A;  1YLW A;  2EWW A;  2EX2 A;  1S6R A;  3SS3 A;  2WGW A;  5F83 A;  1XGJ A;  4DE2 A;  4FOF A;  3LYX A;  2J9O A;  1PRQ A;  2PHY A;  1P9W A;  1IEM A;  2K31 A;  2QPN A;  3NEC A;  1E3U A;  3F1N A;  1U60 A;  4I3A A;  2PYR A;  2PRF A;  5FI2 A;  5KZH A;  1VET B;  4BBT A;  3UPO A;  1PZP A;  4HES A;  3TG9 A;  4II7 A;  4KZ6 A;  3U4L P;  2Q9N A;  3IF6 B;  1ONG A;  2GNX A;  2P9V B;  3P98 A;  2HZ5 A;  5M19 A;  3MKF A;  4OOY A;  3WS0 A;  1DJB A;  2XFT A;  3CPT A;  4KZB A;  4H6J A;  5HWT A;  3B42 A;  4R6L A;  2O9C A;  3T4T A;  5EVI C;  1F98 A;  1BT5 A;  1ZC2 A;  2PT7 A;  5AQB A;  4RX2 A;  3BEB A;  1LL5 A;  3PBN A;  1L0D A;  4M4X A;  4QHC A;  2XD5 A;  2J9P A;  3L7H A;  2Y2N A;  3DWZ A;  2QWS A;  4BD0 A;  4E3I A;  3IWI A;  1TS8 A;  1GHI A;  4MEZ A;  5HSQ A;  1YQS A;  1N9B A;  5E2F A;  3T4Q A;  4EUV A;  1SKO A;  1E25 A;  3UB7 A;  4XUZ A;  5FAQ A;  2A24 B;  3HJK A;  2KX6 A;  4MLL A;  2H28 A;  1NWZ A;  1K57 A;  2ZOH A;  2W1T A;  3MZE A;  1D7E A;  1NLY A;  1BLS A;  5A91 A;  3LCE A;  5IS1 A;  2ZQ9 A;  4WN5 A;  1MWR A;  4HEF A;  3PAE A;  4U3T A;  2M7U A;  2HP9 A;  4IJG A;  4NG2 A;  3OPR A;  5FQK A;  1FQG A;  2B18 A;  3FKV A;  4GHI B;  3VE4 A;  4OQI A;  4R3B A;  2Z6C A;  1OJG A;  5I94 A;  2EX6 A;  4AFI A;  1CK3 A;  1PWD A;  1YM1 A;  5CGW A;  4KZ5 A;  5HPI A;  2MJ6 A;  2D02 A;  3HLW A;  2WAD A;  4KZ7 A;  3TOI A;  3LEQ A;  3QP8 A;  3ZVW A;  3MFD A;  1DY6 A;  1ZHH B;  2OAP 1;  5CHM A;  3ZGA B;  4OLG A;  3LR0 A;  2HDU A;  3VP1 A;  3ZQ5 A;  1SHV A;  3MF0 A;  4FCF A;  1M40 A;  5DVA A;  4BWI A;  1NRF A;  5IU1 A;  4EU0 A;  5FA7 A;  1PZO A;  1NXY A;  1JVJ A;  4IED A;  2R9X A;  1J3W A;  4QY5 A;  4ZTK A;  3UME A;  4NXG A;  1XXM A;  1ERM A;  4PAU A;  3UNW A;  2JCH A;  4PM6 A;  1D06 A;  1P9R A;  2E8J A;  3WWX A;  2UV0 E;  2XGN A;  2OAQ 1;  4KUO A;  3QNB A;  3A3J A;  1L0G A;  2ZM0 A;  2XH9 A;  5D3O A;  3MFX A;  3FPW A;  2HJE A;  3A3F A;  3T4J A;  2OLU A;  4D60 A;  1VB6 A;  2H10 A;  1S1Y A;  5DTT A;  4Q0H A;  2PU2 A;  4LV3 A;  4O0P A;  3IS2 A;  4E3O A;  3MXQ A;  2ZL1 A;  1J9M A;  4X56 A;  2JKG A;  2IWB A;  5F82 A;  3T1Q B;  5CGX A;  3GMW A;  1T1C A;  2Z2M B;  5EVI D;  1TEM A;  5FQJ A;  3V5M A;  4DRT A;  3O88 A;  1H3Q A;  4F3L A;  2ZMV A;  3OOV A;  1H5X A;  5EVI B;  1W79 A;  1PW1 A;  1BSG A;  4I39 A;  4EBL A;  2Y2O A;  4Y7P A;  5L2F A;  3WS2 A;  3UE0 A;  5BOH A;  4OPY A;  3EGX C;  1VQQ A;  4R38 A;  1MZU A;  5HL1 A;  1SDE A;  3G2Z A;  2HP6 A;  3PHY A;  4IVI A;  4OOL A;  3NDG A;  3C38 A;  4LFU A;  2O9B A;  3A3I A;  5DJT A;  2WKI A;  3W4Q A;  4XXR A;  3HLF A;  5CER A;  4DDS A;  2V2F F;  1JTG A;  5DTK A;  5MC7 A;  3NOT C;  4P6B A;  3H82 B;  2JN7 A;  3QP1 A;  1HLU P;  1L2S A;  3G6O A;  3LUQ A;  5KSH A;  2PU4 A;  2Y2I A;  3S7O A;  1PW8 A;  4PMA A;  2XRN A;  3T50 A;  4Y0U A;  4GB7 A;  2XRO A;  5FI7 A;  2WK0 A;  2WGW B;  1L3L A;  5FDH A;  3WS4 A;  1PIO A;  1M6K A;  3NOP C;  5CHJ A;  1A0K A;  1BUL A;  2LB9 A;  2Y2Q A;  3ZHH A;  5J3W A;  3UO9 A;  4R0Q A;  2VEA A;  3LIB A;  1DJC A;  4OP5 A;  1MWS A;  2JBF A;  1Q2P A;  4JGO A;  1ES3 A;  4HHD A;  1PWG A;  3A0R A;  4L0L A;  3T4K A;  3IF5 A;  4JXV A;  3CUE A;  4E6X A;  3CJM A;  3D3O A;  3BWL A;  3O86 A;  4KQQ A;  4S2N A;  1XKZ A;  4EQ1 A;  3MZD A;  2NUP C;  1NJ4 A;  1XX2 A;  1DP8 A;  1XFN A;  4L9E A;  4X1L A;  4ETX A;  2Y2G A;  3QP6 A;  2EX9 A;  3S7Q A;  3LY4 A;  4KG6 A;  3N8R A;  2XF3 A;  2J7V A;  3OPH A;  4WLA A;  5F68 A;  3NUL A;  1ONH A;  3R4K A;  1IYO A;  1CQA A;  3C7V A;  1SKO B;  3PBR A;  4MN5 A;  5AQ9 A;  3ZYT A;  4OQH A;  3DTK A;  1SKF A;  2M1C A;  2UWX A;  2ZC4 B;  4MDZ A;  2VX8 A;  4MMN A;  1I2W A;  3HLB A;  4JLF A;  4UA6 A;  2L4R A;  5FDS A;  1FCO A;  3ZVT A;  4WZ5 A;  4LCL A;  5M1A A;  4GDB A;  1G28 A;  5FQQ A;  3EGD C;  3ZG9 B;  3E2K A;  3LR4 A;  2QKP A;  1WA9 A;  3OCL A;  3BY9 A;  1C3B A;  4UQI M;  1F9I A;  2WYX A;  3JVV A;  4KZ4 A;  1GSX A;  1K38 A;  1OTA A;  1GHP A;  1H8Y A;  3IXB A;  4S2L A;  4R4R A;  2HP5 A;  4E3N A;  2ZC7 A;  3E4O A;  5HPF A;  1QMF A;  4DN0 A;  1ESI A;  4GNU A;  1GHM A;  3AGD A;  4JF6 A;  3E98 A;  4WUJ A;  4Y15 A;  3A0S A;  2W0N A;  2IWC A;  2JE5 A;  3SOI A;  1K55 C;  3D9Y A;  3Q81 A;  2J3W A;  3TJZ C;  4B4Z A;  2A3U A;  2ZMF A;  1LL8 A;  2VKS A;  3VP4 A;  3LR3 A;  4Y0O A;  1SDN A;  3PXP A;  4HBT A;  1FSY A;  2A49 A;  2VA0 A;  1FCN A;  5HAI A;  5U47 A;  1W8Y A;  1ODV A;  3LGO A;  4YOF A;  2G7U A;  1AXB A;  3LIA A;  3KO6 A;  4UA9 A;  2ZQD A;  1GA0 A;  3MMH A;  5EVE A;  5EVL A;  4BBU A;  2JHE A;  3IXD A;  5HFO A;  4K08 A;  4CLC C;  3W8K A;  4Y0T A;  3ZFZ A;  2NUT C;  5A8B A;  5TBM B;  4ARZ B;  4N1H A;  3HLC A;  5FQI A;  3PBS A;  4WMC A;  2OWJ A;  1VEU B;  2ZOI A;  1RCJ A;  3E4P A;  3UDX A;  4YFM A; 
#chains in the Genus database with same CATH homology
 4IJG A;  4PHT A;  1LSW A;  3V67 A;  2B18 A;  3MQ0 A;  4GHI B;  1V9Z A;  3VE4 A;  4HJ6 A;  2J80 A;  2Z6C A;  4BJP A;  1OJG A;  4QPR A;  4WEK A;  2FH5 A;  2IA2 A;  2W1T B;  5TJJ A;  1TS0 A;  1TD5 A;  2O0Y A;  1W63 M;  1W63 Q;  3NHQ A;  4AFI A;  4BMW A;  1OTE A;  3PYP A;  5HPI A;  3OCN A;  3UE6 A;  4LRX C;  2MJ6 A;  1N9N A;  2D02 A;  3EQV A;  4LLO B;  4F3L B;  2QJ7 A;  4HH2 A;  4WF0 A;  3DBA A;  5AJG A;  1ZHH B;  2OAP 1;  3ULF A;  2V0W A;  3LR0 A;  2P04 A;  1P0Z A;  4B93 A;  3ZQ5 A;  5DF9 A;  3MF0 A;  4G3W A;  5F6A A;  1S4S A;  2CMN A;  4L9G A;  3CI6 A;  4OOM A;  3NOU C;  4BWI A;  1IFQ A;  4Y3I A;  5IU1 A;  5F5Y A;  4EU0 A;  3VE3 A;  2QJ5 A;  2PD8 A;  2P7J A;  4CQH A;  5I5L A;  2QYB A;  4WEJ A;  3KYZ A;  1BYW A;  3HCY A;  1Y28 A;  3UME A;  3F1P A;  4NXG A;  1UWP X;  3IBR A;  4PAU A;  5DJU A;  4GS9 A;  3EWK A;  1D06 A;  1LT0 A;  1P9R A;  3KSF A;  2PR6 A;  4L9F A;  4CLC E;  2OAQ 1;  3CUE C;  4KUO A;  2V1A A;  2O9A A;  3FC7 A;  2A24 A;  3U2A A;  2V1B A;  2L1M A;  3D72 A;  4Z1W A;  2WKQ A;  3LIF A;  3FPW A;  3MFX A;  1OJ5 A;  2HJE A;  4UEY A;  2HJ9 C;  2HV1 A;  1G6O A;  3T4J A;  3F1O A;  5G4Z A;  1VB6 A;  2W3F A;  2EA9 A;  1STZ A;  1S1Y A;  4JGP A;  1MC0 A;  4O8G A;  4Q0H A;  3T4O A;  4O0P A;  2VV8 A;  3IS2 A;  3MXQ A;  5HDC A;  4GW9 A;  4EW7 A;  4HH3 A;  1N9L A;  4UQI S;  3FG8 A;  1OPX A;  4EER A;  4E04 A;  2P08 A;  2WKR A;  1T1A A;  2J3T C;  4NKP A;  5AVF A;  2Z6D A;  2DMW A;  3VV4 A;  4G3K A;  4LRZ E;  1T1C A;  3MR0 A;  1TS7 A;  2PD7 A;  4JGR A;  2OOL A;  4EES A;  2FZ0 A;  5FL3 A;  2W3D A;  3K3D A;  2W1R A;  1DP9 A;  4EET B;  1H3Q A;  3IS2 B;  3H7W A;  3E4Q A;  4F3L A;  2ZMV A;  3OOV A;  4KUK A;  5J7E A;  4YWZ A;  4I39 A;  1OT6 A;  3JVU A;  5HDS A;  2V9A A;  2YKF A;  3TRC A;  3KSH A;  1XJ4 A;  4CLC A;  3SW1 A;  4JGQ A;  3H82 A;  5J4E A;  3EGX C;  1MKM A;  4I3I A;  4HNB A;  4R38 A;  3ICY A;  1MZU A;  3B47 A;  3PHY A;  4OOL A;  1OTI A;  3PBO A;  3H7W B;  4IHQ A;  3C38 A;  3PBQ A;  1F5M A;  2O9B A;  5HL6 A;  4ZRR A;  5DJT A;  4CLC D;  1UWN X;  1S4R A;  1GSW A;  2VGL S;  4MCW A;  3BY8 A;  3VOL A;  3A0V A;  1YKD A;  5MC7 A;  3PBT A;  4CLC B;  3NOT C;  4LRY C;  3UB8 A;  3H82 B;  5LBR A;  3IBJ A;  2JN7 A;  1JNU A;  3CIT A;  4MN7 A;  4YNR A;  2K2N A;  3TE8 A;  1T19 A;  2B02 A;  3G6O A;  2JKR I;  3GEC A;  2EWV A;  2XA7 M;  3LUQ A;  5KSH A;  3S7O A;  3RFB A;  3RH8 B;  4NXB A;  4HQA A;  2XRN A;  3S7N A;  3T50 A;  3CAX A;  3K2N A;  5CX7 A;  4EEP A;  1N9O A;  4KQD A;  4XT2 A;  4HY8 A;  1GSV A;  4LPZ A;  2XRO A;  4NEE D;  4HI4 A;  5L8M A;  3LIC A;  2PYP A;  1S66 L;  1LSV A;  1NRJ A;  4GCZ A;  2PDR A;  2KLI A;  1XJ3 A;  2V0U A;  3NOP C;  4GJ4 A;  2LB5 A;  5EFW A;  4O01 A;  3LI9 A;  2JKT I;  3C8C A;  4FSF A;  5IT5 A;  2VZW A;  2LB9 A;  2WKP A;  4G3V A;  4XT2 B;  1T1B A;  5J3W A;  2GZA A;  2VEA A;  3LIB A;  4BBV A;  5F69 A;  5KIZ A;  5DKL A;  3T4S A;  4JGO A;  1DP6 A;  4HP9 A;  2VV6 A;  5AVE A;  4HHD A;  3EEA A;  4HJ3 A;  4DJ3 A;  1LSX A;  4P6Z M;  3A0R A;  2ZBB A;  4L0L A;  2Y79 A;  1TF1 A;  3T4K A;  3CUE A;  3D3O A;  4WL9 A;  2VLG A;  4I3J A;  4DJ2 A;  3BWL A;  4Y5F A;  5DKK A;  1S1Z A;  2R78 A;  3UE3 A;  4EQ1 A;  4HIA A;  2XA7 S;  3MQQ A;  2NUP C;  1DP8 A;  2QHK A;  3LFV A;  1XFN A;  1NLZ A;  4L9E A;  2W3E A;  4ETX A;  4HJ4 A;  2HF6 A;  2I9V A;  3CLO A;  4NXE A;  3W2Z A;  4NXF A;  3LIE A;  3MQO A;  3OBF A;  3CWF A;  3S7Q A;  2PR5 A;  5G4Y A;  2W3H A;  2K7S A;  2M7V A;  3KYQ A;  3R7W A;  4WLA A;  5F68 A;  3UB9 A;  1YSP A;  2A2L A;  3R4K A;  3FPV A;  3TW8 A;  5HD3 A;  3PBR A;  2GJ3 A;  4MN5 A;  3C2W A;  1P97 A;  4HP4 A;  4EEU A;  3OC2 A;  3ZYT A;  3BQ8 A;  2M1C A;  3OLO A;  2J3T D;  2W27 A;  3H9W A;  3B33 A;  4MDZ A;  2OWH A;  1XJ2 A;  2VX8 A;  3LI8 A;  4MMN A;  3P7N A;  3GDI A;  3C30 A;  3P01 A;  1YAX A;  2L4R A;  4IUK A;  3EEH A;  3R7W B;  4Q0J A;  1OTB A;  2EWW A;  4P6Z S;  3KSI A;  3BQA A;  2VJW A;  2D01 A;  3PR6 A;  1G28 A;  4FOF A;  2HGV A;  2Y8H A;  3LYX A;  3EGD C;  2PHY A;  1P9W A;  3LID A;  2K31 A;  3LR4 A;  3F1N A;  3UMD A;  3NJA A;  5DFX A;  2QKP A;  1WA9 A;  4I3A A;  2PYR A;  3OCL A;  3BY9 A;  4BBT A;  3KX0 X;  4UQI M;  1IOU A;  2JKR M;  1F9I A;  3E0Y A;  3HJI A;  4II7 A;  3JVV A;  1TS6 A;  1GSX A;  4PKY G;  3RTY A;  1OTA A;  2L0W A;  4I38 A;  4PKY A;  4DMZ A;  4Y2F A;  4R70 A;  2GNX A;  2GX5 A;  2INW A;  3LR5 A;  3E4O A;  3F1N B;  5HPF A;  4HOI A;  1EW0 A;  4H6J A;  5HWT A;  5HWV A;  3B42 A;  3S7P A;  4R6L A;  4IUH A;  4DN0 A;  1X0O A;  2O9C A;  3T4T A;  2KOI A;  3O5Y A;  2W3G A;  4ME4 A;  1F98 A;  4I5S A;  4Q0I A;  1S67 L;  4ETZ A;  2PT7 A;  2KDK A;  2O99 A;  4EXO A;  1UGU A;  3E98 A;  1XJ6 A;  4WUJ A;  3A0S A;  2W0N A;  3PBN A;  3EQU A;  2JKT M;  4M4X A;  2VV7 A;  5HWW A;  2J3W A;  5HZH A;  3TJZ C;  2ZMF A;  1LL8 A;  2VKS A;  3LR3 A;  2YKH A;  3PXP A;  3F1P B;  1VHM A;  2QWS A;  4H6J B;  5TBM A;  2VA0 A;  4R3A A;  4ARZ A;  4GS9 B;  4RQ9 A;  4MN6 A;  1TS8 A;  2VGL M;  1ODV A;  5HD5 A;  4YOF A;  4GLQ A;  5HSQ A;  2G7U A;  3T4Q A;  4EUV A;  1H8M A;  3MJQ A;  3LIA A;  3KO6 A;  3UB7 A;  1XFQ A;  2A24 B;  1T18 A;  3HJK A;  2KX6 A;  3MMH A;  3BW6 A;  4BBU A;  2JHE A;  4B9O A;  2BAS A;  2H28 A;  1NWZ A;  4GHI A;  4K08 A;  4CLC C;  3F1O B;  3BJN A;  2NUT C;  2ZOH A;  5A8B A;  2W1T A;  4KQO A;  5TBM B;  3K3C A;  4ARZ B;  1D7E A;  1KOU A;  1NLY A;  1OTD A;  1ZTU A;  3UB6 A;  5IS1 A;  1DRM A;  5HDD A;  4WN5 A;  3PBS A;  2XSS A;  5K5B A;  2OWJ A;  3KSG A;  5C5K A;  5DFY A;  2ZOI A;  4WEL A;  2M7U A;  1V9Y A;  1YSQ A;  3T4L A;  3E4P A;  1OT9 A;  3EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...