4GJ4A

The crystal structure of the soluble guanylate cyclase pas alpha domain from manduca sexta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
IGVASFAKAFPWHFITDKRLELVQLGAGFMRLFGTHLATHGSSLGTYFRLLRPRGVPLDFREILKRVNTPFMFALKMPGSTALAEGLEIKGQMVFAAESDSLLFVGSPFLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Soluble guanylyl cyclase alpha-1 subunit
publication title Crystal structure of the Alpha subunit PAS domain from soluble guanylyl cyclase.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lyase
total genus 24
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gj4A00
2P08A 4GJ4A 2P04A
chains in the Genus database with same CATH superfamily
1LI9A 3BQ8A 3KSFA 1IYPA 3SH8A 2Z2MB 5DJUA 3LI8A 3Q81A 3T1RA 5EECA 1PFLA 5CTMA 2ZOIA 3FWLA 1N9BA 3W4QA 2V0WA 1FILA 4KZAA 5F68A 3LR5A 2FZ0A 4OP5A 3CUEC 1A0KA 2J3TD 3MQ0A 1CF0A 2J80A 5F83A 4X68A 2PAVP 5DTSA 2K31A 2YKHA 4QB8A 5EFWA 3IF5A 4XUZA 2ZC5B 2PHYA 1NYMA 5TGFA 3S22A 5J8XA 4BQMA 2OWJA 5HDDA 3IHBA 4KZ7A 1D1JA 2VK3A 4CLCC 2INWA 4DDYA 4JGRA 4L9FA 3WS2A 1YT4A 3BECA 4BBVA 5FQKA 1D06A 1HD8A 4LRYC 2Y79A 2O0YA 2HDRA 1XA7A 4MNRA 3TRCA 3EEHA 4XT2B 2DNSA 3A0RA 3T4KA 4IBXA 5DFYA 3MKEA 1OTEA 4X1LA 5HDCA 2ZC7A 2PBDP 3ZVTA 3HVFA 4G3KA 3A3DA 4CPKA 2QHKA 3VP1A 1KVMA 5KMWA 1NXYA 5KIZA 3IWQA 2Y2JA 3S7NA 1N9OA 3UY6A 1I2WA 3OC2A 3VP0A 5J3WA 3UB7A 3Q82A 3ICYA 1PZPA 4JXVA 2PYRA 3S4XA 1T19A 1P0ZA 3D9YA 2V20A 4OQHA 1XA1A 3NBLA 3H7WB 3R7WA 4BD1A 2XROA 4PMAA 3VOYA 1DP8A 3CMZA 4E04A 2Y2IA 3ZGAB 4ARZA 1FCOA 2G7UA 2JN7A 2HV1A 3IF6B 5IHVA 3UE3A 5F1FA 1FSYA 5FAQA 4S2NC 4AFIA 4YFMA 5EVIA 1IOUA 4S2LA 1VEUA 4YOFA 1S0WA 4GN2A 2J9OA 3LICA 1V9YA 3BWLA 2DRWA 3VOZA 1O7EA 1ZC2A 2XA7S 3N8SA 2WADA 4OOMA 2KX6A 2Y2GA 4N92A 4KQRA 2ZJ9A 2I9VA 1ONGA 2BASA 1ERMA 4QY6A 2ZMAA 5HAPA 1CQAA 2MJ6A 3C38A 2WGWB 4I5SA 4NK3A 2OSUA 2HP5A 3QP4A 4ZJ3A 2ZC4B 3TSGA 4IUHA 3KSHA 4QHCA 1W63Q 3P09A 4JLFA 2VGJA 3VSLA 4Z1WA 4HJ3A 2WK0A 1OTIA 1P97A 1YPRA 2WGIA 3W4OA 3CG5A 2P08A 4ETZA 1ALQA 3CWFA 4GOGA 3K3CA 4HOIA 2W3GA 2P7JA 3DAVA 1TS7A 2RCXA 1BUEA 4I3IA 4FH4A 3UB8A 2XRNA 3VE3A 3GDIA 2ZD8A 5HD3A 1KGFA 4C6YA 3UPNA 3S7QA 3T50A 1JWZA 2K7SA 1MWRA 3LGOA 3PBSA 4P87A 3ZHHA 5E2GA 2ZL1A 1S66L 4GDBA 4DXCA 3WRZA 1IKIA 1N9LA 3NY4A 3KX0X 1TS0A 3S7PA 1G6AA 3C7VA 3M2JA 4WEKA 4GLQA 3BYDA 4KZBA 2Y91A 3PTEA 3UO9A 4IHQA 3W4PA 2Y2MA 4S2PA 2Y2PA 3M2KA 2EFXA 3T1QB 2VV8A 1PZOA 3MKFA 1BZAA 2Z6DA 4E3NA 2D02A 3UE6A 3SW1A 3U4LP 5FI2A 5G18A 3UPOA 3TJZC 5JYOA 1RGYA 1EWZA 2XDMA 1L0DA 4EBLA 3R7WB 3DTKA 2O99A 3IWOA 1IKGA 1YLPA 1LL8A 4ARZB 2XK1A 1W7FA 2VZWA 4EQIA 3CUEA 5FEGA 2WKRA 5DVAA 2A24A 3QP2A 1UWNX 4NXFA 4JF6A 3LEZA 4NXEA 5TBMA 3NDEA 4O0PA 1SHVA 3WRTA 4BD0A 1TDGA 3GQZA 1S1YA 5L8MA 2EA9A 5DTTA 1KE3A 5FA7A 5CEDA 3N8LA 1YKDA 3C2WA 3NI9A 1JNUA 3T4LA 3PBOA 2QMIA 3VOLA 1W8QA 4OONA 4CLCA 4Q0IA 3IH8A 4EEPA 2RL3A 3CJMA 1H8ZA 4HBUA 2A49A 3T1XA 2Z6CA 2ZLYA 4MDZA 1K55C 2OOLA 2V1AA 4F3LA 1WYBA 1FCNA 3A3JA 3QP5A 1YSPA 2PD7A 3CAXA 1QMFA 2HJEA 2X71A 3CPTA 4BL2A 4S2OA 4QWOA 2ZQ7A 5IU1A 4WN5A 3KYZA 2X01A 3MXSA 4OP8A 4UA6A 3ISGA 5HPFA 5HARA 4Y2FA 4YINA 2JKFA 3QNBA 4MMNA 3QP8A 5CGWA 5J4EA 1LLBA 4R3AA 1FQGA 3MZEA 1M6KA 3PBNA 5F6AA 4JXWA 3PHYA 5CHMA 3O3VA 3BEBA 2QYBA 4L9GA 1LSXA 1SKFA 3A0VA 2JKRI 4IVKA 4P6ZS 1XJ6A 4EW7A 1Y4OA 3FZCA 5FQJA 4B4XA 5FQ9A 5HL1A 2W1TB 3HUOA 2ZL1B 4FUWA 3FKWA 2EFUA 3VFFA 5M18A 2Y2LA 1P9WA 3VE4A 4DN0A 1MPLA 3IH9A 5MC7A 1ESUA 5I5LA 4P6BA 4X6TA 1BSGA 3SOIA 3JVUA 3L7HA 2WGVA 2Y2HA 2V8FA 1F98A 5A93A 3E4OA 2DCFA 3BRMA 4PKYG 2EX8A 1K54C 3NIAA 1W63M 3HUNA 5DF8A 3C7UA 2EWWA 3LYXA 4LRXC 4OOYA 3BFGA 3ZG5A 3Q7VA 1GSWA 2ZBBA 3F1NB 5FQMA 4P85A 1TDLA 4GJ4A 1ESIA 4S2JA 4QD4A 3OOVA 2PU2A 4UQIM 4WMCA 4DE2A 3PR6A 4HIAA 1FR1A 4OH0A 4E6XA 3IX3A 1K57C 5LBRA 1RGZA 4BLMA 1ES2A 5A92A 2XSSA 4X55A 3C4PA 3RXXA 3IHAA 4S2KA 5HDSA 2A24B 4MBHA 3ZCZA 1MKMA 3M6HA 3NOUC 5TBMB 3MXRA 3CI6A 3UMDA 1HVBA 2J8YA 1MBLA 1STZA 1CI9A 4Y3IA 2EX9A 3ZDJA 4OOLA 1HLUP 1E3UA 3B33A 4KZ8A 3FV7A 1S4RA 1ES4A 4KQQA 2FH5A 4UEYA 1VHMA 4OVDA 3FYZA 4CLCB 4E3OA 3F1PA 4LV2A 4OLDA 4EWFA 5GHYA 4H6JA 1FR6A 2XFTA 3SZTA 4ZJ1A 5DJTA 1MXOA 5CXWA 1JWPA 1XJ2A 2HPBA 3IX4A 4LCLA 5DKLA 4F3LB 3UMEA 1KOUA 1BULA 5HWWA 4OPRA 1YLTA 2H10A 2ZQ9A 3K3DA 2PYPA 4OQIA 4P0MA 1RP5A 3MFDA 5GHXA 1IYQA 2UWXA 3MFXA 3AGDA 5F1GA 1NLYA 2HP9A 4KUKA 2WZXA 1F2KA 3AGEA 3N8RA 4MN5A 2JKGA 3MXQA 1IFQA 3V50A 2DMWA 3FC7A 4GCZA 4U0XA 5EPHA 1GSVA 1K38A 1KGEA 3VP3A 3GVBA 1ES3A 4GHIA 2GNXA 1FSWA 5AQ9A 4DRTA 2XH9A 3RXWA 3PAGA 3IXGA 2PU4A 2WKIA 3UN7A 1I2SA 3K2NA 1L0EA 3SS5A 3CZDA 2JC7A 1FCMA 3ZG9B 3BFFA 3H82A 3G2YA 3LIAA 1CJFA 4HEFA 3ZG8B 4JF5A 4WF0A 5AQ7A 5EOOA 2ZC3B 2O9CA 4IBRA 2QWSA 4HHDA 5D3OA 5M19A 5KZHA 1IEMA 4R1GA 3QNCA 2G2WA 4FOFA 1YMSA 4KZ3A 3D72A 1NWZA 3A3IA 3B3XA 3UB5P 2ZQAA 3EOIA 1K25A 2KLIA 3BJNA 4CLCD 3GMWA 1UWPX 5KSCA 2OWHA 3W8KA 1E25A 3NOPC 3E4QA 4X53A 1JVJA 3Q7VB 2VJWA 1PRQA 4JKTA 2B18A 1J3WA 4R6LA 1LI0A 5FEFA 1H8YA 4JGPA 3Q1FA 3F1OA 1S4SA 3EGXC 3HLBA 3B42A 4OQ0A 1SCWA 4ID4A 4R3JA 5HFOA 4Q8IA 2GDNA 4R3BA 3TG9A 2WAFA 2ZMFA 1WA9A 4X1MA 1K55A 4R0QA 1X0OA 1D7EA 2V0UA 4WM9A 1BLCA 1AXBA 4BMWA 4ZBEA 5CERA 4KG5A 1XGIA 1Y54A 4ESPA 3ZVWA 4GW9A 4N1HA 1PWDA 4IVIA 4D60A 4M3KA 3HREA 1I5QA 3UE1A 1P9RA 1LL5A 1YSQA 3UB9A 5FI6A 1GHPA 1OMEA 4EEUA 3GTCA 2EWVA 1H5XA 2QPNA 1DJCA 1H8MA 3D3OA 4ZJ2A 3SS3A 4LGWA 5M1AA 4JBFA 2XA7M 3ITAA 1J9MA 4OKPA 2JBFA 2QKPA 4H6JB 3G31A 2XD5A 5IS1A 4KZ9A 1VETA 1MY8A 3PAEA 3PBTA 3S7OA 2ZM2A 2ACGA 5E2EA 3CITA 5TFQA 5DFXA 4CLCE 2PD8A 4JF4A 2J3WA 3U2AA 3ULFA 3MBZA 1PI4A 2PDRA 3NDGA 1ZHHB 4GS9A 4FSFA 3IX8A 3E2LA 2OLVA 1U60A 4ME4A 2WYXA 4E3KA 2V8CA 4BBUA 1KDSA 5HSQA 4DKIA 3BLSA 1OTDA 3T4JA 4B93A 2QJ5A 4WMCD 5CHJA 4MBFA 2Y2OA 5FL3A 5DF7A 4GHIB 1K54A 2VA0A 3BM6A 4BENA 4R4SA 3BY9A 2VX8A 3N7WA 5EUAA 1YLYA 3H82B 2NUPC 2XGNA 3LIBA 4BBTA 1OPXA 4QY5A 2XR0A 4Q0HA 1W79A 5TR7A 3C30A 4I39A 5EV0A 3FPVA 4C3QA 3LUQA 2Q0OA 1K57A 5GLAA 3T12B 4Y0TA 3UE0A 3DWKA 2JCHA 3OPPA 1E3UD 1OTAA 4DDSA 3HBRA 4I3JA 2C5WB 4L9EA 2V2FF 4UA7A 3LI9A 4HP9A 3O87A 3N4IA 2QJ7A 4HI4A 4DXBA 3VP2A 1K4EA 2H28A 3E4PA 1TVFA 4LV1A 4DJ2A 4XXRA 3IS2A 2FFFB 3G32A 1TD5A 4EXOA 1OT9A 3LIEA 5E2FA 2K2NA 3L9KA 4DE0A 3ZFZA 4C75A 3MMHA 1MWSA 3G34A 2R9XA 3MR0A 4KUOA 5HAIA 3F1OB 1GA0A 1W5DA 2J7VA 1NRJA 3OCLA 5GLDA 3SS4A 3O5YA 2OLUA 5EVIB 3V5MA 4OPZA 4PM9A 4O01A 4WZ4A 1VEUB 1S67L 2EX2A 2W3FA 4BWIA 4NG2A 5U47A 5AJGA 1K4FA 3ZQ5A 1OTBA 4HJ6A 5G4ZA 5FI7A 2WKPA 2JKTI 1GHMA 1N9NA 4DJ3A 4I3AA 1KE4A 3BY8A 4YNRA 2PBYA 2WAEA 2J9PA 1DJBA 1Z6FA 1ZG6A 4MN6A 1XP4A 3N6IA 1NZUA 5EM0A 4WEJA 3KSGA 5EE8A 5GLBA 4NETA 2PRFA 1EW0A 1NY0A 5CGSA 1YLWA 3CHWP 1SKOA 1LHYA 5EM1A 5CHUA 2ZMVA 3IXDA 1IYSA 1WYCA 2BTFP 2ZC6B 1XFQA 5FAOA 2JHEA 1CI8A 2ZM8A 1ONHA 3Q7ZA 4DMZA 3OCNA 3HLCA 3C8CA 4JGQA 1DJAA 3QP1A 1JWVA 4RQ9A 4EESA 1VB6A 2D01A 3V3SA 2P9VA 4MBKA 4RVAA 4FCFA 2B95A 4OPQA 2E8JA 1TS8A 4DE3A 4HNBA 2A2LA 4FTXA 4XT2A 4N9LA 3A3EA 2LB9A 3GV9A 1XKZA 2W1RA 5EVID 3D4FA 1DP9A 1MZUA 3QP6A 4EBNA 4X25A 3G6OA 1RCJA 3FPWA 3UNWA 4P6ZM 4DF6A 2LB5A 4Y15A 5HL6A 4UA9A 1G6OA 5GHZA 3EQVA 4MLLA 5A90A 4X56A 3VP4A 3LO7A 4GNUA 3HL9A 3RTYA 4X69A 4S2NA 3G30A 1YM1A 2QZ6A 2H0TA 2M7VA 5L10A 3E98A 4PKYA 4RA7A 1XPBA 2ZQ8A 4EETB 3EGDC 4F94A 2A3UA 2J3TC 3IXHA 2VGLS 3IS2B 3DTMA 4WZ5C 2O9BA 3E0YA 2I72A 2B5RA 1E4DA 3KO6A 3IBJA 3OLOA 3KSIA 4B88A 4RX3A 1ACFA 1F5MA 3JPUA 4GB7A 4S2MA 5F69A 1Y28A 4FH2A 5FASA 4U0TA 5FDSA 1W8YA 3WS0A 2VGKA 4LCMA 3EQUA 1G28A 3MZFA 2BLSA 2WKHA 3CLOA 2OAQ1 2PT7A 5HW3A 2EXBA 2CC1A 4ZRRA 3DW0A 5K5BA 1G68A 2V1ZA 2H5SA 4EQ1A 3MJQA 4LPZA 3EWKA 4N1XA 4CQHA 2HF6A 5BOHA 4I38A 5E43A 4S2IA 4Y7PA 1K0KA 3RJUA 3MQQA 3BLMA 3OBFA 4HP4A 3W2ZA 5IT5A 4K0WA 3UPPA 4LFUA 1BTLA 2WGWA 3FKVA 4Y0UA 5JYPA 2Q9NA 4O7DA 3CPTB 4GKUA 5CX7A 5FQQA 1K56A 1SKOB 4II7A 1XJ4A 3EEAA 5EVLA 4D2OA 3NECA 1QMEA 3AGFA 5AQAA 2IWDA 3HLWA 4GDNA 1LT0A 3VSKA 4QJGA 1S6RA 2G2UA 1XFNA 1GCEA 2Y2KA 5CECA 1IELA 2P9VB 1EI5A 3LCEA 4E3LA 3BFCA 3LR3A 2BG1A 3MZDA 1DP6A 1BLPA 4MEZA 5CTNA 2CMNA 5E2HA 5GL9A 1HZOA 4U3TA 3WS5A 2ZQCA 1PYYA 2VEAA 3RH8B 2Y4AA 2ZQDA 4JXSA 3GRJA 4UAAA 1BLHA 1TEMA 3OZHA 3MQOA 2GZAA 4IUKA 3TOIA 3S1YA 5EVEA 3UB6A 2EXAA 2Q9MA 1SDEA 4GZBA 4PM7A 3BFDA 3LFVA 1L0FA 2HDUA 3KYEA 2WKQA 1FIKA 3P98A 5HPIA 4Y5FA 5AVEA 4PAUA 2B02A 5I94A 4L0LA 4WBGA 2VLGA 5KSHA 1ODVA 3GR2A 3O86A 4YWZA 5TJJA 1YAXA 3LEQA 4HJ4A 2XF3A 4MN7A 3WWXA 5L2FA 3Q07A 3HJIA 2YKFA 3LR4A 3DWZA 1ZTUA 4HESA 2V1BA 4OLGA 3VV4A 1T1BA 4A5RA 4QU3A 2O9AA 2UV0E 2KOIA 4PM8A 2NUTC 4LENA 3SH9A 1OJ5A 3G35A 1NZOA 2XD1A 1V9ZA 3SH7A 2GX5A 3MS6A 1VQQA 4KQDA 1GHIA 5AVFA 3HLFA 3LIDA 5EOEA 4NXGA 5DTKA 4EU0A 4KZ6A 1PW1A 3A0SA 4LV0A 1HTZA 3HUMA 1BLSA 1XJ3A 1SDNA 1ZG4A 3P7NA 4Y17A 5F5YA 2OV5A 4IEDA 3H9WA 3F1PB 2HGVA 3IF6C 2IWBA 1OT6A 1MC0A 4DE1A 1NRFA 3G2ZA 3JYIA 2W0NA 2PR6A 4IJGA 5HWTA 1CK3A 1GA9A 4ETXA 1XX2A 4K0XA 3PBRA 1KGGA 1T18A 1K6RA 1YLJA 3R4KA 1UGUA 2Y2NA 3E2KA 3MSHA 3IBRA 5DKKA 3NULA 3V67A 1T1AA 2XQZA 3IWIA 2L0WA 1BT5A 4H8RA 4KQOA 1KDWA 4PM5A 4GD6A 3GECA 1FOFA 4LV3A 5FATA 3UDXA 2ZOHA 5F82A 3VMAA 4ZDXA 4Y0OA 5AQBA 4HBTA 5DF9A 2Y59A 5FQIA 3A3FA 5L09A 4Z9QA 1JTGA 4FD8A 1L3LA 2H0YA 1PNEA 1Q2PA 2V9AA 5HX9A 3ITBA 2W1TA 3V3RA 5FAPA 3BFEA 4WZ5A 1JTDA 2W3EA 3NC8A 3OPRA 4E6WA 4N9KA 3UDFA 2X02A 1NJ4A 2Y8HA 3T4QA 3WS1A 1TF1A 1OJGA 1ES5A 1CEGA 4NXBA 4OPYA 3UDIA 1M40A 4GD8A 3OPLA 4KENB 1XXMA 3T1SA 2M1CA 1DRMA 4PHTA 3PXPA 5CGXA 5FDHA 2VV6A 2WUQA 1SZVA 2W3DA 4JXGA 2Y55A 4G3WA 3ZNYA 3B47A 4WELA 3F1NA 4KG6A 3QHYA 2WKEA 4EUZA 1Q2QA 1S1ZA 4WYYA 2W3HA 4UHUA 3TE8A 1PWGA 2AVXA 4O8GA 3LR0A 2JE5A 1MKIA 2P04A 1K56D 4B4ZA 1KE0A 1YMXA 5FSRA 3BQAA 4R70A 1YQSA 1PW8A 4RX2A 1H3QA 1BYWA 3HJKA 4EERA 3IXBA 1DY6A 3IT9A 3DBAA 5HAQA 2M7UA 1YLZA 1MWUA 4LRZE 2HP6A 3T4TA 2XFSA 4NKPA 1LSVA 1NYYA 4NEED 3RFBA 2FFYA 2W27A 2Z2LB 3OPHA 4KG2A 2IA2A 4HH3A 1L2SA 1G5UA 3C4OA 5HZHA 3MF0A 5HWVA 4M4XA 1GSXA 2L4RA 1AWIA 1N4OA 3C5AA 3NJAA 1VETB 1XGJA 4EUVA 1Z09A 5EVIC 1NLZA 3ZG7B 3P01A 1PIOA 4BJPA 1TS6A 3HLGA 4CJNA 3T4SA 1KVLA 2WZZA 4PPRA 1WE4A 3I7JA 2GJ3A 1IYOA 4GS9B 4JGOA 1L0GA 4Q0JA 3ZYTA 3T4OA 4MCWA 3FG8A 4ZAMA 5G4YA 4JPMA 5HD5A 2HZ5A 5A8BA 1C3BA 3M6BA 4K91A 4EBPA 4HH2A 4E3MA 3NHQA 1EROA 2KDKA 2VKSA 5GLCA 5CEBA 4EV4A 3DTEA 3TW8A 2L1MA 2Y2QA 1CEFA 3WS4A 3BW6A 2C6WB 4LLOB 2EX6A 3V39A 4R38A 4K08A 4E3IA 2VV7A 4R4RA 2JKTM 3GSGA 3LY3A 2IWCA 3JVVA 4QPRA 3VFHA 2P74A 2XLNA 1MWTA 3LY4A 4Y13A 4G3VA 5J7EA 3G4PA 5A91A 3LIFA 5L07A 3NCKA 1K6SA 3IQAA 1LL9A 1PWCA 1ERQA 4E3JA 3KYQA 4XUXA 4HQAA 4B9OA 4UQIS 2R9WA 2OAP1 2ZM0A 1T1CA 4HY8A 1F9IA 4WUJA 4OQGA 3HLEA 4ZTKA 3O88A 1LSWA 1ZKJA 3H7WA 5CRFA 1PI5A 3NOTC 3DTIA 2HDSA 4RYEA 3ZNTA 2R78A 4KZ4A 4WL9A 5C5KA 4BL3A 2PR5A 4R23A 2VGLM 1VM1A 3IF6A 3HCYA 3PBQA 2XEPA 4PM6A 4KZ5A 1H0MA 4WLAA 1O07A 2E8IA 2HJ9C 3PYPA 3HLDA 3ZG0A 2JKRM 2HDQA
chains in the Genus database with same CATH topology
2PD7A 2VA0A 4PAUA 2B02A 3BQ8A 4L0LA 3KSFA 3CAXA 2HJEA 2VLGA 5KSHA 1ODVA 3BY9A 5DJUA 2VX8A 3LI8A 5IU1A 4YWZA 5TJJA 3H82B 2NUPC 1YAXA 4WN5A 3KYZA 4HJ4A 4MN7A 3LIBA 2ZOIA 4BBTA 1OPXA 4Q0HA 3HJIA 3C30A 4I39A 2V0WA 3FPVA 2YKFA 3LUQA 3LR4A 5HPFA 1ZTUA 4Y2FA 2V1BA 5F68A 3LR5A 3VV4A 1T1BA 2FZ0A 4MMNA 3CUEC 5J4EA 2J3TD 4R3AA 3MQ0A 2O9AA 2KOIA 3PBNA 2NUTC 1OTAA 1OJ5A 2J80A 5F6AA 4I3JA 1V9ZA 3PHYA 4L9EA 2K31A 2YKHA 2GX5A 3LI9A 5EFWA 4HP9A 2QYBA 4L9GA 1LSXA 2QJ7A 3A0VA 2JKRI 4HI4A 2PHYA 4P6ZS 1XJ6A 2H28A 4KQDA 3E4PA 4EW7A 5AVFA 2W1TB 4DJ2A 3LIDA 3IS2A 4NXGA 4EU0A 1TD5A 4EXOA 1OT9A 2OWJA 3A0SA 3LIEA 5HDDA 2K2NA 1P9WA 3VE4A 1XJ3A 3MMHA 3P7NA 5F5YA 3MR0A 4DN0A 4CLCC 4KUOA 5MC7A 3H9WA 3F1PB 2INWA 3F1OB 5I5LA 2HGVA 4JGRA 4L9FA 1NRJA 1OT6A 3OCLA 1MC0A 3JVUA 4BBVA 1D06A 1F98A 4LRYC 3E4OA 3O5YA 2W0NA 2Y79A 2O0YA 2PR6A 4IJGA 5HWTA 4PKYG 4O01A 3TRCA 1W63M 4ETXA 3EEHA 4XT2B 2EWWA 3LYXA 3PBRA 4LRXC 1S67L 3A0RA 3T4KA 1T18A 2W3FA 5DFYA 1GSWA 1OTEA 4BWIA 2ZBBA 3F1NB 3R4KA 5HDCA 1UGUA 5AJGA 4GJ4A 3ZQ5A 1OTBA 3IBRA 4HJ6A 5DKKA 5G4ZA 3OOVA 4G3KA 4UQIM 3V67A 3PR6A 2WKPA 1T1AA 4HIAA 2JKTI 2QHKA 1N9NA 4DJ3A 2L0WA 5KIZA 4I3AA 5LBRA 4KQOA 3BY8A 4YNRA 2XSSA 3S7NA 1N9OA 4MN6A 3GECA 3OC2A 2ZOHA 4WEJA 3KSGA 5HDSA 5J3WA 2A24B 5DF9A 3UB7A 3ICYA 1MKMA 2PYRA 3NOUC 5TBMB 1EW0A 3CI6A 3UMDA 1T19A 1STZA 1P0ZA 2V9AA 4Y3IA 2ZMVA 2W1TA 1XFQA 3H7WB 4OOLA 2JHEA 3B33A 3R7WA 2XROA 1S4RA 2W3EA 2FH5A 1DP8A 4UEYA 4DMZA 1VHMA 3OCNA 4E04A 3C8CA 4JGQA 4ARZA 4CLCB 4RQ9A 2Y8HA 3F1PA 3T4QA 4EESA 1VB6A 1TF1A 2D01A 2G7UA 2JN7A 1OJGA 2HV1A 4NXBA 4H6JA 3UE3A 1TS8A 5DJTA 2M1CA 1DRMA 1XJ2A 4AFIA 4PHTA 3PXPA 1IOUA 4HNBA 4F3LB 5DKLA 2A2LA 2VV6A 4YOFA 3UMEA 1KOUA 5HWWA 2W3DA 4XT2A 4G3WA 2LB9A 3LICA 2W1RA 3B47A 1V9YA 4WELA 3BWLA 3K3DA 2PYPA 3F1NA 1DP9A 1MZUA 3G6OA 1S1ZA 3FPWA 2XA7S 2W3HA 3MFXA 4P6ZM 2LB5A 3TE8A 5HL6A 1G6OA 1NLYA 4KUKA 4O8GA 3EQVA 4OOMA 2KX6A 3LR0A 2I9VA 4MN5A 2BASA 2P04A 3MXQA 1IFQA 2DMWA 3FC7A 3RTYA 4GCZA 1GSVA 2MJ6A 3C38A 3BQAA 4I5SA 2M7VA 4R70A 4GHIA 3E98A 4PKYA 2GNXA 4IUHA 1H3QA 1BYWA 3HJKA 3KSHA 4EERA 1W63Q 4EETB 3K2NA 3EGDC 2J3TC 4Z1WA 3DBAA 2VGLS 3H82A 2M7UA 4LRZE 4HJ3A 3LIAA 3IS2B 3T4TA 4NKPA 1OTIA 1LSVA 1P97A 2O9BA 4NEED 4WF0A 3E0YA 2P08A 3RFBA 2O9CA 2QWSA 4ETZA 2W27A 3CWFA 4HHDA 3K3CA 4HOIA 2W3GA 2IA2A 3KO6A 3IBJA 2P7JA 4HH3A 3OLOA 1TS7A 3KSIA 5HZHA 3MF0A 4I3IA 5HWVA 4M4XA 1GSXA 4FOFA 2L4RA 3UB8A 2XRNA 1F5MA 3D72A 3VE3A 1NWZA 5F69A 1Y28A 3GDIA 3EOIA 3NJAA 4EUVA 2KLIA 5HD3A 3BJNA 1NLZA 3P01A 3S7QA 4CLCD 3EQUA 1G28A 1UWPX 3T50A 2K7SA 4BJPA 3CLOA 1TS6A 2OAQ1 2PT7A 2OWHA 3PBSA 3T4SA 3NOPC 1S66L 4ZRRA 3E4QA 5K5BA 2VJWA 1N9LA 2GJ3A 3KX0X 4EQ1A 1TS0A 2B18A 3S7PA 4R6LA 3MJQA 4GS9B 4JGOA 4JGPA 4LPZA 4Q0JA 3F1OA 4WEKA 3EWKA 3ZYTA 1S4SA 3EGXC 3T4OA 3B42A 4CQHA 2HF6A 4MCWA 3FG8A 4I38A 4GLQA 5G4YA 5HD5A 5A8BA 4IHQA 3MQQA 3OBFA 4HP4A 3W2ZA 5IT5A 2ZMFA 1WA9A 1X0OA 4HH2A 1D7EA 2KDKA 3NHQA 2V0UA 2VV8A 2VKSA 2Z6DA 4BMWA 2D02A 3UE6A 3TW8A 3SW1A 2L1MA 5CX7A 3BW6A 4GW9A 4LLOB 4II7A 4K08A 4R38A 1XJ4A 3EEAA 3TJZC 2VV7A 2JKTM 3R7WB 1P9RA 1YSQA 2O99A 3UB9A 1LT0A 3JVVA 4QPRA 1LL8A 4EEUA 5AVEA 1XFNA 2EWVA 4ARZB 1H8MA 3D3OA 2VZWA 3CUEA 4G3VA 5J7EA 2WKRA 2XA7M 2A24A 3LIFA 3LR3A 2QKPA 1UWNX 4H6JB 4NXFA 5IS1A 4NXEA 5TBMA 4O0PA 3KYQA 4HQAA 3PBTA 1DP6A 1S1YA 4B9OA 4UQIS 5L8MA 2OAP1 2EA9A 3S7OA 2CMNA 1T1CA 4HY8A 1F9IA 4WUJA 3CITA 1YKDA 3C2WA 1LSWA 3H7WA 5DFXA 3NOTC 4CLCE 1JNUA 2PD8A 3T4LA 2VEAA 3PBOA 3RH8B 2J3WA 2R78A 3U2AA 3ULFA 3VOLA 2PDRA 5C5KA 1ZHHB 4GS9A 4FSFA 4WL9A 3MQOA 4CLCA 4Q0IA 4EEPA 2PR5A 2GZAA 4IUKA 2VGLM 4ME4A 3HCYA 3UB6A 3PBQA 4BBUA 2Z6CA 5HSQA 4WLAA 4MDZA 2HJ9C 1OTDA 3T4JA 3LFVA 3PYPA 2OOLA 2V1AA 4B93A 2JKRM 2QJ5A 2WKQA 4F3LA 5FL3A 4GHIB 1YSPA 5HPIA 4Y5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P08 A;  4GJ4 A;  2P04 A; 
#chains in the Genus database with same CATH topology
 1LI9 A;  3BQ8 A;  3KSF A;  1IYP A;  3SH8 A;  2Z2M B;  5DJU A;  3LI8 A;  3Q81 A;  3T1R A;  5EEC A;  1PFL A;  5CTM A;  2ZOI A;  3FWL A;  1N9B A;  3W4Q A;  2V0W A;  1FIL A;  4KZA A;  5F68 A;  3LR5 A;  2FZ0 A;  4OP5 A;  3CUE C;  1A0K A;  2J3T D;  3MQ0 A;  1CF0 A;  2J80 A;  5F83 A;  4X68 A;  2PAV P;  5DTS A;  2K31 A;  2YKH A;  4QB8 A;  5EFW A;  3IF5 A;  4XUZ A;  2ZC5 B;  2PHY A;  1NYM A;  5TGF A;  3S22 A;  5J8X A;  4BQM A;  2OWJ A;  5HDD A;  3IHB A;  4KZ7 A;  1D1J A;  2VK3 A;  4CLC C;  2INW A;  4DDY A;  4JGR A;  4L9F A;  3WS2 A;  1YT4 A;  3BEC A;  4BBV A;  5FQK A;  1D06 A;  1HD8 A;  4LRY C;  2Y79 A;  2O0Y A;  2HDR A;  1XA7 A;  4MNR A;  3TRC A;  3EEH A;  4XT2 B;  2DNS A;  3A0R A;  3T4K A;  4IBX A;  5DFY A;  3MKE A;  1OTE A;  4X1L A;  5HDC A;  2ZC7 A;  2PBD P;  3ZVT A;  3HVF A;  4G3K A;  3A3D A;  4CPK A;  2QHK A;  3VP1 A;  1KVM A;  5KMW A;  1NXY A;  5KIZ A;  3IWQ A;  2Y2J A;  3S7N A;  1N9O A;  3UY6 A;  1I2W A;  3OC2 A;  3VP0 A;  5J3W A;  3UB7 A;  3Q82 A;  3ICY A;  1PZP A;  4JXV A;  2PYR A;  3S4X A;  1T19 A;  1P0Z A;  3D9Y A;  2V20 A;  4OQH A;  1XA1 A;  3NBL A;  3H7W B;  3R7W A;  4BD1 A;  2XRO A;  4PMA A;  3VOY A;  1DP8 A;  3CMZ A;  4E04 A;  2Y2I A;  3ZGA B;  4ARZ A;  1FCO A;  2G7U A;  2JN7 A;  2HV1 A;  3IF6 B;  5IHV A;  3UE3 A;  5F1F A;  1FSY A;  5FAQ A;  4S2N C;  4AFI A;  4YFM A;  5EVI A;  1IOU A;  4S2L A;  1VEU A;  4YOF A;  1S0W A;  4GN2 A;  2J9O A;  3LIC A;  1V9Y A;  3BWL A;  2DRW A;  3VOZ A;  1O7E A;  1ZC2 A;  2XA7 S;  3N8S A;  2WAD A;  4OOM A;  2KX6 A;  2Y2G A;  4N92 A;  4KQR A;  2ZJ9 A;  2I9V A;  1ONG A;  2BAS A;  1ERM A;  4QY6 A;  2ZMA A;  5HAP A;  1CQA A;  2MJ6 A;  3C38 A;  2WGW B;  4I5S A;  4NK3 A;  2OSU A;  2HP5 A;  3QP4 A;  4ZJ3 A;  2ZC4 B;  3TSG A;  4IUH A;  3KSH A;  4QHC A;  1W63 Q;  3P09 A;  4JLF A;  2VGJ A;  3VSL A;  4Z1W A;  4HJ3 A;  2WK0 A;  1OTI A;  1P97 A;  1YPR A;  2WGI A;  3W4O A;  3CG5 A;  2P08 A;  4ETZ A;  1ALQ A;  3CWF A;  4GOG A;  3K3C A;  4HOI A;  2W3G A;  2P7J A;  3DAV A;  1TS7 A;  2RCX A;  1BUE A;  4I3I A;  4FH4 A;  3UB8 A;  2XRN A;  3VE3 A;  3GDI A;  2ZD8 A;  5HD3 A;  1KGF A;  4C6Y A;  3UPN A;  3S7Q A;  3T50 A;  1JWZ A;  2K7S A;  1MWR A;  3LGO A;  3PBS A;  4P87 A;  3ZHH A;  5E2G A;  2ZL1 A;  1S66 L;  4GDB A;  4DXC A;  3WRZ A;  1IKI A;  1N9L A;  3NY4 A;  3KX0 X;  1TS0 A;  3S7P A;  1G6A A;  3C7V A;  3M2J A;  4WEK A;  4GLQ A;  3BYD A;  4KZB A;  2Y91 A;  3PTE A;  3UO9 A;  4IHQ A;  3W4P A;  2Y2M A;  4S2P A;  2Y2P A;  3M2K A;  2EFX A;  3T1Q B;  2VV8 A;  1PZO A;  3MKF A;  1BZA A;  2Z6D A;  4E3N A;  2D02 A;  3UE6 A;  3SW1 A;  3U4L P;  5FI2 A;  5G18 A;  3UPO A;  3TJZ C;  5JYO A;  1RGY A;  1EWZ A;  2XDM A;  1L0D A;  4EBL A;  3R7W B;  3DTK A;  2O99 A;  3IWO A;  1IKG A;  1YLP A;  1LL8 A;  4ARZ B;  2XK1 A;  1W7F A;  2VZW A;  4EQI A;  3CUE A;  5FEG A;  2WKR A;  5DVA A;  2A24 A;  3QP2 A;  1UWN X;  4NXF A;  4JF6 A;  3LEZ A;  4NXE A;  5TBM A;  3NDE A;  4O0P A;  1SHV A;  3WRT A;  4BD0 A;  1TDG A;  3GQZ A;  1S1Y A;  5L8M A;  2EA9 A;  5DTT A;  1KE3 A;  5FA7 A;  5CED A;  3N8L A;  1YKD A;  3C2W A;  3NI9 A;  1JNU A;  3T4L A;  3PBO A;  2QMI A;  3VOL A;  1W8Q A;  4OON A;  4CLC A;  4Q0I A;  3IH8 A;  4EEP A;  2RL3 A;  3CJM A;  1H8Z A;  4HBU A;  2A49 A;  3T1X A;  2Z6C A;  2ZLY A;  4MDZ A;  1K55 C;  2OOL A;  2V1A A;  4F3L A;  1WYB A;  1FCN A;  3A3J A;  3QP5 A;  1YSP A;  2PD7 A;  3CAX A;  1QMF A;  2HJE A;  2X71 A;  3CPT A;  4BL2 A;  4S2O A;  4QWO A;  2ZQ7 A;  5IU1 A;  4WN5 A;  3KYZ A;  2X01 A;  3MXS A;  4OP8 A;  4UA6 A;  3ISG A;  5HPF A;  5HAR A;  4Y2F A;  4YIN A;  2JKF A;  3QNB A;  4MMN A;  3QP8 A;  5CGW A;  5J4E A;  1LLB A;  4R3A A;  1FQG A;  3MZE A;  1M6K A;  3PBN A;  5F6A A;  4JXW A;  3PHY A;  5CHM A;  3O3V A;  3BEB A;  2QYB A;  4L9G A;  1LSX A;  1SKF A;  3A0V A;  2JKR I;  4IVK A;  4P6Z S;  1XJ6 A;  4EW7 A;  1Y4O A;  3FZC A;  5FQJ A;  4B4X A;  5FQ9 A;  5HL1 A;  2W1T B;  3HUO A;  2ZL1 B;  4FUW A;  3FKW A;  2EFU A;  3VFF A;  5M18 A;  2Y2L A;  1P9W A;  3VE4 A;  4DN0 A;  1MPL A;  3IH9 A;  5MC7 A;  1ESU A;  5I5L A;  4P6B A;  4X6T A;  1BSG A;  3SOI A;  3JVU A;  3L7H A;  2WGV A;  2Y2H A;  2V8F A;  1F98 A;  5A93 A;  3E4O A;  2DCF A;  3BRM A;  4PKY G;  2EX8 A;  1K54 C;  3NIA A;  1W63 M;  3HUN A;  5DF8 A;  3C7U A;  2EWW A;  3LYX A;  4LRX C;  4OOY A;  3BFG A;  3ZG5 A;  3Q7V A;  1GSW A;  2ZBB A;  3F1N B;  5FQM A;  4P85 A;  1TDL A;  4GJ4 A;  1ESI A;  4S2J A;  4QD4 A;  3OOV A;  2PU2 A;  4UQI M;  4WMC A;  4DE2 A;  3PR6 A;  4HIA A;  1FR1 A;  4OH0 A;  4E6X A;  3IX3 A;  1K57 C;  5LBR A;  1RGZ A;  4BLM A;  1ES2 A;  5A92 A;  2XSS A;  4X55 A;  3C4P A;  3RXX A;  3IHA A;  4S2K A;  5HDS A;  2A24 B;  4MBH A;  3ZCZ A;  1MKM A;  3M6H A;  3NOU C;  5TBM B;  3MXR A;  3CI6 A;  3UMD A;  1HVB A;  2J8Y A;  1MBL A;  1STZ A;  1CI9 A;  4Y3I A;  2EX9 A;  3ZDJ A;  4OOL A;  1HLU P;  1E3U A;  3B33 A;  4KZ8 A;  3FV7 A;  1S4R A;  1ES4 A;  4KQQ A;  2FH5 A;  4UEY A;  1VHM A;  4OVD A;  3FYZ A;  4CLC B;  4E3O A;  3F1P A;  4LV2 A;  4OLD A;  4EWF A;  5GHY A;  4H6J A;  1FR6 A;  2XFT A;  3SZT A;  4ZJ1 A;  5DJT A;  1MXO A;  5CXW A;  1JWP A;  1XJ2 A;  2HPB A;  3IX4 A;  4LCL A;  5DKL A;  4F3L B;  3UME A;  1KOU A;  1BUL A;  5HWW A;  4OPR A;  1YLT A;  2H10 A;  2ZQ9 A;  3K3D A;  2PYP A;  4OQI A;  4P0M A;  1RP5 A;  3MFD A;  5GHX A;  1IYQ A;  2UWX A;  3MFX A;  3AGD A;  5F1G A;  1NLY A;  2HP9 A;  4KUK A;  2WZX A;  1F2K A;  3AGE A;  3N8R A;  4MN5 A;  2JKG A;  3MXQ A;  1IFQ A;  3V50 A;  2DMW A;  3FC7 A;  4GCZ A;  4U0X A;  5EPH A;  1GSV A;  1K38 A;  1KGE A;  3VP3 A;  3GVB A;  1ES3 A;  4GHI A;  2GNX A;  1FSW A;  5AQ9 A;  4DRT A;  2XH9 A;  3RXW A;  3PAG A;  3IXG A;  2PU4 A;  2WKI A;  3UN7 A;  1I2S A;  3K2N A;  1L0E A;  3SS5 A;  3CZD A;  2JC7 A;  1FCM A;  3ZG9 B;  3BFF A;  3H82 A;  3G2Y A;  3LIA A;  1CJF A;  4HEF A;  3ZG8 B;  4JF5 A;  4WF0 A;  5AQ7 A;  5EOO A;  2ZC3 B;  2O9C A;  4IBR A;  2QWS A;  4HHD A;  5D3O A;  5M19 A;  5KZH A;  1IEM A;  4R1G A;  3QNC A;  2G2W A;  4FOF A;  1YMS A;  4KZ3 A;  3D72 A;  1NWZ A;  3A3I A;  3B3X A;  3UB5 P;  2ZQA A;  3EOI A;  1K25 A;  2KLI A;  3BJN A;  4CLC D;  3GMW A;  1UWP X;  5KSC A;  2OWH A;  3W8K A;  1E25 A;  3NOP C;  3E4Q A;  4X53 A;  1JVJ A;  3Q7V B;  2VJW A;  1PRQ A;  4JKT A;  2B18 A;  1J3W A;  4R6L A;  1LI0 A;  5FEF A;  1H8Y A;  4JGP A;  3Q1F A;  3F1O A;  1S4S A;  3EGX C;  3HLB A;  3B42 A;  4OQ0 A;  1SCW A;  4ID4 A;  4R3J A;  5HFO A;  4Q8I A;  2GDN A;  4R3B A;  3TG9 A;  2WAF A;  2ZMF A;  1WA9 A;  4X1M A;  1K55 A;  4R0Q A;  1X0O A;  1D7E A;  2V0U A;  4WM9 A;  1BLC A;  1AXB A;  4BMW A;  4ZBE A;  5CER A;  4KG5 A;  1XGI A;  1Y54 A;  4ESP A;  3ZVW A;  4GW9 A;  4N1H A;  1PWD A;  4IVI A;  4D60 A;  4M3K A;  3HRE A;  1I5Q A;  3UE1 A;  1P9R A;  1LL5 A;  1YSQ A;  3UB9 A;  5FI6 A;  1GHP A;  1OME A;  4EEU A;  3GTC A;  2EWV A;  1H5X A;  2QPN A;  1DJC A;  1H8M A;  3D3O A;  4ZJ2 A;  3SS3 A;  4LGW A;  5M1A A;  4JBF A;  2XA7 M;  3ITA A;  1J9M A;  4OKP A;  2JBF A;  2QKP A;  4H6J B;  3G31 A;  2XD5 A;  5IS1 A;  4KZ9 A;  1VET A;  1MY8 A;  3PAE A;  3PBT A;  3S7O A;  2ZM2 A;  2ACG A;  5E2E A;  3CIT A;  5TFQ A;  5DFX A;  4CLC E;  2PD8 A;  4JF4 A;  2J3W A;  3U2A A;  3ULF A;  3MBZ A;  1PI4 A;  2PDR A;  3NDG A;  1ZHH B;  4GS9 A;  4FSF A;  3IX8 A;  3E2L A;  2OLV A;  1U60 A;  4ME4 A;  2WYX A;  4E3K A;  2V8C A;  4BBU A;  1KDS A;  5HSQ A;  4DKI A;  3BLS A;  1OTD A;  3T4J A;  4B93 A;  2QJ5 A;  4WMC D;  5CHJ A;  4MBF A;  2Y2O A;  5FL3 A;  5DF7 A;  4GHI B;  1K54 A;  2VA0 A;  3BM6 A;  4BEN A;  4R4S A;  3BY9 A;  2VX8 A;  3N7W A;  5EUA A;  1YLY A;  3H82 B;  2NUP C;  2XGN A;  3LIB A;  4BBT A;  1OPX A;  4QY5 A;  2XR0 A;  4Q0H A;  1W79 A;  5TR7 A;  3C30 A;  4I39 A;  5EV0 A;  3FPV A;  4C3Q A;  3LUQ A;  2Q0O A;  1K57 A;  5GLA A;  3T12 B;  4Y0T A;  3UE0 A;  3DWK A;  2JCH A;  3OPP A;  1E3U D;  1OTA A;  4DDS A;  3HBR A;  4I3J A;  2C5W B;  4L9E A;  2V2F F;  4UA7 A;  3LI9 A;  4HP9 A;  3O87 A;  3N4I A;  2QJ7 A;  4HI4 A;  4DXB A;  3VP2 A;  1K4E A;  2H28 A;  3E4P A;  1TVF A;  4LV1 A;  4DJ2 A;  4XXR A;  3IS2 A;  2FFF B;  3G32 A;  1TD5 A;  4EXO A;  1OT9 A;  3LIE A;  5E2F A;  2K2N A;  3L9K A;  4DE0 A;  3ZFZ A;  4C75 A;  3MMH A;  1MWS A;  3G34 A;  2R9X A;  3MR0 A;  4KUO A;  5HAI A;  3F1O B;  1GA0 A;  1W5D A;  2J7V A;  1NRJ A;  3OCL A;  5GLD A;  3SS4 A;  3O5Y A;  2OLU A;  5EVI B;  3V5M A;  4OPZ A;  4PM9 A;  4O01 A;  4WZ4 A;  1VEU B;  1S67 L;  2EX2 A;  2W3F A;  4BWI A;  4NG2 A;  5U47 A;  5AJG A;  1K4F A;  3ZQ5 A;  1OTB A;  4HJ6 A;  5G4Z A;  5FI7 A;  2WKP A;  2JKT I;  1GHM A;  1N9N A;  4DJ3 A;  4I3A A;  1KE4 A;  3BY8 A;  4YNR A;  2PBY A;  2WAE A;  2J9P A;  1DJB A;  1Z6F A;  1ZG6 A;  4MN6 A;  1XP4 A;  3N6I A;  1NZU A;  5EM0 A;  4WEJ A;  3KSG A;  5EE8 A;  5GLB A;  4NET A;  2PRF A;  1EW0 A;  1NY0 A;  5CGS A;  1YLW A;  3CHW P;  1SKO A;  1LHY A;  5EM1 A;  5CHU A;  2ZMV A;  3IXD A;  1IYS A;  1WYC A;  2BTF P;  2ZC6 B;  1XFQ A;  5FAO A;  2JHE A;  1CI8 A;  2ZM8 A;  1ONH A;  3Q7Z A;  4DMZ A;  3OCN A;  3HLC A;  3C8C A;  4JGQ A;  1DJA A;  3QP1 A;  1JWV A;  4RQ9 A;  4EES A;  1VB6 A;  2D01 A;  3V3S A;  2P9V A;  4MBK A;  4RVA A;  4FCF A;  2B95 A;  4OPQ A;  2E8J A;  1TS8 A;  4DE3 A;  4HNB A;  2A2L A;  4FTX A;  4XT2 A;  4N9L A;  3A3E A;  2LB9 A;  3GV9 A;  1XKZ A;  2W1R A;  5EVI D;  3D4F A;  1DP9 A;  1MZU A;  3QP6 A;  4EBN A;  4X25 A;  3G6O A;  1RCJ A;  3FPW A;  3UNW A;  4P6Z M;  4DF6 A;  2LB5 A;  4Y15 A;  5HL6 A;  4UA9 A;  1G6O A;  5GHZ A;  3EQV A;  4MLL A;  5A90 A;  4X56 A;  3VP4 A;  3LO7 A;  4GNU A;  3HL9 A;  3RTY A;  4X69 A;  4S2N A;  3G30 A;  1YM1 A;  2QZ6 A;  2H0T A;  2M7V A;  5L10 A;  3E98 A;  4PKY A;  4RA7 A;  1XPB A;  2ZQ8 A;  4EET B;  3EGD C;  4F94 A;  2A3U A;  2J3T C;  3IXH A;  2VGL S;  3IS2 B;  3DTM A;  4WZ5 C;  2O9B A;  3E0Y A;  2I72 A;  2B5R A;  1E4D A;  3KO6 A;  3IBJ A;  3OLO A;  3KSI A;  4B88 A;  4RX3 A;  1ACF A;  1F5M A;  3JPU A;  4GB7 A;  4S2M A;  5F69 A;  1Y28 A;  4FH2 A;  5FAS A;  4U0T A;  5FDS A;  1W8Y A;  3WS0 A;  2VGK A;  4LCM A;  3EQU A;  1G28 A;  3MZF A;  2BLS A;  2WKH A;  3CLO A;  2OAQ 1;  2PT7 A;  5HW3 A;  2EXB A;  2CC1 A;  4ZRR A;  3DW0 A;  5K5B A;  1G68 A;  2V1Z A;  2H5S A;  4EQ1 A;  3MJQ A;  4LPZ A;  3EWK A;  4N1X A;  4CQH A;  2HF6 A;  5BOH A;  4I38 A;  5E43 A;  4S2I A;  4Y7P A;  1K0K A;  3RJU A;  3MQQ A;  3BLM A;  3OBF A;  4HP4 A;  3W2Z A;  5IT5 A;  4K0W A;  3UPP A;  4LFU A;  1BTL A;  2WGW A;  3FKV A;  4Y0U A;  5JYP A;  2Q9N A;  4O7D A;  3CPT B;  4GKU A;  5CX7 A;  5FQQ A;  1K56 A;  1SKO B;  4II7 A;  1XJ4 A;  3EEA A;  5EVL A;  4D2O A;  3NEC A;  1QME A;  3AGF A;  5AQA A;  2IWD A;  3HLW A;  4GDN A;  1LT0 A;  3VSK A;  4QJG A;  1S6R A;  2G2U A;  1XFN A;  1GCE A;  2Y2K A;  5CEC A;  1IEL A;  2P9V B;  1EI5 A;  3LCE A;  4E3L A;  3BFC A;  3LR3 A;  2BG1 A;  3MZD A;  1DP6 A;  1BLP A;  4MEZ A;  5CTN A;  2CMN A;  5E2H A;  5GL9 A;  1HZO A;  4U3T A;  3WS5 A;  2ZQC A;  1PYY A;  2VEA A;  3RH8 B;  2Y4A A;  2ZQD A;  4JXS A;  3GRJ A;  4UAA A;  1BLH A;  1TEM A;  3OZH A;  3MQO A;  2GZA A;  4IUK A;  3TOI A;  3S1Y A;  5EVE A;  3UB6 A;  2EXA A;  2Q9M A;  1SDE A;  4GZB A;  4PM7 A;  3BFD A;  3LFV A;  1L0F A;  2HDU A;  3KYE A;  2WKQ A;  1FIK A;  3P98 A;  5HPI A;  4Y5F A;  5AVE A;  4PAU A;  2B02 A;  5I94 A;  4L0L A;  4WBG A;  2VLG A;  5KSH A;  1ODV A;  3GR2 A;  3O86 A;  4YWZ A;  5TJJ A;  1YAX A;  3LEQ A;  4HJ4 A;  2XF3 A;  4MN7 A;  3WWX A;  5L2F A;  3Q07 A;  3HJI A;  2YKF A;  3LR4 A;  3DWZ A;  1ZTU A;  4HES A;  2V1B A;  4OLG A;  3VV4 A;  1T1B A;  4A5R A;  4QU3 A;  2O9A A;  2UV0 E;  2KOI A;  4PM8 A;  2NUT C;  4LEN A;  3SH9 A;  1OJ5 A;  3G35 A;  1NZO A;  2XD1 A;  1V9Z A;  3SH7 A;  2GX5 A;  3MS6 A;  1VQQ A;  4KQD A;  1GHI A;  5AVF A;  3HLF A;  3LID A;  5EOE A;  4NXG A;  5DTK A;  4EU0 A;  4KZ6 A;  1PW1 A;  3A0S A;  4LV0 A;  1HTZ A;  3HUM A;  1BLS A;  1XJ3 A;  1SDN A;  1ZG4 A;  3P7N A;  4Y17 A;  5F5Y A;  2OV5 A;  4IED A;  3H9W A;  3F1P B;  2HGV A;  3IF6 C;  2IWB A;  1OT6 A;  1MC0 A;  4DE1 A;  1NRF A;  3G2Z A;  3JYI A;  2W0N A;  2PR6 A;  4IJG A;  5HWT A;  1CK3 A;  1GA9 A;  4ETX A;  1XX2 A;  4K0X A;  3PBR A;  1KGG A;  1T18 A;  1K6R A;  1YLJ A;  3R4K A;  1UGU A;  2Y2N A;  3E2K A;  3MSH A;  3IBR A;  5DKK A;  3NUL A;  3V67 A;  1T1A A;  2XQZ A;  3IWI A;  2L0W A;  1BT5 A;  4H8R A;  4KQO A;  1KDW A;  4PM5 A;  4GD6 A;  3GEC A;  1FOF A;  4LV3 A;  5FAT A;  3UDX A;  2ZOH A;  5F82 A;  3VMA A;  4ZDX A;  4Y0O A;  5AQB A;  4HBT A;  5DF9 A;  2Y59 A;  5FQI A;  3A3F A;  5L09 A;  4Z9Q A;  1JTG A;  4FD8 A;  1L3L A;  2H0Y A;  1PNE A;  1Q2P A;  2V9A A;  5HX9 A;  3ITB A;  2W1T A;  3V3R A;  5FAP A;  3BFE A;  4WZ5 A;  1JTD A;  2W3E A;  3NC8 A;  3OPR A;  4E6W A;  4N9K A;  3UDF A;  2X02 A;  1NJ4 A;  2Y8H A;  3T4Q A;  3WS1 A;  1TF1 A;  1OJG A;  1ES5 A;  1CEG A;  4NXB A;  4OPY A;  3UDI A;  1M40 A;  4GD8 A;  3OPL A;  4KEN B;  1XXM A;  3T1S A;  2M1C A;  1DRM A;  4PHT A;  3PXP A;  5CGX A;  5FDH A;  2VV6 A;  2WUQ A;  1SZV A;  2W3D A;  4JXG A;  2Y55 A;  4G3W A;  3ZNY A;  3B47 A;  4WEL A;  3F1N A;  4KG6 A;  3QHY A;  2WKE A;  4EUZ A;  1Q2Q A;  1S1Z A;  4WYY A;  2W3H A;  4UHU A;  3TE8 A;  1PWG A;  2AVX A;  4O8G A;  3LR0 A;  2JE5 A;  1MKI A;  2P04 A;  1K56 D;  4B4Z A;  1KE0 A;  1YMX A;  5FSR A;  3BQA A;  4R70 A;  1YQS A;  1PW8 A;  4RX2 A;  1H3Q A;  1BYW A;  3HJK A;  4EER A;  3IXB A;  1DY6 A;  3IT9 A;  3DBA A;  5HAQ A;  2M7U A;  1YLZ A;  1MWU A;  4LRZ E;  2HP6 A;  3T4T A;  2XFS A;  4NKP A;  1LSV A;  1NYY A;  4NEE D;  3RFB A;  2FFY A;  2W27 A;  2Z2L B;  3OPH A;  4KG2 A;  2IA2 A;  4HH3 A;  1L2S A;  1G5U A;  3C4O A;  5HZH A;  3MF0 A;  5HWV A;  4M4X A;  1GSX A;  2L4R A;  1AWI A;  1N4O A;  3C5A A;  3NJA A;  1VET B;  1XGJ A;  4EUV A;  1Z09 A;  5EVI C;  1NLZ A;  3ZG7 B;  3P01 A;  1PIO A;  4BJP A;  1TS6 A;  3HLG A;  4CJN A;  3T4S A;  1KVL A;  2WZZ A;  4PPR A;  1WE4 A;  3I7J A;  2GJ3 A;  1IYO A;  4GS9 B;  4JGO A;  1L0G A;  4Q0J A;  3ZYT A;  3T4O A;  4MCW A;  3FG8 A;  4ZAM A;  5G4Y A;  4JPM A;  5HD5 A;  2HZ5 A;  5A8B A;  1C3B A;  3M6B A;  4K91 A;  4EBP A;  4HH2 A;  4E3M A;  3NHQ A;  1ERO A;  2KDK A;  2VKS A;  5GLC A;  5CEB A;  4EV4 A;  3DTE A;  3TW8 A;  2L1M A;  2Y2Q A;  1CEF A;  3WS4 A;  3BW6 A;  2C6W B;  4LLO B;  2EX6 A;  3V39 A;  4R38 A;  4K08 A;  4E3I A;  2VV7 A;  4R4R A;  2JKT M;  3GSG A;  3LY3 A;  2IWC A;  3JVV A;  4QPR A;  3VFH A;  2P74 A;  2XLN A;  1MWT A;  3LY4 A;  4Y13 A;  4G3V A;  5J7E A;  3G4P A;  5A91 A;  3LIF A;  5L07 A;  3NCK A;  1K6S A;  3IQA A;  1LL9 A;  1PWC A;  1ERQ A;  4E3J A;  3KYQ A;  4XUX A;  4HQA A;  4B9O A;  4UQI S;  2R9W A;  2OAP 1;  2ZM0 A;  1T1C A;  4HY8 A;  1F9I A;  4WUJ A;  4OQG A;  3HLE A;  4ZTK A;  3O88 A;  1LSW A;  1ZKJ A;  3H7W A;  5CRF A;  1PI5 A;  3NOT C;  3DTI A;  2HDS A;  4RYE A;  3ZNT A;  2R78 A;  4KZ4 A;  4WL9 A;  5C5K A;  4BL3 A;  2PR5 A;  4R23 A;  2VGL M;  1VM1 A;  3IF6 A;  3HCY A;  3PBQ A;  2XEP A;  4PM6 A;  4KZ5 A;  1H0M A;  4WLA A;  1O07 A;  2E8I A;  2HJ9 C;  3PYP A;  3HLD A;  3ZG0 A;  2JKR M;  2HDQ A; 
#chains in the Genus database with same CATH homology
 2PD7 A;  2VA0 A;  4PAU A;  2B02 A;  3BQ8 A;  4L0L A;  3KSF A;  3CAX A;  2HJE A;  2VLG A;  5KSH A;  1ODV A;  3BY9 A;  5DJU A;  2VX8 A;  3LI8 A;  5IU1 A;  4YWZ A;  5TJJ A;  3H82 B;  2NUP C;  1YAX A;  4WN5 A;  3KYZ A;  4HJ4 A;  4MN7 A;  3LIB A;  2ZOI A;  4BBT A;  1OPX A;  4Q0H A;  3HJI A;  3C30 A;  4I39 A;  2V0W A;  3FPV A;  2YKF A;  3LUQ A;  3LR4 A;  5HPF A;  1ZTU A;  4Y2F A;  2V1B A;  5F68 A;  3LR5 A;  3VV4 A;  1T1B A;  2FZ0 A;  4MMN A;  3CUE C;  5J4E A;  2J3T D;  4R3A A;  3MQ0 A;  2O9A A;  2KOI A;  3PBN A;  2NUT C;  1OTA A;  1OJ5 A;  2J80 A;  5F6A A;  4I3J A;  1V9Z A;  3PHY A;  4L9E A;  2K31 A;  2YKH A;  2GX5 A;  3LI9 A;  5EFW A;  4HP9 A;  2QYB A;  4L9G A;  1LSX A;  2QJ7 A;  3A0V A;  2JKR I;  4HI4 A;  2PHY A;  4P6Z S;  1XJ6 A;  2H28 A;  4KQD A;  3E4P A;  4EW7 A;  5AVF A;  2W1T B;  4DJ2 A;  3LID A;  3IS2 A;  4NXG A;  4EU0 A;  1TD5 A;  4EXO A;  1OT9 A;  2OWJ A;  3A0S A;  3LIE A;  5HDD A;  2K2N A;  1P9W A;  3VE4 A;  1XJ3 A;  3MMH A;  3P7N A;  5F5Y A;  3MR0 A;  4DN0 A;  4CLC C;  4KUO A;  5MC7 A;  3H9W A;  3F1P B;  2INW A;  3F1O B;  5I5L A;  2HGV A;  4JGR A;  4L9F A;  1NRJ A;  1OT6 A;  3OCL A;  1MC0 A;  3JVU A;  4BBV A;  1D06 A;  1F98 A;  4LRY C;  3E4O A;  3O5Y A;  2W0N A;  2Y79 A;  2O0Y A;  2PR6 A;  4IJG A;  5HWT A;  4PKY G;  4O01 A;  3TRC A;  1W63 M;  4ETX A;  3EEH A;  4XT2 B;  2EWW A;  3LYX A;  3PBR A;  4LRX C;  1S67 L;  3A0R A;  3T4K A;  1T18 A;  2W3F A;  5DFY A;  1GSW A;  1OTE A;  4BWI A;  2ZBB A;  3F1N B;  3R4K A;  5HDC A;  1UGU A;  5AJG A;  4GJ4 A;  3ZQ5 A;  1OTB A;  3IBR A;  4HJ6 A;  5DKK A;  5G4Z A;  3OOV A;  4G3K A;  4UQI M;  3V67 A;  3PR6 A;  2WKP A;  1T1A A;  4HIA A;  2JKT I;  2QHK A;  1N9N A;  4DJ3 A;  2L0W A;  5KIZ A;  4I3A A;  5LBR A;  4KQO A;  3BY8 A;  4YNR A;  2XSS A;  3S7N A;  1N9O A;  4MN6 A;  3GEC A;  3OC2 A;  2ZOH A;  4WEJ A;  3KSG A;  5HDS A;  5J3W A;  2A24 B;  5DF9 A;  3UB7 A;  3ICY A;  1MKM A;  2PYR A;  3NOU C;  5TBM B;  1EW0 A;  3CI6 A;  3UMD A;  1T19 A;  1STZ A;  1P0Z A;  2V9A A;  4Y3I A;  2ZMV A;  2W1T A;  1XFQ A;  3H7W B;  4OOL A;  2JHE A;  3B33 A;  3R7W A;  2XRO A;  1S4R A;  2W3E A;  2FH5 A;  1DP8 A;  4UEY A;  4DMZ A;  1VHM A;  3OCN A;  4E04 A;  3C8C A;  4JGQ A;  4ARZ A;  4CLC B;  4RQ9 A;  2Y8H A;  3F1P A;  3T4Q A;  4EES A;  1VB6 A;  1TF1 A;  2D01 A;  2G7U A;  2JN7 A;  1OJG A;  2HV1 A;  4NXB A;  4H6J A;  3UE3 A;  1TS8 A;  5DJT A;  2M1C A;  1DRM A;  1XJ2 A;  4AFI A;  4PHT A;  3PXP A;  1IOU A;  4HNB A;  4F3L B;  5DKL A;  2A2L A;  2VV6 A;  4YOF A;  3UME A;  1KOU A;  5HWW A;  2W3D A;  4XT2 A;  4G3W A;  2LB9 A;  3LIC A;  2W1R A;  3B47 A;  1V9Y A;  4WEL A;  3BWL A;  3K3D A;  2PYP A;  3F1N A;  1DP9 A;  1MZU A;  3G6O A;  1S1Z A;  3FPW A;  2XA7 S;  2W3H A;  3MFX A;  4P6Z M;  2LB5 A;  3TE8 A;  5HL6 A;  1G6O A;  1NLY A;  4KUK A;  4O8G A;  3EQV A;  4OOM A;  2KX6 A;  3LR0 A;  2I9V A;  4MN5 A;  2BAS A;  2P04 A;  3MXQ A;  1IFQ A;  2DMW A;  3FC7 A;  3RTY A;  4GCZ A;  1GSV A;  2MJ6 A;  3C38 A;  3BQA A;  4I5S A;  2M7V A;  4R70 A;  4GHI A;  3E98 A;  4PKY A;  2GNX A;  4IUH A;  1H3Q A;  1BYW A;  3HJK A;  3KSH A;  4EER A;  1W63 Q;  4EET B;  3K2N A;  3EGD C;  2J3T C;  4Z1W A;  3DBA A;  2VGL S;  3H82 A;  2M7U A;  4LRZ E;  4HJ3 A;  3LIA A;  3IS2 B;  3T4T A;  4NKP A;  1OTI A;  1LSV A;  1P97 A;  2O9B A;  4NEE D;  4WF0 A;  3E0Y A;  2P08 A;  3RFB A;  2O9C A;  2QWS A;  4ETZ A;  2W27 A;  3CWF A;  4HHD A;  3K3C A;  4HOI A;  2W3G A;  2IA2 A;  3KO6 A;  3IBJ A;  2P7J A;  4HH3 A;  3OLO A;  1TS7 A;  3KSI A;  5HZH A;  3MF0 A;  4I3I A;  5HWV A;  4M4X A;  1GSX A;  4FOF A;  2L4R A;  3UB8 A;  2XRN A;  1F5M A;  3D72 A;  3VE3 A;  1NWZ A;  5F69 A;  1Y28 A;  3GDI A;  3EOI A;  3NJA A;  4EUV A;  2KLI A;  5HD3 A;  3BJN A;  1NLZ A;  3P01 A;  3S7Q A;  4CLC D;  3EQU A;  1G28 A;  1UWP X;  3T50 A;  2K7S A;  4BJP A;  3CLO A;  1TS6 A;  2OAQ 1;  2PT7 A;  2OWH A;  3PBS A;  3T4S A;  3NOP C;  1S66 L;  4ZRR A;  3E4Q A;  5K5B A;  2VJW A;  1N9L A;  2GJ3 A;  3KX0 X;  4EQ1 A;  1TS0 A;  2B18 A;  3S7P A;  4R6L A;  3MJQ A;  4GS9 B;  4JGO A;  4JGP A;  4LPZ A;  4Q0J A;  3F1O A;  4WEK A;  3EWK A;  3ZYT A;  1S4S A;  3EGX C;  3T4O A;  3B42 A;  4CQH A;  2HF6 A;  4MCW A;  3FG8 A;  4I38 A;  4GLQ A;  5G4Y A;  5HD5 A;  5A8B A;  4IHQ A;  3MQQ A;  3OBF A;  4HP4 A;  3W2Z A;  5IT5 A;  2ZMF A;  1WA9 A;  1X0O A;  4HH2 A;  1D7E A;  2KDK A;  3NHQ A;  2V0U A;  2VV8 A;  2VKS A;  2Z6D A;  4BMW A;  2D02 A;  3UE6 A;  3TW8 A;  3SW1 A;  2L1M A;  5CX7 A;  3BW6 A;  4GW9 A;  4LLO B;  4II7 A;  4K08 A;  4R38 A;  1XJ4 A;  3EEA A;  3TJZ C;  2VV7 A;  2JKT M;  3R7W B;  1P9R A;  1YSQ A;  2O99 A;  3UB9 A;  1LT0 A;  3JVV A;  4QPR A;  1LL8 A;  4EEU A;  5AVE A;  1XFN A;  2EWV A;  4ARZ B;  1H8M A;  3D3O A;  2VZW A;  3CUE A;  4G3V A;  5J7E A;  2WKR A;  2XA7 M;  2A24 A;  3LIF A;  3LR3 A;  2QKP A;  1UWN X;  4H6J B;  4NXF A;  5IS1 A;  4NXE A;  5TBM A;  4O0P A;  3KYQ A;  4HQA A;  3PBT A;  1DP6 A;  1S1Y A;  4B9O A;  4UQI S;  5L8M A;  2OAP 1;  2EA9 A;  3S7O A;  2CMN A;  1T1C A;  4HY8 A;  1F9I A;  4WUJ A;  3CIT A;  1YKD A;  3C2W A;  1LSW A;  3H7W A;  5DFX A;  3NOT C;  4CLC E;  1JNU A;  2PD8 A;  3T4L A;  2VEA A;  3PBO A;  3RH8 B;  2J3W A;  2R78 A;  3U2A A;  3ULF A;  3VOL A;  2PDR A;  5C5K A;  1ZHH B;  4GS9 A;  4FSF A;  4WL9 A;  3MQO A;  4CLC A;  4Q0I A;  4EEP A;  2PR5 A;  2GZA A;  4IUK A;  2VGL M;  4ME4 A;  3HCY A;  3UB6 A;  3PBQ A;  4BBU A;  2Z6C A;  5HSQ A;  4WLA A;  4MDZ A;  2HJ9 C;  1OTD A;  3T4J A;  3LFV A;  3PYP A;  2OOL A;  2V1A A;  4B93 A;  2JKR M;  2QJ5 A;  2WKQ A;  4F3L A;  5FL3 A;  4GHI B;  1YSP A;  5HPI A;  4Y5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...