4GJ4A

The crystal structure of the soluble guanylate cyclase pas alpha domain from manduca sexta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
IGVASFAKAFPWHFITDKRLELVQLGAGFMRLFGTHLATHGSSLGTYFRLLRPRGVPLDFREILKRVNTPFMFALKMPGSTALAEGLEIKGQMVFAAESDSLLFVGSPFLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Alpha subunit PAS domain from soluble guanylyl cyclase.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lyase
molecule keywords Soluble guanylyl cyclase alpha-1 subunit
total genus 24
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gj4A00
2P08A 2P04A 4GJ4A
chains in the Genus database with same CATH superfamily
3DTKA 3HUMA 4R4SA 2A49A 4PM9A 4NG2A 3G6OA 4HH3A 3IS2B 1KOUA 1ONHA 3ZNYA 2LB5A 2Z2LB 5GHZA 5TFQA 3ZGAB 2RL3A 2O9CA 4CLCA 4GJ4A 4B93A 1RP5A 3WS5A 4Q0JA 3MQ0A 3A3IA 3CZDA 4DE1A 1Q2PA 5KZHA 2G7UA 4R4RA 1OT9A 2PYPA 4R3BA 3HLFA 1P0ZA 2INWA 1VEUA 3GDIA 3RH8B 5FEFA 4EQ1A 2HV1A 1NXYA 4KQRA 3UE3A 3IQAA 4CLCD 2Y2IA 5EVEA 4XT2B 3KSGA 4PHTA 3BY8A 3F1OA 1TDLA 1F98A 3V3RA 2PT7A 1NY0A 2JKFA 4N92A 4BLMA 5HAPA 1FIKA 4Y15A 1MWSA 3DBAA 1BUEA 4QWOA 5A8BA 2PDRA 4A5RA 4BMWA 1FCOA 1IYOA 3ICYA 4ARZA 5EE8A 3C30A 3BFEA 4HI4A 3LY4A 4FH4A 1ES4A 4PKYG 1NRJA 3T50A 4Y7PA 3NJAA 3M6HA 2W3DA 2P74A 4NXBA 2FZ0A 1K0KA 1VEUB 1XJ2A 3MKFA 2WKRA 2X71A 4NK3A 4YNRA 1JTGA 3T4KA 4DF6A 4KG6A 4OQIA 3RFBA 4DJ2A 4JF5A 4EETB 1PI5A 5HDDA 1KVLA 1ALQA 2XGNA 4FSFA 4M3KA 4G3VA 4P85A 3GR2A 2WAFA 1KDSA 2QHKA 3GRJA 3HBRA 1BT5A 2W27A 1YMXA 3CUEC 4LCLA 1F2KA 2ZD8A 1JWZA 3EEAA 3E2KA 2QPNA 4OP5A 3LCEA 4BL2A 2H10A 2ZM8A 1S67L 3BYDA 1N9LA 4CLCC 3VP3A 2E8IA 3UMEA 4MBFA 5IHVA 3HCYA 3BRMA 3W4QA 2WZZA 1JNUA 4DDSA 4KZ4A 3U2AA 1C3BA 2D02A 3LY3A 3O86A 3G34A 1S1YA 2O0YA 3GV9A 3O88A 5HFOA 1XA7A 4UQIM 3H7WB 2WYXA 5EVIC 4GCZA 1XJ6A 2P9VA 4ME4A 4B9OA 1BLSA 2ZC3B 1G6AA 2M1CA 4RA7A 1J3WA 3VFFA 2GJ3A 2ZOIA 4G3KA 1KVMA 4WZ5C 1P97A 3QP1A 5L8MA 2B02A 5G4ZA 1ONGA 3Q7VA 1FR6A 5EFWA 3Q07A 1STZA 4JGOA 1FCNA 4RX3A 1H5XA 3KX0X 5DTTA 4IVIA 4OONA 4HNBA 3LICA 2O9AA 2W3FA 3S1YA 1BLHA 1VETB 2VGLS 3LFVA 4FUWA 3F1NB 3UDIA 2CMNA 1KE4A 5L09A 5IS1A 1BZAA 5FQKA 2UV0E 5CRFA 1ZG6A 3IBRA 1QMFA 2FH5A 3UMDA 3IT9A 3ITAA 1K57C 2Y2MA 1LL9A 4GN2A 2OWJA 1JTDA 3NOUC 3IXHA 5FAPA 2W3HA 3ZG5A 2KDKA 2EX9A 4E3NA 3E98A 2V1ZA 1TS0A 2J9PA 1K25A 3B42A 2EXAA 1XJ4A 4DMZA 3IWOA 2P08A 3LIEA 4WYYA 3A3JA 3UB8A 1W5DA 3C8CA 3S7NA 1Z6FA 4L9FA 3H82A 4YWZA 3LR3A 4HH2A 4KZ8A 4N9KA 3T4QA 1BYWA 4EW7A 1XFQA 2H0TA 1MWTA 5L07A 2HDRA 2Y4AA 2NUPC 1XX2A 2ZQAA 4GS9A 2HDQA 2Y2HA 1NRFA 4MEZA 1FQGA 3NBLA 4Z9QA 4QD4A 5AQBA 1YLWA 3D3OA 4QB8A 2XR0A 3QP8A 2Y2NA 4BBUA 3LGOA 1NLZA 2M7UA 1LL8A 3KYQA 1FCMA 2DRWA 4I5SA 5TBMB 1SCWA 2B5RA 1JWPA 4WZ4A 2J3WA 3UN7A 4LRZE 2Y2PA 4Y0TA 2NUTC 3NDGA 1OTDA 1PW1A 3MKEA 3L7HA 2O9BA 1MKMA 2K2NA 4EESA 1K55A 2WADA 4CLCB 3C7VA 3CITA 3IF6A 4E6XA 2V20A 1RCJA 1WE4A 1D1JA 1PI4A 3W4PA 3ZG9B 1GA9A 4LV1A 4DXBA 1YLTA 4HJ3A 1OTIA 3N7WA 4QPRA 1TDGA 1K6RA 3G2YA 4EEUA 3IX4A 5FI7A 4E3KA 1BLPA 1Z09A 2WAEA 5DKKA 1OPXA 5EOOA 1CK3A 1M40A 2V9AA 5EVIB 3GECA 4OOYA 4DJ3A 1WYCA 4WL9A 2VV7A 1W8QA 3H9WA 2ACGA 1XFNA 1FR1A 1ZG4A 2IWDA 2WUQA 1XPBA 2GX5A 1V9YA 3T4OA 1Y4OA 3P09A 5F69A 1H3QA 2WKEA 4HESA 4X56A 1CF0A 5FASA 4I38A 1G6OA 2XA7S 5DF8A 1Y54A 1L2SA 3VV4A 2X01A 4DE0A 4WEJA 3OCLA 3WS4A 5EM1A 4ZJ3A 2W1RA 1TEMA 3PYPA 2V8FA 3UE1A 4OH0A 2QZ6A 2J3TC 3CPTA 3UPOA 4Y5FA 5FQMA 1PWDA 2JKTM 3ITBA 4FH2A 3PXPA 4ARZB 3MFDA 4K0WA 3TW8A 3LIBA 4HOIA 3NY4A 5HZHA 4GDNA 1I2WA 3MZEA 2HJEA 3OPLA 4EEPA 1LSXA 4OKPA 1SDNA 2BLSA 4UEYA 2K7SA 1NLYA 4DRTA 3GMWA 3P7NA 4JLFA 3SS3A 2JKRI 5DVAA 3N8SA 2WKPA 4HJ4A 5CTMA 1S0WA 1K56D 2Y2QA 5GLCA 3IF6B 2Y59A 4S2KA 4XT2A 4YFMA 3IX3A 1O7EA 3FPWA 4U3TA 4O7DA 5CGWA 2D01A 3T1RA 1S1ZA 4BQMA 1IELA 3LIDA 1HTZA 3CUEA 3PBNA 4OLGA 2PD8A 3OC2A 5DF7A 1IFQA 4NXFA 2VGKA 3UE6A 1TF1A 4DE2A 5M18A 1H8ZA 4KUOA 2I72A 5DTSA 3PBQA 1XKZA 3Q81A 3UPNA 1ZHHB 4GB7A 4WMCA 4MN5A 1TS7A 2PHYA 5CX7A 4M4XA 3VP1A 3PBOA 2Q9MA 3IS2A 1MPLA 4L9EA 4O8GA 1X0OA 1CI9A 1HD8A 5FQQA 1L3LA 2XK1A 4CQHA 3HLGA 4UA9A 3M2KA 4OVDA 4JGPA 4OOMA 5HDCA 2R9WA 3BM6A 2R78A 1KGGA 5CHJA 4IUHA 2PBYA 3HVFA 4JXSA 1GSWA 3IX8A 3CWFA 1N9BA 5I5LA 3DTEA 1LSWA 4CLCE 1GHIA 3EWKA 4GNUA 1ES3A 1YQSA 5EUAA 2DNSA 3ULFA 1NYMA 3QP4A 3RXXA 2OWHA 2PU4A 3PTEA 4DE3A 5AQ9A 4OQGA 4IJGA 3PAGA 3HLDA 3ZQ5A 1NYYA 2IWCA 3JPUA 4HQAA 3A3FA 1DJCA 1GSXA 1TS8A 1H0MA 3S7PA 3T12B 4HBTA 3IXDA 4X69A 1IEMA 4LV2A 1PRQA 3FC7A 2GZAA 4E3LA 1L0EA 4FCFA 4EQIA 1YMSA 5TGFA 2V8CA 4N1XA 5DJUA 4PKYA 2EX2A 5CGXA 3NIAA 2ZC7A 4CJNA 1CQAA 3UB9A 1GHMA 1NZOA 2VV8A 1LI9A 3PBRA 4Q0HA 4E3MA 5HWTA 3B3XA 1UGUA 2YKFA 1FSYA 1CI8A 3D9YA 5I94A 1GCEA 4RYEA 1NJ4A 1NWZA 3IXGA 5F83A 5FL3A 4F3LB 4ID4A 5G4YA 4KQQA 3MZFA 3F1PA 4CPKA 4ZBEA 3LIAA 2J7VA 4DXCA 1LT0A 1DP6A 3KYEA 3IF6C 4R70A 1YSPA 2JN7A 5J3WA 3IH9A 3VOLA 5FI6A 2QMIA 3DWZA 4PM7A 3HLCA 5HAIA 1N9OA 2Q0OA 2J3TD 2VV6A 2J8YA 2VKSA 2ZC5B 1CJFA 1ACFA 1IYQA 5HSQA 4WN5A 4E3JA 3CHWP 1MBLA 3N4IA 2Q9NA 3VE4A 2G2UA 5HL6A 5BOHA 4UAAA 1DJAA 5HDSA 5CERA 1XGJA 3C5AA 5E2HA 3VSLA 3HJKA 2PYRA 3FKVA 2Y2GA 2C6WB 3O5YA 5A92A 2ZMAA 1F5MA 2V2FF 2G2WA 2WKQA 4B4ZA 2VGJA 1I2SA 1N9NA 1MC0A 4Y0OA 4K91A 1T19A 4LV0A 4HP9A 1K6SA 3G32A 4H6JA 4X53A 2EX8A 2Z2MB 3G35A 2VK3A 3VP2A 5FI2A 3A3DA 2HPBA 1BTLA 4BD0A 5DFYA 2ZL1B 4OQHA 1TVFA 3W2ZA 4QJGA 2EWWA 2XA7M 4GD8A 4JF4A 1HLUP 2XROA 1UWNX 2XH9A 3KYZA 3WS2A 3O3VA 1N4OA 3AGEA 1D06A 2H0YA 2LB9A 1LL5A 1WYBA 1PFLA 3V3SA 1BLCA 1MZUA 3TSGA 4PMAA 1YT4A 2JKRM 4QY6A 3UDFA 1VM1A 2VGLM 2W0NA 4X1LA 3TE8A 4X6TA 1IOUA 1W7FA 2C5WB 2WK0A 1F9IA 4IBXA 2HGVA 3MQOA 3PHYA 1IYSA 3N8RA 3NC8A 4K0XA 4X55A 3ZNTA 5TJJA 5EOEA 1CEGA 3MQQA 3UY6A 1PIOA 2OV5A 1EW0A 4MMNA 5FATA 4MBHA 4LENA 4JGRA 5D3OA 3LEQA 3EGXC 3ZG8B 5CTNA 3F1PB 3JVUA 2PBDP 3GQZA 3E0YA 4ZDXA 1IKGA 5CXWA 5HW3A 1ZC2A 3M2JA 4UHUA 4EBPA 5E2EA 2EX6A 4OOLA 4LGWA 4QY5A 4BBTA 2W1TA 3MXRA 3CJMA 1YSQA 2HP6A 3G4PA 5L2FA 3K3CA 4GD6A 3GTCA 5KMWA 4ESPA 4Y3IA 2OAQ1 2YKHA 2I9VA 2PD7A 3E4PA 2Z6CA 2V1AA 3MR0A 3GSGA 2VEAA 3OZHA 2XF3A 4RX2A 4HIAA 2UWXA 1OMEA 2Y2KA 4LRXC 3Q7ZA 5J4EA 2HF6A 5CHMA 4RQ9A 1EI5A 4C6YA 4EV4A 3EEHA 4E3IA 4LV3A 3ZYTA 2CC1A 2R9XA 4EUZA 4JXVA 3BLSA 2JCHA 3LO7A 4KG5A 4E3OA 4GLQA 5HARA 1SDEA 1PYYA 5DTKA 3V5MA 4X68A 1K54A 4O01A 2O99A 2OAP1 2J80A 2OLUA 1W79A 1KE0A 5HD5A 1W63Q 2VX8A 4P6ZS 1K54C 2V1BA 4EWFA 3E2LA 3FZCA 3I7JA 4S2MA 4WM9A 1E4DA 3VOYA 5CHUA 4MN7A 3KSIA 3MFXA 3LUQA 2EXBA 3S7OA 3NHQA 3EOIA 4ZJ1A 1ZKJA 3IWIA 3NECA 1OTEA 1Y28A 1PW8A 1T1AA 4MDZA 1YKDA 4U0XA 3HLBA 1NZUA 2DMWA 1DJBA 1FILA 4KUKA 3BFDA 4BJPA 5F5YA 5AQ7A 1MWRA 2Y8HA 3BFGA 2FFYA 2VA0A 3NDEA 4XUXA 4B4XA 1YLYA 4I3AA 4HBUA 3G2ZA 4P0MA 1DP8A 1UWPX 1IYPA 3VFHA 1S4RA 3D4FA 5TBMA 3BW6A 1LHYA 1SKOA 1XA1A 1GA0A 5C5KA 3HUNA 4OPYA 3OBFA 1O07A 1YAXA 1OJ5A 2OLVA 3SW1A 1HZOA 5A91A 3UNWA 2XD5A 5AVEA 2JHEA 2Y55A 5HAQA 4GHIB 3H82B 4II7A 1E3UD 4WUJA 4KZAA 3E4OA 1LI0A 1K38A 3P98A 4R3AA 2QWSA 1K57A 3AGDA 1PZPA 2JE5A 4JPMA 4XXRA 2B18A 5F6AA 3K3DA 4WELA 3IBJA 3CI6A 5K5BA 3MMHA 3W8KA 3ZHHA 4DDYA 3S22A 2GDNA 3M6BA 4Y0UA 3R7WB 5CECA 4MN6A 1QMEA 3K2NA 2Y79A 4R0QA 3DAVA 3UB6A 3MXQA 3LI8A 3LEZA 3LI9A 1EWZA 4MCWA 4NEED 1M6KA 3G31A 4KQOA 3LYXA 5AQAA 5LBRA 1FSWA 4XUZA 1DRMA 4X25A 3ISGA 3VP4A 5GHYA 4P6ZM 2HP9A 2OSUA 2W3GA 5HWVA 4LRYC 3W4OA 3MS6A 5EVIA 4KZ3A 1DY6A 4KZ6A 4S2PA 4EBNA 1HVBA 2EWVA 2ZQ7A 3Q82A 4ZTKA 1OTAA 3ZG7B 3HL9A 4BWIA 3D72A 3IWQA 2ZMFA 2WGVA 3QP6A 5DF9A 1J9MA 3PR6A 5KSCA 3T1SA 3BECA 2DCFA 2Z6DA 4OLDA 5L10A 1S66L 1VQQA 1LSVA 4OP8A 4X1MA 5CEBA 4GKUA 3QNBA 2HZ5A 2ZQ8A 4NXGA 2IA2A 2MJ6A 5KSHA 4C75A 4ETZA 3LR4A 3UB5P 3IH8A 4F3LA 3C38A 3NOTC 5HWWA 3NCKA 5GHXA 3NI9A 4Z1WA 5EPHA 4PM5A 4S2OA 3O87A 2P04A 1Q2QA 1AWIA 3T4JA 1DP9A 4NKPA 3UDXA 2JBFA 3VOZA 2WZXA 2A3UA 4Q0IA 3UE0A 3OLOA 3AGFA 1XJ3A 1KGFA 4LLOB 2XQZA 2EA9A 4WF0A 4JBFA 5M1AA 3FG8A 3ZDJA 2HDUA 5JYOA 3BY9A 3CLOA 1MKIA 4YINA 1E25A 1MXOA 1WA9A 4MBKA 4MLLA 3G30A 5IT5A 1YLZA 3OPRA 5AVFA 4JXGA 1G68A 3BQAA 3QHYA 1G28A 2KOIA 5FA7A 1PWGA 5HPIA 3T1QB 5DFXA 1ODVA 5EM0A 3CAXA 3MJQA 2JKTI 4GZBA 3UO9A 3RTYA 1JWVA 1XGIA 2W3EA 1D7EA 3OPPA 1RGZA 3PBTA 3HREA 4UA6A 3FYZA 5GLDA 4R6LA 2JKGA 3WWXA 3BFCA 4DN0A 3A3EA 2P7JA 4WZ5A 3TJZC 2XDMA 4GW9A 2Y2JA 4N9LA 3ZVWA 1K4EA 1MY8A 1I5QA 5U47A 2ZC6B 4E6WA 3P01A 4KQDA 2A2LA 4EERA 3FKWA 1IKIA 3SH9A 4BBVA 4G3WA 3T4TA 3EQUA 5A93A 1PNEA 2QYBA 3LIFA 2HJ9C 5G18A 3WRTA 3QNCA 4QHCA 2ZL1A 1H8MA 5F82A 1OJGA 2BG1A 1W63M 4BL3A 1CEFA 3JVVA 4QU3A 4OPRA 4HP4A 2P9VB 4S2JA 4BENA 1SKFA 1V9ZA 4ZJ2A 4H6JB 4R38A 3R7WA 3FWLA 3LR5A 5F1GA 1W8YA 3CG5A 5J8XA 1L0DA 1ESUA 2ZJ9A 1T1CA 1A0KA 2M7VA 4KZBA 3HLEA 4JXWA 4EXOA 2HDSA 1L0FA 4R1GA 4OQ0A 3MSHA 3QP2A 4KG2A 1FOFA 1ESIA 3T1XA 2PR5A 5AJGA 5TR7A 4GOGA 3A0VA 2JC7A 4IEDA 3IHBA 3N6IA 3SH7A 1ERQA 4GS9B 3ZCZA 5E2FA 5HX9A 4Y17A 4I3JA 3B33A 3CMZA 3MXSA 3TG9A 2XSSA 4PAUA 1T1BA 2BASA 2X02A 4LFUA 1P9WA 2WKHA 1K4FA 4WMCD 3FPVA 3IXBA 4PM8A 1SHVA 3S7QA 2W1TB 1JVJA 4R23A 1SKOB 2K31A 4Y13A 1KE3A 4ZRRA 3TRCA 5EVID 2PU2A 5DKLA 4F94A 4YOFA 4IBRA 3ZG0A 1S4SA 4D2OA 3NOPC 5GLBA 4IUKA 2J9OA 4L0LA 1XP4A 1ERMA 3B47A 5MC7A 2EFUA 5A90A 5CEDA 3C4OA 4H8RA 2FFFB 1K56A 2XEPA 2VJWA 3BWLA 4LPZA 3V67A 4B88A 2ZOHA 3SH8A 1G5UA 3L9KA 4KZ9A 3T4SA 2A24A 4D60A 4Y2FA 5GLAA 4P6BA 3F1NA 3A0SA 1VETA 3HUOA 5HPFA 1TS6A 4EUVA 4KENB 2H5SA 5IU1A 3Q7VB 3WS1A 5GL9A 5M19A 5KIZA 1XXMA 5HD3A 1OTBA 2ZC4B 4RVAA 2ZM0A 1SZVA 3EGDC 1EROA 3DW0A 3ZVTA 4PPRA 5F68A 2ZQDA 5F1FA 4O0PA 3DTIA 4JGQA 5FSRA 3Q1FA 4FTXA 3RXWA 2QJ5A 3UPPA 3HJIA 3KSHA 1L0GA 2WGIA 4C3QA 1YLJA 2Y2OA 1LLBA 2XFSA 3MF0A 1BSGA 3QP5A 2PR6A 2Y2LA 5FDHA 1ES2A 1S6RA 2HP5A 2ZQ9A 2QKPA 5DJTA 2XD1A 4GHIA 1P9RA 4FD8A 4N1HA 2PRFA 2V0WA 2Y91A 1GSVA 4GDBA 3TOIA 4EU0A 1BULA 4IHQA 1YLPA 5J7EA 3S4XA 2ZBBA 3BFFA 3HLWA 2XFTA 3LR0A 1OT6A 1PZOA 4OPZA 4I39A 4NXEA 4HY8A 2ZLYA 2GNXA 3U4LP 3BJNA 3PAEA 4DKIA 5FAOA 3MZDA 5FQJA 3V50A 1VHMA 2B95A 4UQIS 3C7UA 4S2IA 3A0RA 5JYPA 2QJ7A 2BTFP 4K08A 3MBZA 1ES5A 2KLIA 4WBGA 3EQVA 3WRZA 3WS0A 5E2GA 1RGYA 2ZMVA 2WKIA 3DTMA 5FAQA 3C2WA 3R4KA 4JF6A 4R3JA 4PM6A 5EECA 3DWKA 3RJUA 2WGWA 2XLNA 5E43A 1GHPA 3VSKA 3JYIA 4OPQA 4BD1A 4ZAMA 5CGSA 4WLAA 4EBLA 1H8YA 2ZQCA 4S2LA 3IHAA 1VB6A 5EVLA 5FQ9A 3BLMA 4S2NC 3ZFZA 3UB7A 2XRNA 4NETA 1TD5A 4I3IA 1ZTUA 3KO6A 2L1MA 1PWCA 4JKTA 1YPRA 3SS5A 2VLGA 3BQ8A 3OPHA 1U60A 3N8LA 5EV0A 3NULA 4MNRA 2RCXA 3VMAA 1KGEA 4WEKA 2H28A 3SOIA 1T18A 3BEBA 4Q8IA 4IVKA 3C4PA 5FEGA 4KZ5A 3F1OB 4FOFA 5FDSA 2KX6A 4AFIA 2ZM2A 4UA7A 3CPTB 2EFXA 2A24B 3H7WA 1E3UA 1MWUA 3E4QA 4E04A 4KZ7A 3VE3A 2VZWA 4LCMA 2WGWB 4HHDA 3VP0A 3SZTA 2L4RA 4HJ6A 5HL1A 3PBSA 3GVBA 2V0UA 2PAVP 3SS4A 2AVXA 4HEFA 3T4LA 2E8JA 2OOLA 4S2NA 4P87A 1AXBA 1KDWA 3KSFA 5FQIA 3V39A 3FV7A 1K55C 2L0WA 2IWBA 3OCNA 4U0TA 4ETXA 1YM1A 3OOVA 3IF5A 4L9GA
chains in the Genus database with same CATH topology
3MQQA 4DN0A 1EW0A 2P7JA 4MMNA 2GX5A 3TJZC 1V9YA 4GW9A 3T4OA 4JGRA 5F69A 1H3QA 3G6OA 4HH3A 3IS2B 3EGXC 1KOUA 3F1PB 3JVUA 2LB5A 4I38A 1G6OA 3E0YA 2XA7S 3P01A 4KQDA 3VV4A 2A2LA 4EERA 2O9CA 4CLCA 4OOLA 4WEJA 3OCLA 4BBTA 2W1TA 4GJ4A 4B93A 4Q0JA 3MQ0A 4BBVA 2W1RA 4G3WA 3T4TA 1YSQA 3PYPA 3EQUA 2QYBA 2G7UA 2HJ9C 3LIFA 1OT9A 2J3TC 2PYPA 3K3CA 1P0ZA 2INWA 1H8MA 4Y3IA 1OJGA 4Y5FA 2OAQ1 1W63M 3GDIA 2JKTM 3RH8B 2YKHA 2I9VA 2PD7A 3E4PA 3PXPA 4ARZB 3JVVA 4EQ1A 2Z6CA 2V1AA 4HP4A 3TW8A 3LIBA 3MR0A 4HOIA 5HZHA 1V9ZA 2HJEA 2HV1A 2VEAA 4EEPA 1LSXA 3UE3A 4H6JB 4R38A 3R7WA 4CLCD 4UEYA 3LR5A 2K7SA 1NLYA 4HIAA 4XT2B 3KSGA 1T1CA 3P7NA 2M7VA 2JKRI 4PHTA 4LRXC 3BY8A 2WKPA 3F1OA 4HJ4A 4EXOA 5J4EA 2HF6A 1F98A 2PT7A 4RQ9A 4XT2A 3EEHA 3ZYTA 3FPWA 3DBAA 2D01A 2PR5A 5AJGA 3A0VA 5A8BA 1S1ZA 2PDRA 3LIDA 4GLQA 4BMWA 3CUEA 3PBNA 3ICYA 4ARZA 4GS9B 3C30A 2PD8A 4I3JA 3OC2A 4HI4A 3B33A 4O01A 1IFQA 2O99A 2OAP1 4NXFA 2J80A 3UE6A 2XSSA 1TF1A 5HD5A 4PAUA 1T1BA 2BASA 4PKYG 1NRJA 1P9WA 3T50A 4KUOA 1W63Q 3FPVA 2VX8A 3PBQA 4P6ZS 3S7QA 2W1TB 3NJAA 1ZHHB 2V1BA 4MN5A 2K31A 2W3DA 1TS7A 3TRCA 4ZRRA 2PHYA 4NXBA 2FZ0A 5CX7A 1XJ2A 4M4XA 3PBOA 5DKLA 3IS2A 4YOFA 2WKRA 4MN7A 3KSIA 3MFXA 3LUQA 1S4SA 4L9EA 4O8GA 4YNRA 3NOPC 3S7OA 4IUKA 3NHQA 3EOIA 3T4KA 1X0OA 4L0LA 3RFBA 3B47A 4DJ2A 1OTEA 1Y28A 5MC7A 4EETB 1T1AA 4MDZA 1YKDA 2DMWA 4KUKA 5HDDA 4BJPA 4CQHA 5F5YA 4FSFA 4JGPA 2Y8HA 4OOMA 4G3VA 5HDCA 2VJWA 3BWLA 4LPZA 3V67A 2R78A 2VA0A 2ZOHA 4IUHA 4I3AA 3T4SA 1GSWA 3CWFA 2A24A 5I5LA 2QHKA 1DP8A 1UWPX 1LSWA 4Y2FA 1S4RA 2W27A 4CLCE 3EWKA 3F1NA 3CUEC 3A0SA 5HPFA 5TBMA 3ULFA 1TS6A 3EEAA 2OWHA 3BW6A 4EUVA 1S67L 1N9LA 5C5KA 4IJGA 3OBFA 5IU1A 4CLCC 1YAXA 3ZQ5A 1OJ5A 3UMEA 4HQAA 5KIZA 3HCYA 1GSXA 1TS8A 5HD3A 1OTBA 3S7PA 1JNUA 3SW1A 3EGDC 3U2AA 3FC7A 2GZAA 2D02A 5AVEA 2JHEA 5F68A 1S1YA 2O0YA 4O0PA 4JGQA 4GHIB 3H82B 4II7A 4UQIM 4WUJA 3E4OA 3H7WB 5DJUA 2QJ5A 3HJIA 4PKYA 4GCZA 1XJ6A 3KSHA 4ME4A 4B9OA 4R3AA 2QWSA 2M1CA 2GJ3A 2ZOIA 3UB9A 2B18A 4G3KA 2VV8A 3MF0A 5F6AA 3K3DA 4WELA 3IBJA 1P97A 3PBRA 5L8MA 2B02A 2PR6A 3CI6A 4Q0HA 5G4ZA 3MMHA 5K5BA 5HWTA 1UGUA 2YKFA 5EFWA 3R7WB 2QKPA 1STZA 4JGOA 4MN6A 5DJTA 4GHIA 3K2NA 3KX0X 1P9RA 2Y79A 2V0WA 4HNBA 1NWZA 5FL3A 3MXQA 3UB6A 4F3LB 3LI8A 3LICA 2O9AA 1GSVA 2W3FA 5G4YA 3LI9A 2VGLS 3LFVA 3F1PA 3F1NB 4MCWA 2CMNA 4EU0A 5IS1A 4IHQA 4NEED 5J7EA 3LIAA 3IBRA 2ZBBA 1LT0A 4KQOA 2FH5A 3LYXA 1DP6A 4R70A 3UMDA 5LBRA 1YSPA 3LR0A 1DRMA 1OT6A 2JN7A 5J3WA 4I39A 4NXEA 3VOLA 4HY8A 2GNXA 3BJNA 4P6ZM 2W3GA 2OWJA 5HWVA 4LRYC 3NOUC 1N9OA 1VHMA 4UQIS 2EWVA 2J3TD 2VV6A 3A0RA 2VKSA 2W3HA 2QJ7A 4K08A 1OTAA 2KDKA 4BWIA 2KLIA 3D72A 5HSQA 3E98A 2ZMFA 3EQVA 4WN5A 1TS0A 2ZMVA 5DF9A 3B42A 3PR6A 3C2WA 3R4KA 1XJ4A 3VE4A 2Z6DA 4DMZA 5HL6A 2P08A 3LIEA 1S66L 3UB8A 4WLAA 5HDSA 3C8CA 3S7NA 1VB6A 1LSVA 4L9FA 3H82A 3HJKA 4YWZA 2PYRA 3LR3A 2XRNA 3UB7A 4HH2A 3O5YA 1TD5A 3T4QA 4I3IA 4NXGA 1BYWA 1F5MA 1ZTUA 2IA2A 1XFQA 3KO6A 4EW7A 2L1MA 2MJ6A 2NUPC 2WKQA 5KSHA 1N9NA 4GS9A 4ETZA 2VLGA 3LR4A 3BQ8A 4F3LA 1MC0A 3C38A 3NOTC 5HWWA 4Z1WA 1T19A 2P04A 3D3OA 4HP9A 4H6JA 4WEKA 1DP9A 4NKPA 3T4JA 4BBUA 2H28A 1T18A 1NLZA 2M7UA 1LL8A 3KYQA 3F1OB 4I5SA 4Q0IA 5TBMB 3OLOA 1XJ3A 4FOFA 5DFYA 4LLOB 2J3WA 2KX6A 4AFIA 2EA9A 4WF0A 4LRZE 4L9GA 2A24B 3W2ZA 3H7WA 2NUTC 3FG8A 2EWWA 1OTDA 2XA7M 3BY9A 3CLOA 2XROA 1UWNX 3E4QA 3KYZA 2O9BA 1MKMA 4E04A 2K2NA 4EESA 4CLCB 3VE3A 1D06A 1WA9A 3CITA 5IT5A 2LB9A 2VZWA 4HHDA 5AVFA 4HJ3A 1OTIA 1MZUA 4QPRA 2L4RA 3BQAA 1G28A 4HJ6A 2KOIA 3PBSA 2JKRM 2V0UA 4EEUA 5HPIA 3T4LA 5DFXA 1ODVA 2VGLM 2W0NA 2OOLA 3CAXA 5DKKA 1OPXA 3MJQA 3TE8A 2JKTI 3KSFA 3RTYA 1IOUA 2V9AA 3GECA 4DJ3A 1F9IA 2W3EA 1D7EA 4WL9A 2L0WA 3PBTA 2VV7A 2HGVA 3MQOA 3PHYA 3OCNA 4ETXA 3OOVA 3H9WA 4R6LA 1XFNA 5TJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P08 A;  2P04 A;  4GJ4 A; 
#chains in the Genus database with same CATH topology
 3DTK A;  3HUM A;  4R4S A;  2A49 A;  4PM9 A;  4NG2 A;  3G6O A;  4HH3 A;  3IS2 B;  1KOU A;  1ONH A;  3ZNY A;  2LB5 A;  2Z2L B;  5GHZ A;  5TFQ A;  3ZGA B;  2RL3 A;  2O9C A;  4CLC A;  4GJ4 A;  4B93 A;  1RP5 A;  3WS5 A;  4Q0J A;  3MQ0 A;  3A3I A;  3CZD A;  4DE1 A;  1Q2P A;  5KZH A;  2G7U A;  4R4R A;  1OT9 A;  2PYP A;  4R3B A;  3HLF A;  1P0Z A;  2INW A;  1VEU A;  3GDI A;  3RH8 B;  5FEF A;  4EQ1 A;  2HV1 A;  1NXY A;  4KQR A;  3UE3 A;  3IQA A;  4CLC D;  2Y2I A;  5EVE A;  4XT2 B;  3KSG A;  4PHT A;  3BY8 A;  3F1O A;  1TDL A;  1F98 A;  3V3R A;  2PT7 A;  1NY0 A;  2JKF A;  4N92 A;  4BLM A;  5HAP A;  1FIK A;  4Y15 A;  1MWS A;  3DBA A;  1BUE A;  4QWO A;  5A8B A;  2PDR A;  4A5R A;  4BMW A;  1FCO A;  1IYO A;  3ICY A;  4ARZ A;  5EE8 A;  3C30 A;  3BFE A;  4HI4 A;  3LY4 A;  4FH4 A;  1ES4 A;  4PKY G;  1NRJ A;  3T50 A;  4Y7P A;  3NJA A;  3M6H A;  2W3D A;  2P74 A;  4NXB A;  2FZ0 A;  1K0K A;  1VEU B;  1XJ2 A;  3MKF A;  2WKR A;  2X71 A;  4NK3 A;  4YNR A;  1JTG A;  3T4K A;  4DF6 A;  4KG6 A;  4OQI A;  3RFB A;  4DJ2 A;  4JF5 A;  4EET B;  1PI5 A;  5HDD A;  1KVL A;  1ALQ A;  2XGN A;  4FSF A;  4M3K A;  4G3V A;  4P85 A;  3GR2 A;  2WAF A;  1KDS A;  2QHK A;  3GRJ A;  3HBR A;  1BT5 A;  2W27 A;  1YMX A;  3CUE C;  4LCL A;  1F2K A;  2ZD8 A;  1JWZ A;  3EEA A;  3E2K A;  2QPN A;  4OP5 A;  3LCE A;  4BL2 A;  2H10 A;  2ZM8 A;  1S67 L;  3BYD A;  1N9L A;  4CLC C;  3VP3 A;  2E8I A;  3UME A;  4MBF A;  5IHV A;  3HCY A;  3BRM A;  3W4Q A;  2WZZ A;  1JNU A;  4DDS A;  4KZ4 A;  3U2A A;  1C3B A;  2D02 A;  3LY3 A;  3O86 A;  3G34 A;  1S1Y A;  2O0Y A;  3GV9 A;  3O88 A;  5HFO A;  1XA7 A;  4UQI M;  3H7W B;  2WYX A;  5EVI C;  4GCZ A;  1XJ6 A;  2P9V A;  4ME4 A;  4B9O A;  1BLS A;  2ZC3 B;  1G6A A;  2M1C A;  4RA7 A;  1J3W A;  3VFF A;  2GJ3 A;  2ZOI A;  4G3K A;  1KVM A;  4WZ5 C;  1P97 A;  3QP1 A;  5L8M A;  2B02 A;  5G4Z A;  1ONG A;  3Q7V A;  1FR6 A;  5EFW A;  3Q07 A;  1STZ A;  4JGO A;  1FCN A;  4RX3 A;  1H5X A;  3KX0 X;  5DTT A;  4IVI A;  4OON A;  4HNB A;  3LIC A;  2O9A A;  2W3F A;  3S1Y A;  1BLH A;  1VET B;  2VGL S;  3LFV A;  4FUW A;  3F1N B;  3UDI A;  2CMN A;  1KE4 A;  5L09 A;  5IS1 A;  1BZA A;  5FQK A;  2UV0 E;  5CRF A;  1ZG6 A;  3IBR A;  1QMF A;  2FH5 A;  3UMD A;  3IT9 A;  3ITA A;  1K57 C;  2Y2M A;  1LL9 A;  4GN2 A;  2OWJ A;  1JTD A;  3NOU C;  3IXH A;  5FAP A;  2W3H A;  3ZG5 A;  2KDK A;  2EX9 A;  4E3N A;  3E98 A;  2V1Z A;  1TS0 A;  2J9P A;  1K25 A;  3B42 A;  2EXA A;  1XJ4 A;  4DMZ A;  3IWO A;  2P08 A;  3LIE A;  4WYY A;  3A3J A;  3UB8 A;  1W5D A;  3C8C A;  3S7N A;  1Z6F A;  4L9F A;  3H82 A;  4YWZ A;  3LR3 A;  4HH2 A;  4KZ8 A;  4N9K A;  3T4Q A;  1BYW A;  4EW7 A;  1XFQ A;  2H0T A;  1MWT A;  5L07 A;  2HDR A;  2Y4A A;  2NUP C;  1XX2 A;  2ZQA A;  4GS9 A;  2HDQ A;  2Y2H A;  1NRF A;  4MEZ A;  1FQG A;  3NBL A;  4Z9Q A;  4QD4 A;  5AQB A;  1YLW A;  3D3O A;  4QB8 A;  2XR0 A;  3QP8 A;  2Y2N A;  4BBU A;  3LGO A;  1NLZ A;  2M7U A;  1LL8 A;  3KYQ A;  1FCM A;  2DRW A;  4I5S A;  5TBM B;  1SCW A;  2B5R A;  1JWP A;  4WZ4 A;  2J3W A;  3UN7 A;  4LRZ E;  2Y2P A;  4Y0T A;  2NUT C;  3NDG A;  1OTD A;  1PW1 A;  3MKE A;  3L7H A;  2O9B A;  1MKM A;  2K2N A;  4EES A;  1K55 A;  2WAD A;  4CLC B;  3C7V A;  3CIT A;  3IF6 A;  4E6X A;  2V20 A;  1RCJ A;  1WE4 A;  1D1J A;  1PI4 A;  3W4P A;  3ZG9 B;  1GA9 A;  4LV1 A;  4DXB A;  1YLT A;  4HJ3 A;  1OTI A;  3N7W A;  4QPR A;  1TDG A;  1K6R A;  3G2Y A;  4EEU A;  3IX4 A;  5FI7 A;  4E3K A;  1BLP A;  1Z09 A;  2WAE A;  5DKK A;  1OPX A;  5EOO A;  1CK3 A;  1M40 A;  2V9A A;  5EVI B;  3GEC A;  4OOY A;  4DJ3 A;  1WYC A;  4WL9 A;  2VV7 A;  1W8Q A;  3H9W A;  2ACG A;  1XFN A;  1FR1 A;  1ZG4 A;  2IWD A;  2WUQ A;  1XPB A;  2GX5 A;  1V9Y A;  3T4O A;  1Y4O A;  3P09 A;  5F69 A;  1H3Q A;  2WKE A;  4HES A;  4X56 A;  1CF0 A;  5FAS A;  4I38 A;  1G6O A;  2XA7 S;  5DF8 A;  1Y54 A;  1L2S A;  3VV4 A;  2X01 A;  4DE0 A;  4WEJ A;  3OCL A;  3WS4 A;  5EM1 A;  4ZJ3 A;  2W1R A;  1TEM A;  3PYP A;  2V8F A;  3UE1 A;  4OH0 A;  2QZ6 A;  2J3T C;  3CPT A;  3UPO A;  4Y5F A;  5FQM A;  1PWD A;  2JKT M;  3ITB A;  4FH2 A;  3PXP A;  4ARZ B;  3MFD A;  4K0W A;  3TW8 A;  3LIB A;  4HOI A;  3NY4 A;  5HZH A;  4GDN A;  1I2W A;  3MZE A;  2HJE A;  3OPL A;  4EEP A;  1LSX A;  4OKP A;  1SDN A;  2BLS A;  4UEY A;  2K7S A;  1NLY A;  4DRT A;  3GMW A;  3P7N A;  4JLF A;  3SS3 A;  2JKR I;  5DVA A;  3N8S A;  2WKP A;  4HJ4 A;  5CTM A;  1S0W A;  1K56 D;  2Y2Q A;  5GLC A;  3IF6 B;  2Y59 A;  4S2K A;  4XT2 A;  4YFM A;  3IX3 A;  1O7E A;  3FPW A;  4U3T A;  4O7D A;  5CGW A;  2D01 A;  3T1R A;  1S1Z A;  4BQM A;  1IEL A;  3LID A;  1HTZ A;  3CUE A;  3PBN A;  4OLG A;  2PD8 A;  3OC2 A;  5DF7 A;  1IFQ A;  4NXF A;  2VGK A;  3UE6 A;  1TF1 A;  4DE2 A;  5M18 A;  1H8Z A;  4KUO A;  2I72 A;  5DTS A;  3PBQ A;  1XKZ A;  3Q81 A;  3UPN A;  1ZHH B;  4GB7 A;  4WMC A;  4MN5 A;  1TS7 A;  2PHY A;  5CX7 A;  4M4X A;  3VP1 A;  3PBO A;  2Q9M A;  3IS2 A;  1MPL A;  4L9E A;  4O8G A;  1X0O A;  1CI9 A;  1HD8 A;  5FQQ A;  1L3L A;  2XK1 A;  4CQH A;  3HLG A;  4UA9 A;  3M2K A;  4OVD A;  4JGP A;  4OOM A;  5HDC A;  2R9W A;  3BM6 A;  2R78 A;  1KGG A;  5CHJ A;  4IUH A;  2PBY A;  3HVF A;  4JXS A;  1GSW A;  3IX8 A;  3CWF A;  1N9B A;  5I5L A;  3DTE A;  1LSW A;  4CLC E;  1GHI A;  3EWK A;  4GNU A;  1ES3 A;  1YQS A;  5EUA A;  2DNS A;  3ULF A;  1NYM A;  3QP4 A;  3RXX A;  2OWH A;  2PU4 A;  3PTE A;  4DE3 A;  5AQ9 A;  4OQG A;  4IJG A;  3PAG A;  3HLD A;  3ZQ5 A;  1NYY A;  2IWC A;  3JPU A;  4HQA A;  3A3F A;  1DJC A;  1GSX A;  1TS8 A;  1H0M A;  3S7P A;  3T12 B;  4HBT A;  3IXD A;  4X69 A;  1IEM A;  4LV2 A;  1PRQ A;  3FC7 A;  2GZA A;  4E3L A;  1L0E A;  4FCF A;  4EQI A;  1YMS A;  5TGF A;  2V8C A;  4N1X A;  5DJU A;  4PKY A;  2EX2 A;  5CGX A;  3NIA A;  2ZC7 A;  4CJN A;  1CQA A;  3UB9 A;  1GHM A;  1NZO A;  2VV8 A;  1LI9 A;  3PBR A;  4Q0H A;  4E3M A;  5HWT A;  3B3X A;  1UGU A;  2YKF A;  1FSY A;  1CI8 A;  3D9Y A;  5I94 A;  1GCE A;  4RYE A;  1NJ4 A;  1NWZ A;  3IXG A;  5F83 A;  5FL3 A;  4F3L B;  4ID4 A;  5G4Y A;  4KQQ A;  3MZF A;  3F1P A;  4CPK A;  4ZBE A;  3LIA A;  2J7V A;  4DXC A;  1LT0 A;  1DP6 A;  3KYE A;  3IF6 C;  4R70 A;  1YSP A;  2JN7 A;  5J3W A;  3IH9 A;  3VOL A;  5FI6 A;  2QMI A;  3DWZ A;  4PM7 A;  3HLC A;  5HAI A;  1N9O A;  2Q0O A;  2J3T D;  2VV6 A;  2J8Y A;  2VKS A;  2ZC5 B;  1CJF A;  1ACF A;  1IYQ A;  5HSQ A;  4WN5 A;  4E3J A;  3CHW P;  1MBL A;  3N4I A;  2Q9N A;  3VE4 A;  2G2U A;  5HL6 A;  5BOH A;  4UAA A;  1DJA A;  5HDS A;  5CER A;  1XGJ A;  3C5A A;  5E2H A;  3VSL A;  3HJK A;  2PYR A;  3FKV A;  2Y2G A;  2C6W B;  3O5Y A;  5A92 A;  2ZMA A;  1F5M A;  2V2F F;  2G2W A;  2WKQ A;  4B4Z A;  2VGJ A;  1I2S A;  1N9N A;  1MC0 A;  4Y0O A;  4K91 A;  1T19 A;  4LV0 A;  4HP9 A;  1K6S A;  3G32 A;  4H6J A;  4X53 A;  2EX8 A;  2Z2M B;  3G35 A;  2VK3 A;  3VP2 A;  5FI2 A;  3A3D A;  2HPB A;  1BTL A;  4BD0 A;  5DFY A;  2ZL1 B;  4OQH A;  1TVF A;  3W2Z A;  4QJG A;  2EWW A;  2XA7 M;  4GD8 A;  4JF4 A;  1HLU P;  2XRO A;  1UWN X;  2XH9 A;  3KYZ A;  3WS2 A;  3O3V A;  1N4O A;  3AGE A;  1D06 A;  2H0Y A;  2LB9 A;  1LL5 A;  1WYB A;  1PFL A;  3V3S A;  1BLC A;  1MZU A;  3TSG A;  4PMA A;  1YT4 A;  2JKR M;  4QY6 A;  3UDF A;  1VM1 A;  2VGL M;  2W0N A;  4X1L A;  3TE8 A;  4X6T A;  1IOU A;  1W7F A;  2C5W B;  2WK0 A;  1F9I A;  4IBX A;  2HGV A;  3MQO A;  3PHY A;  1IYS A;  3N8R A;  3NC8 A;  4K0X A;  4X55 A;  3ZNT A;  5TJJ A;  5EOE A;  1CEG A;  3MQQ A;  3UY6 A;  1PIO A;  2OV5 A;  1EW0 A;  4MMN A;  5FAT A;  4MBH A;  4LEN A;  4JGR A;  5D3O A;  3LEQ A;  3EGX C;  3ZG8 B;  5CTN A;  3F1P B;  3JVU A;  2PBD P;  3GQZ A;  3E0Y A;  4ZDX A;  1IKG A;  5CXW A;  5HW3 A;  1ZC2 A;  3M2J A;  4UHU A;  4EBP A;  5E2E A;  2EX6 A;  4OOL A;  4LGW A;  4QY5 A;  4BBT A;  2W1T A;  3MXR A;  3CJM A;  1YSQ A;  2HP6 A;  3G4P A;  5L2F A;  3K3C A;  4GD6 A;  3GTC A;  5KMW A;  4ESP A;  4Y3I A;  2OAQ 1;  2YKH A;  2I9V A;  2PD7 A;  3E4P A;  2Z6C A;  2V1A A;  3MR0 A;  3GSG A;  2VEA A;  3OZH A;  2XF3 A;  4RX2 A;  4HIA A;  2UWX A;  1OME A;  2Y2K A;  4LRX C;  3Q7Z A;  5J4E A;  2HF6 A;  5CHM A;  4RQ9 A;  1EI5 A;  4C6Y A;  4EV4 A;  3EEH A;  4E3I A;  4LV3 A;  3ZYT A;  2CC1 A;  2R9X A;  4EUZ A;  4JXV A;  3BLS A;  2JCH A;  3LO7 A;  4KG5 A;  4E3O A;  4GLQ A;  5HAR A;  1SDE A;  1PYY A;  5DTK A;  3V5M A;  4X68 A;  1K54 A;  4O01 A;  2O99 A;  2OAP 1;  2J80 A;  2OLU A;  1W79 A;  1KE0 A;  5HD5 A;  1W63 Q;  2VX8 A;  4P6Z S;  1K54 C;  2V1B A;  4EWF A;  3E2L A;  3FZC A;  3I7J A;  4S2M A;  4WM9 A;  1E4D A;  3VOY A;  5CHU A;  4MN7 A;  3KSI A;  3MFX A;  3LUQ A;  2EXB A;  3S7O A;  3NHQ A;  3EOI A;  4ZJ1 A;  1ZKJ A;  3IWI A;  3NEC A;  1OTE A;  1Y28 A;  1PW8 A;  1T1A A;  4MDZ A;  1YKD A;  4U0X A;  3HLB A;  1NZU A;  2DMW A;  1DJB A;  1FIL A;  4KUK A;  3BFD A;  4BJP A;  5F5Y A;  5AQ7 A;  1MWR A;  2Y8H A;  3BFG A;  2FFY A;  2VA0 A;  3NDE A;  4XUX A;  4B4X A;  1YLY A;  4I3A A;  4HBU A;  3G2Z A;  4P0M A;  1DP8 A;  1UWP X;  1IYP A;  3VFH A;  1S4R A;  3D4F A;  5TBM A;  3BW6 A;  1LHY A;  1SKO A;  1XA1 A;  1GA0 A;  5C5K A;  3HUN A;  4OPY A;  3OBF A;  1O07 A;  1YAX A;  1OJ5 A;  2OLV A;  3SW1 A;  1HZO A;  5A91 A;  3UNW A;  2XD5 A;  5AVE A;  2JHE A;  2Y55 A;  5HAQ A;  4GHI B;  3H82 B;  4II7 A;  1E3U D;  4WUJ A;  4KZA A;  3E4O A;  1LI0 A;  1K38 A;  3P98 A;  4R3A A;  2QWS A;  1K57 A;  3AGD A;  1PZP A;  2JE5 A;  4JPM A;  4XXR A;  2B18 A;  5F6A A;  3K3D A;  4WEL A;  3IBJ A;  3CI6 A;  5K5B A;  3MMH A;  3W8K A;  3ZHH A;  4DDY A;  3S22 A;  2GDN A;  3M6B A;  4Y0U A;  3R7W B;  5CEC A;  4MN6 A;  1QME A;  3K2N A;  2Y79 A;  4R0Q A;  3DAV A;  3UB6 A;  3MXQ A;  3LI8 A;  3LEZ A;  3LI9 A;  1EWZ A;  4MCW A;  4NEE D;  1M6K A;  3G31 A;  4KQO A;  3LYX A;  5AQA A;  5LBR A;  1FSW A;  4XUZ A;  1DRM A;  4X25 A;  3ISG A;  3VP4 A;  5GHY A;  4P6Z M;  2HP9 A;  2OSU A;  2W3G A;  5HWV A;  4LRY C;  3W4O A;  3MS6 A;  5EVI A;  4KZ3 A;  1DY6 A;  4KZ6 A;  4S2P A;  4EBN A;  1HVB A;  2EWV A;  2ZQ7 A;  3Q82 A;  4ZTK A;  1OTA A;  3ZG7 B;  3HL9 A;  4BWI A;  3D72 A;  3IWQ A;  2ZMF A;  2WGV A;  3QP6 A;  5DF9 A;  1J9M A;  3PR6 A;  5KSC A;  3T1S A;  3BEC A;  2DCF A;  2Z6D A;  4OLD A;  5L10 A;  1S66 L;  1VQQ A;  1LSV A;  4OP8 A;  4X1M A;  5CEB A;  4GKU A;  3QNB A;  2HZ5 A;  2ZQ8 A;  4NXG A;  2IA2 A;  2MJ6 A;  5KSH A;  4C75 A;  4ETZ A;  3LR4 A;  3UB5 P;  3IH8 A;  4F3L A;  3C38 A;  3NOT C;  5HWW A;  3NCK A;  5GHX A;  3NI9 A;  4Z1W A;  5EPH A;  4PM5 A;  4S2O A;  3O87 A;  2P04 A;  1Q2Q A;  1AWI A;  3T4J A;  1DP9 A;  4NKP A;  3UDX A;  2JBF A;  3VOZ A;  2WZX A;  2A3U A;  4Q0I A;  3UE0 A;  3OLO A;  3AGF A;  1XJ3 A;  1KGF A;  4LLO B;  2XQZ A;  2EA9 A;  4WF0 A;  4JBF A;  5M1A A;  3FG8 A;  3ZDJ A;  2HDU A;  5JYO A;  3BY9 A;  3CLO A;  1MKI A;  4YIN A;  1E25 A;  1MXO A;  1WA9 A;  4MBK A;  4MLL A;  3G30 A;  5IT5 A;  1YLZ A;  3OPR A;  5AVF A;  4JXG A;  1G68 A;  3BQA A;  3QHY A;  1G28 A;  2KOI A;  5FA7 A;  1PWG A;  5HPI A;  3T1Q B;  5DFX A;  1ODV A;  5EM0 A;  3CAX A;  3MJQ A;  2JKT I;  4GZB A;  3UO9 A;  3RTY A;  1JWV A;  1XGI A;  2W3E A;  1D7E A;  3OPP A;  1RGZ A;  3PBT A;  3HRE A;  4UA6 A;  3FYZ A;  5GLD A;  4R6L A;  2JKG A;  3WWX A;  3BFC A;  4DN0 A;  3A3E A;  2P7J A;  4WZ5 A;  3TJZ C;  2XDM A;  4GW9 A;  2Y2J A;  4N9L A;  3ZVW A;  1K4E A;  1MY8 A;  1I5Q A;  5U47 A;  2ZC6 B;  4E6W A;  3P01 A;  4KQD A;  2A2L A;  4EER A;  3FKW A;  1IKI A;  3SH9 A;  4BBV A;  4G3W A;  3T4T A;  3EQU A;  5A93 A;  1PNE A;  2QYB A;  3LIF A;  2HJ9 C;  5G18 A;  3WRT A;  3QNC A;  4QHC A;  2ZL1 A;  1H8M A;  5F82 A;  1OJG A;  2BG1 A;  1W63 M;  4BL3 A;  1CEF A;  3JVV A;  4QU3 A;  4OPR A;  4HP4 A;  2P9V B;  4S2J A;  4BEN A;  1SKF A;  1V9Z A;  4ZJ2 A;  4H6J B;  4R38 A;  3R7W A;  3FWL A;  3LR5 A;  5F1G A;  1W8Y A;  3CG5 A;  5J8X A;  1L0D A;  1ESU A;  2ZJ9 A;  1T1C A;  1A0K A;  2M7V A;  4KZB A;  3HLE A;  4JXW A;  4EXO A;  2HDS A;  1L0F A;  4R1G A;  4OQ0 A;  3MSH A;  3QP2 A;  4KG2 A;  1FOF A;  1ESI A;  3T1X A;  2PR5 A;  5AJG A;  5TR7 A;  4GOG A;  3A0V A;  2JC7 A;  4IED A;  3IHB A;  3N6I A;  3SH7 A;  1ERQ A;  4GS9 B;  3ZCZ A;  5E2F A;  5HX9 A;  4Y17 A;  4I3J A;  3B33 A;  3CMZ A;  3MXS A;  3TG9 A;  2XSS A;  4PAU A;  1T1B A;  2BAS A;  2X02 A;  4LFU A;  1P9W A;  2WKH A;  1K4F A;  4WMC D;  3FPV A;  3IXB A;  4PM8 A;  1SHV A;  3S7Q A;  2W1T B;  1JVJ A;  4R23 A;  1SKO B;  2K31 A;  4Y13 A;  1KE3 A;  4ZRR A;  3TRC A;  5EVI D;  2PU2 A;  5DKL A;  4F94 A;  4YOF A;  4IBR A;  3ZG0 A;  1S4S A;  4D2O A;  3NOP C;  5GLB A;  4IUK A;  2J9O A;  4L0L A;  1XP4 A;  1ERM A;  3B47 A;  5MC7 A;  2EFU A;  5A90 A;  5CED A;  3C4O A;  4H8R A;  2FFF B;  1K56 A;  2XEP A;  2VJW A;  3BWL A;  4LPZ A;  3V67 A;  4B88 A;  2ZOH A;  3SH8 A;  1G5U A;  3L9K A;  4KZ9 A;  3T4S A;  2A24 A;  4D60 A;  4Y2F A;  5GLA A;  4P6B A;  3F1N A;  3A0S A;  1VET A;  3HUO A;  5HPF A;  1TS6 A;  4EUV A;  4KEN B;  2H5S A;  5IU1 A;  3Q7V B;  3WS1 A;  5GL9 A;  5M19 A;  5KIZ A;  1XXM A;  5HD3 A;  1OTB A;  2ZC4 B;  4RVA A;  2ZM0 A;  1SZV A;  3EGD C;  1ERO A;  3DW0 A;  3ZVT A;  4PPR A;  5F68 A;  2ZQD A;  5F1F A;  4O0P A;  3DTI A;  4JGQ A;  5FSR A;  3Q1F A;  4FTX A;  3RXW A;  2QJ5 A;  3UPP A;  3HJI A;  3KSH A;  1L0G A;  2WGI A;  4C3Q A;  1YLJ A;  2Y2O A;  1LLB A;  2XFS A;  3MF0 A;  1BSG A;  3QP5 A;  2PR6 A;  2Y2L A;  5FDH A;  1ES2 A;  1S6R A;  2HP5 A;  2ZQ9 A;  2QKP A;  5DJT A;  2XD1 A;  4GHI A;  1P9R A;  4FD8 A;  4N1H A;  2PRF A;  2V0W A;  2Y91 A;  1GSV A;  4GDB A;  3TOI A;  4EU0 A;  1BUL A;  4IHQ A;  1YLP A;  5J7E A;  3S4X A;  2ZBB A;  3BFF A;  3HLW A;  2XFT A;  3LR0 A;  1OT6 A;  1PZO A;  4OPZ A;  4I39 A;  4NXE A;  4HY8 A;  2ZLY A;  2GNX A;  3U4L P;  3BJN A;  3PAE A;  4DKI A;  5FAO A;  3MZD A;  5FQJ A;  3V50 A;  1VHM A;  2B95 A;  4UQI S;  3C7U A;  4S2I A;  3A0R A;  5JYP A;  2QJ7 A;  2BTF P;  4K08 A;  3MBZ A;  1ES5 A;  2KLI A;  4WBG A;  3EQV A;  3WRZ A;  3WS0 A;  5E2G A;  1RGY A;  2ZMV A;  2WKI A;  3DTM A;  5FAQ A;  3C2W A;  3R4K A;  4JF6 A;  4R3J A;  4PM6 A;  5EEC A;  3DWK A;  3RJU A;  2WGW A;  2XLN A;  5E43 A;  1GHP A;  3VSK A;  3JYI A;  4OPQ A;  4BD1 A;  4ZAM A;  5CGS A;  4WLA A;  4EBL A;  1H8Y A;  2ZQC A;  4S2L A;  3IHA A;  1VB6 A;  5EVL A;  5FQ9 A;  3BLM A;  4S2N C;  3ZFZ A;  3UB7 A;  2XRN A;  4NET A;  1TD5 A;  4I3I A;  1ZTU A;  3KO6 A;  2L1M A;  1PWC A;  4JKT A;  1YPR A;  3SS5 A;  2VLG A;  3BQ8 A;  3OPH A;  1U60 A;  3N8L A;  5EV0 A;  3NUL A;  4MNR A;  2RCX A;  3VMA A;  1KGE A;  4WEK A;  2H28 A;  3SOI A;  1T18 A;  3BEB A;  4Q8I A;  4IVK A;  3C4P A;  5FEG A;  4KZ5 A;  3F1O B;  4FOF A;  5FDS A;  2KX6 A;  4AFI A;  2ZM2 A;  4UA7 A;  3CPT B;  2EFX A;  2A24 B;  3H7W A;  1E3U A;  1MWU A;  3E4Q A;  4E04 A;  4KZ7 A;  3VE3 A;  2VZW A;  4LCM A;  2WGW B;  4HHD A;  3VP0 A;  3SZT A;  2L4R A;  4HJ6 A;  5HL1 A;  3PBS A;  3GVB A;  2V0U A;  2PAV P;  3SS4 A;  2AVX A;  4HEF A;  3T4L A;  2E8J A;  2OOL A;  4S2N A;  4P87 A;  1AXB A;  1KDW A;  3KSF A;  5FQI A;  3V39 A;  3FV7 A;  1K55 C;  2L0W A;  2IWB A;  3OCN A;  4U0T A;  4ETX A;  1YM1 A;  3OOV A;  3IF5 A;  4L9G A; 
#chains in the Genus database with same CATH homology
 3MQQ A;  4DN0 A;  1EW0 A;  2P7J A;  4MMN A;  2GX5 A;  3TJZ C;  1V9Y A;  4GW9 A;  3T4O A;  4JGR A;  5F69 A;  1H3Q A;  3G6O A;  4HH3 A;  3IS2 B;  3EGX C;  1KOU A;  3F1P B;  3JVU A;  2LB5 A;  4I38 A;  1G6O A;  3E0Y A;  2XA7 S;  3P01 A;  4KQD A;  3VV4 A;  2A2L A;  4EER A;  2O9C A;  4CLC A;  4OOL A;  4WEJ A;  3OCL A;  4BBT A;  2W1T A;  4GJ4 A;  4B93 A;  4Q0J A;  3MQ0 A;  4BBV A;  2W1R A;  4G3W A;  3T4T A;  1YSQ A;  3PYP A;  3EQU A;  2QYB A;  2G7U A;  2HJ9 C;  3LIF A;  1OT9 A;  2J3T C;  2PYP A;  3K3C A;  1P0Z A;  2INW A;  1H8M A;  4Y3I A;  1OJG A;  4Y5F A;  2OAQ 1;  1W63 M;  3GDI A;  2JKT M;  3RH8 B;  2YKH A;  2I9V A;  2PD7 A;  3E4P A;  3PXP A;  4ARZ B;  3JVV A;  4EQ1 A;  2Z6C A;  2V1A A;  4HP4 A;  3TW8 A;  3LIB A;  3MR0 A;  4HOI A;  5HZH A;  1V9Z A;  2HJE A;  2HV1 A;  2VEA A;  4EEP A;  1LSX A;  3UE3 A;  4H6J B;  4R38 A;  3R7W A;  4CLC D;  4UEY A;  3LR5 A;  2K7S A;  1NLY A;  4HIA A;  4XT2 B;  3KSG A;  1T1C A;  3P7N A;  2M7V A;  2JKR I;  4PHT A;  4LRX C;  3BY8 A;  2WKP A;  3F1O A;  4HJ4 A;  4EXO A;  5J4E A;  2HF6 A;  1F98 A;  2PT7 A;  4RQ9 A;  4XT2 A;  3EEH A;  3ZYT A;  3FPW A;  3DBA A;  2D01 A;  2PR5 A;  5AJG A;  3A0V A;  5A8B A;  1S1Z A;  2PDR A;  3LID A;  4GLQ A;  4BMW A;  3CUE A;  3PBN A;  3ICY A;  4ARZ A;  4GS9 B;  3C30 A;  2PD8 A;  4I3J A;  3OC2 A;  4HI4 A;  3B33 A;  4O01 A;  1IFQ A;  2O99 A;  2OAP 1;  4NXF A;  2J80 A;  3UE6 A;  2XSS A;  1TF1 A;  5HD5 A;  4PAU A;  1T1B A;  2BAS A;  4PKY G;  1NRJ A;  1P9W A;  3T50 A;  4KUO A;  1W63 Q;  3FPV A;  2VX8 A;  3PBQ A;  4P6Z S;  3S7Q A;  2W1T B;  3NJA A;  1ZHH B;  2V1B A;  4MN5 A;  2K31 A;  2W3D A;  1TS7 A;  3TRC A;  4ZRR A;  2PHY A;  4NXB A;  2FZ0 A;  5CX7 A;  1XJ2 A;  4M4X A;  3PBO A;  5DKL A;  3IS2 A;  4YOF A;  2WKR A;  4MN7 A;  3KSI A;  3MFX A;  3LUQ A;  1S4S A;  4L9E A;  4O8G A;  4YNR A;  3NOP C;  3S7O A;  4IUK A;  3NHQ A;  3EOI A;  3T4K A;  1X0O A;  4L0L A;  3RFB A;  3B47 A;  4DJ2 A;  1OTE A;  1Y28 A;  5MC7 A;  4EET B;  1T1A A;  4MDZ A;  1YKD A;  2DMW A;  4KUK A;  5HDD A;  4BJP A;  4CQH A;  5F5Y A;  4FSF A;  4JGP A;  2Y8H A;  4OOM A;  4G3V A;  5HDC A;  2VJW A;  3BWL A;  4LPZ A;  3V67 A;  2R78 A;  2VA0 A;  2ZOH A;  4IUH A;  4I3A A;  3T4S A;  1GSW A;  3CWF A;  2A24 A;  5I5L A;  2QHK A;  1DP8 A;  1UWP X;  1LSW A;  4Y2F A;  1S4R A;  2W27 A;  4CLC E;  3EWK A;  3F1N A;  3CUE C;  3A0S A;  5HPF A;  5TBM A;  3ULF A;  1TS6 A;  3EEA A;  2OWH A;  3BW6 A;  4EUV A;  1S67 L;  1N9L A;  5C5K A;  4IJG A;  3OBF A;  5IU1 A;  4CLC C;  1YAX A;  3ZQ5 A;  1OJ5 A;  3UME A;  4HQA A;  5KIZ A;  3HCY A;  1GSX A;  1TS8 A;  5HD3 A;  1OTB A;  3S7P A;  1JNU A;  3SW1 A;  3EGD C;  3U2A A;  3FC7 A;  2GZA A;  2D02 A;  5AVE A;  2JHE A;  5F68 A;  1S1Y A;  2O0Y A;  4O0P A;  4JGQ A;  4GHI B;  3H82 B;  4II7 A;  4UQI M;  4WUJ A;  3E4O A;  3H7W B;  5DJU A;  2QJ5 A;  3HJI A;  4PKY A;  4GCZ A;  1XJ6 A;  3KSH A;  4ME4 A;  4B9O A;  4R3A A;  2QWS A;  2M1C A;  2GJ3 A;  2ZOI A;  3UB9 A;  2B18 A;  4G3K A;  2VV8 A;  3MF0 A;  5F6A A;  3K3D A;  4WEL A;  3IBJ A;  1P97 A;  3PBR A;  5L8M A;  2B02 A;  2PR6 A;  3CI6 A;  4Q0H A;  5G4Z A;  3MMH A;  5K5B A;  5HWT A;  1UGU A;  2YKF A;  5EFW A;  3R7W B;  2QKP A;  1STZ A;  4JGO A;  4MN6 A;  5DJT A;  4GHI A;  3K2N A;  3KX0 X;  1P9R A;  2Y79 A;  2V0W A;  4HNB A;  1NWZ A;  5FL3 A;  3MXQ A;  3UB6 A;  4F3L B;  3LI8 A;  3LIC A;  2O9A A;  1GSV A;  2W3F A;  5G4Y A;  3LI9 A;  2VGL S;  3LFV A;  3F1P A;  3F1N B;  4MCW A;  2CMN A;  4EU0 A;  5IS1 A;  4IHQ A;  4NEE D;  5J7E A;  3LIA A;  3IBR A;  2ZBB A;  1LT0 A;  4KQO A;  2FH5 A;  3LYX A;  1DP6 A;  4R70 A;  3UMD A;  5LBR A;  1YSP A;  3LR0 A;  1DRM A;  1OT6 A;  2JN7 A;  5J3W A;  4I39 A;  4NXE A;  3VOL A;  4HY8 A;  2GNX A;  3BJN A;  4P6Z M;  2W3G A;  2OWJ A;  5HWV A;  4LRY C;  3NOU C;  1N9O A;  1VHM A;  4UQI S;  2EWV A;  2J3T D;  2VV6 A;  3A0R A;  2VKS A;  2W3H A;  2QJ7 A;  4K08 A;  1OTA A;  2KDK A;  4BWI A;  2KLI A;  3D72 A;  5HSQ A;  3E98 A;  2ZMF A;  3EQV A;  4WN5 A;  1TS0 A;  2ZMV A;  5DF9 A;  3B42 A;  3PR6 A;  3C2W A;  3R4K A;  1XJ4 A;  3VE4 A;  2Z6D A;  4DMZ A;  5HL6 A;  2P08 A;  3LIE A;  1S66 L;  3UB8 A;  4WLA A;  5HDS A;  3C8C A;  3S7N A;  1VB6 A;  1LSV A;  4L9F A;  3H82 A;  3HJK A;  4YWZ A;  2PYR A;  3LR3 A;  2XRN A;  3UB7 A;  4HH2 A;  3O5Y A;  1TD5 A;  3T4Q A;  4I3I A;  4NXG A;  1BYW A;  1F5M A;  1ZTU A;  2IA2 A;  1XFQ A;  3KO6 A;  4EW7 A;  2L1M A;  2MJ6 A;  2NUP C;  2WKQ A;  5KSH A;  1N9N A;  4GS9 A;  4ETZ A;  2VLG A;  3LR4 A;  3BQ8 A;  4F3L A;  1MC0 A;  3C38 A;  3NOT C;  5HWW A;  4Z1W A;  1T19 A;  2P04 A;  3D3O A;  4HP9 A;  4H6J A;  4WEK A;  1DP9 A;  4NKP A;  3T4J A;  4BBU A;  2H28 A;  1T18 A;  1NLZ A;  2M7U A;  1LL8 A;  3KYQ A;  3F1O B;  4I5S A;  4Q0I A;  5TBM B;  3OLO A;  1XJ3 A;  4FOF A;  5DFY A;  4LLO B;  2J3W A;  2KX6 A;  4AFI A;  2EA9 A;  4WF0 A;  4LRZ E;  4L9G A;  2A24 B;  3W2Z A;  3H7W A;  2NUT C;  3FG8 A;  2EWW A;  1OTD A;  2XA7 M;  3BY9 A;  3CLO A;  2XRO A;  1UWN X;  3E4Q A;  3KYZ A;  2O9B A;  1MKM A;  4E04 A;  2K2N A;  4EES A;  4CLC B;  3VE3 A;  1D06 A;  1WA9 A;  3CIT A;  5IT5 A;  2LB9 A;  2VZW A;  4HHD A;  5AVF A;  4HJ3 A;  1OTI A;  1MZU A;  4QPR A;  2L4R A;  3BQA A;  1G28 A;  4HJ6 A;  2KOI A;  3PBS A;  2JKR M;  2V0U A;  4EEU A;  5HPI A;  3T4L A;  5DFX A;  1ODV A;  2VGL M;  2W0N A;  2OOL A;  3CAX A;  5DKK A;  1OPX A;  3MJQ A;  3TE8 A;  2JKT I;  3KSF A;  3RTY A;  1IOU A;  2V9A A;  3GEC A;  4DJ3 A;  1F9I A;  2W3E A;  1D7E A;  4WL9 A;  2L0W A;  3PBT A;  2VV7 A;  2HGV A;  3MQO A;  3PHY A;  3OCN A;  4ETX A;  3OOV A;  3H9W A;  4R6L A;  1XFN A;  5TJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...