4GJ4A

The crystal structure of the soluble guanylate cyclase pas alpha domain from manduca sexta
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
IGVASFAKAFPWHFITDKRLELVQLGAGFMRLFGTHLATHGSSLGTYFRLLRPRGVPLDFREILKRVNTPFMFALKMPGSTALAEGLEIKGQMVFAAESDSLLFVGSPFLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Soluble guanylyl cyclase alpha-1 subunit
publication title Crystal structure of the Alpha subunit PAS domain from soluble guanylyl cyclase.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lyase
total genus 24
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.260 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gj4A00
2P08A 2P04A 4GJ4A
chains in the Genus database with same CATH superfamily
5MC7A 2XQZA 3W4QA 4LV2A 4K08A 4BJPA 1K6SA 3IF6A 2K31A 2HDRA 3M6BA 4UA7A 3BFGA 3MFDA 4Y15A 3NY4A 4KZ9A 4EBLA 3MFXA 2G2WA 5CHUA 3QP6A 2H28A 2R78A 3B33A 1N9NA 1YQSA 3TOIA 4ZJ1A 1F2KA 2J9OA 1I5QA 5CEDA 3V50A 4NXFA 3TG9A 3A0VA 4HBTA 2V0WA 3WWXA 4R0QA 2OV5A 1GHMA 2QYBA 3DW0A 4HP4A 3UDXA 3UNWA 1XXMA 4WEJA 3QP5A 2HDSA 4OQHA 1UWPX 4DDSA 5EM1A 1FOFA 3C38A 4FTXA 4QHCA 3ZVWA 3BEBA 2HP5A 2K2NA 4OQ0A 1YLJA 4BBUA 5KIZA 1W7FA 3T4TA 1O07A 4HIAA 4HY8A 1ZTUA 4MEZA 4HH2A 3ZNYA 1SDNA 3DBAA 3V5MA 3UB6A 5EVIA 4KUKA 3S1YA 1YLTA 4R70A 1NJ4A 1YLWA 3SH9A 4C3QA 4PKYG 1CI8A 4R23A 3T50A 2EFXA 4XXRA 2Q9NA 3BRMA 4Y13A 2C5WB 3EGDC 3KO6A 1KDWA 3R7WA 1L0GA 5TGFA 5L2FA 5DTTA 4CLCB 4LFUA 1PWCA 4X6TA 5U47A 2EX9A 3CJMA 3OZHA 1Q2QA 3ITAA 4R3JA 2W1RA 4ZDXA 3G2ZA 1WYCA 3FKWA 3B47A 1GHIA 5IHVA 3B3XA 3T4SA 3HUNA 3ZCZA 4Y7PA 4B4XA 2HZ5A 4O7DA 2GJ3A 2Q9MA 4XT2B 4Y3IA 1H5XA 4GDNA 3HUOA 3LI8A 1VB6A 3CAXA 2VKSA 3BFCA 1K4EA 5K5BA 2WGWB 5HFOA 3A0RA 4UA6A 4Y0UA 5HWWA 4ETZA 1HLUP 3LCEA 3PHYA 4FD8A 5HL6A 1NWZA 1PZOA 1OJ5A 1YAXA 3TJZC 2QZ6A 5CHJA 4JXWA 3IF5A 2P08A 3HLFA 2CMNA 5DVAA 1TS7A 3KSGA 1PI4A 1GSWA 1JWPA 4PPRA 3IF6C 3DWKA 5DKLA 3IBJA 2EX8A 4RA7A 4KG2A 5BOHA 1DJBA 1S6RA 2UWXA 4JGPA 3UE3A 1J9MA 2H10A 3H9WA 2PBYA 1H8ZA 2HPBA 1YLYA 4K91A 4L9FA 1GHPA 1TDGA 4CLCE 4BD0A 1IEMA 1SDEA 1TS8A 2WKQA 3FKVA 4K0WA 3CPTA 4UQIS 1ES2A 4GOGA 1NRJA 3OCNA 4HH3A 3LIDA 4EQ1A 5FQQA 3EOIA 3ZVTA 2HJ9C 4PM9A 1F5MA 2ZLYA 2WAEA 5GHXA 2Y8HA 2V1AA 1BT5A 1XFQA 4HBUA 3KSIA 1E3UA 3BWLA 4WZ5C 3W2ZA 5FQKA 2GZAA 5GLAA 3VSLA 4DN0A 4YINA 4WELA 3HJIA 4O0PA 3D4FA 4EUVA 2H0TA 4RX3A 1BULA 1S0WA 1Y28A 2HV1A 2P9VB 3FV7A 4GS9A 1OTBA 2Y2QA 2Y55A 3RJUA 5EVIC 2Y4AA 4P6ZS 2XROA 2YKFA 4I3IA 4KZ5A 3H7WB 1U60A 1MWUA 4G3VA 3BECA 4YFMA 2ZQCA 5D3OA 2D01A 3F1OA 1JTGA 4UHUA 5M19A 3C4PA 1GA9A 2BG1A 3VFHA 5GLBA 5KSCA 3G31A 2GDNA 2HF6A 1YT4A 4JLFA 5CRFA 4HOIA 4WYYA 1JNUA 3HLWA 1LHYA 3N8SA 4NXEA 5EV0A 1FR1A 2XD5A 2XEPA 2NUTC 2O9CA 4JF4A 2ZMVA 3IS2A 2I72A 3LICA 3BFDA 2INWA 3V3RA 3G30A 3C5AA 2WADA 1ZC2A 5CTNA 2GNXA 1NLZA 4OONA 4P87A 2ACGA 1GSVA 3SS4A 5KMWA 3PBSA 2EWVA 5HAPA 3PR6A 1NLYA 1YLZA 3O86A 4EXOA 2Z2MB 1EW0A 1ES3A 2B02A 2PRFA 3LEZA 1PW8A 3E98A 1TD5A 3UB7A 2Y2HA 4B9OA 2IA2A 2RL3A 3PAEA 1VETA 4OOMA 5F1GA 4GCZA 4WN5A 3Q81A 3MKEA 3OBFA 4KZBA 1ESUA 4HHDA 3ZG0A 1UWNX 4PM8A 2OWHA 4GW9A 3UPPA 4MN7A 3NDEA 2DMWA 2ZM8A 5HDCA 1IYOA 1BYWA 3MSHA 3E4PA 4KQQA 3ZG8B 4F3LA 4FUWA 2M7UA 4OPYA 2IWCA 3V67A 3VOZA 1BTLA 3N8LA 1KGEA 4ZBEA 1VEUB 4GD6A 3HBRA 5F69A 5A93A 1PZPA 2VGLS 3EQVA 4OH0A 3HLEA 5EVLA 3KYEA 1MKIA 3WS5A 3S7NA 3W4PA 4OOYA 1JWVA 3LYXA 2NUPC 4PHTA 4R4RA 2HP6A 5TR7A 4HNBA 1OTIA 3LI9A 5AVFA 2QWSA 3R4KA 4ZJ2A 1LSWA 3BJNA 5FI2A 5CXWA 3MF0A 1NYYA 1CK3A 3N8RA 5KZHA 2J7VA 2OAP1 2ZC7A 4HQAA 3LEQA 3PBQA 2V0UA 2BASA 1I2SA 2WZZA 2V8FA 1FSYA 2HDQA 3A0SA 5GHZA 2JBFA 4HP9A 3E2LA 4P6ZM 2FH5A 4ESPA 3LR5A 3C7VA 3Q1FA 3TE8A 2GX5A 3E4QA 4JF6A 5G4YA 5HSQA 4GN2A 4H6JB 4KZ3A 3EWKA 3SZTA 1LL9A 3G2YA 3P09A 1E25A 5FASA 2V1ZA 4Z9QA 1ACFA 4LRXC 4IEDA 4DXCA 4YWZA 2VGJA 2XA7S 1ALQA 5HDDA 3DTKA 3IWOA 4MMNA 4X56A 1CEFA 3EEAA 2ZM2A 1IYSA 3GV9A 4MLLA 3H82B 1LSXA 5M1AA 3ZG5A 3S22A 3ZFZA 3UE6A 3MXQA 4MN6A 5AQBA 1HD8A 4EUZA 2Y2PA 5EFWA 4CPKA 5EM0A 1LL8A 1DP8A 5F83A 5HL1A 3P98A 4FSFA 4IVIA 1W8QA 3TSGA 5CEBA 1LLBA 5HWTA 4S2MA 5M18A 1XGJA 1RGYA 4ID4A 4YNRA 1OMEA 2Z6DA 4K0XA 3IWQA 3NULA 2E8IA 2OLUA 4LRYC 2A2LA 4OLDA 3DTMA 1M40A 3S7QA 1K4FA 1P0ZA 5FQJA 3OLOA 1CJFA 3WRTA 4EBPA 1AWIA 1YMSA 3LIAA 3MZDA 3FG8A 1XFNA 4S2KA 4PKYA 5FAOA 5A90A 1DJCA 4CQHA 2X01A 3LGOA 1FR6A 3VP0A 3M6HA 1CI9A 2JKTM 5IT5A 2A3UA 3CITA 1KE0A 1VM1A 3NJAA 3NC8A 4LV1A 1SCWA 4WZ5A 2XH9A 3PXPA 5IS1A 3O88A 1LI0A 4Z1WA 3K2NA 3ULFA 3LIFA 3IF6B 4HJ4A 3T4JA 3PBOA 1YM1A 3P01A 3RTYA 3T1QB 2A49A 1DRMA 3DWZA 5HAQA 4KQDA 4R6LA 4JXGA 2WGVA 2JE5A 2VV6A 1FILA 5TFQA 3UPOA 1FQGA 4EW7A 3VP4A 4KG5A 3ZGAB 1ZG4A 2WZXA 4GJ4A 3OPPA 2A24A 1H3QA 4E6WA 5F68A 3GQZA 4B93A 3M2KA 3D3OA 1LL5A 1Q2PA 3QP8A 4JPMA 4BL2A 4CLCD 3HL9A 3MMHA 4F94A 5CX7A 2WKRA 3HVFA 1JTDA 4FH4A 3M2JA 1JWZA 4GB7A 2V1BA 4KG6A 4KUOA 1WA9A 2PR5A 5C5KA 4NG2A 2XSSA 1G5UA 4ZTKA 5EVIB 3QNBA 4Y0OA 3NDGA 4BMWA 1P9RA 1TDLA 3LO7A 5E43A 4A5RA 4LLOB 4C75A 2ZQ7A 3S4XA 3HLCA 5HD5A 3UMDA 2XA7M 1K54A 4QWOA 1CF0A 3PTEA 1XP4A 4P85A 1DJAA 3RXXA 3R7WB 2ZQ8A 4BWIA 3GR2A 3ZG9B 4DJ2A 3MKFA 2HGVA 2DRWA 1OJGA 2MJ6A 4O01A 3HJKA 3G4PA 5A91A 3IH9A 3MXRA 1RP5A 2PU4A 2H5SA 3IHAA 1ZKJA 4MBHA 4LGWA 1RCJA 1DP6A 2ZBBA 4M4XA 4WUJA 3MS6A 4QY5A 1K56D 4WMCD 2LB5A 1TS0A 2DCFA 3CI6A 3UB8A 4OQGA 2X71A 2L0WA 3CWFA 4PM5A 3CMZA 1TEMA 3EGXC 1Z09A 4ZJ3A 2W3HA 3MJQA 2XR0A 5CECA 2HDUA 1KOUA 3F1NA 5AJGA 3CZDA 3D72A 1AXBA 4N1XA 2PDRA 3WS2A 5A92A 1L2SA 2J8YA 5TBMA 2OSUA 2L1MA 4LPZA 4KZ8A 1SKOA 4IUKA 3HUMA 4UEYA 1LSVA 1KE4A 1S66L 1T1CA 4JGOA 4HJ6A 3MBZA 1ONHA 4CLCC 1F98A 1L0EA 4X1LA 4CJNA 3IX4A 4N9KA 4GDBA 2JKRI 4EQIA 2ZMAA 3G35A 1J3WA 1DY6A 1W63M 2ZC5B 2V8CA 4P6BA 2B5RA 4I38A 3E0YA 1N4OA 3MQ0A 2G7UA 5DFYA 3CPTB 3OPRA 3U4LP 1ZG6A 3MR0A 1ZHHB 2W3EA 1BUEA 3HLBA 2JCHA 3VP2A 1KGFA 1ONGA 2WKHA 4X69A 1S67L 3BY8A 1K55C 1ES5A 4DE2A 2XLNA 4L0LA 1SKOB 3N4IA 5GL9A 3NI9A 4MN5A 4LV0A 4G3KA 4X53A 3CLOA 4II7A 3SH7A 1K0KA 3MZEA 2E8JA 2B18A 4GS9B 1S4SA 3F1PA 2VV8A 2V9AA 1WE4A 3C4OA 3MQOA 1PW1A 5FI6A 2G2UA 2P74A 1PYYA 3FWLA 1K54C 2VLGA 4IJGA 4Y2FA 2VEAA 2W3GA 3KYZA 1MKMA 4ZRRA 1N9BA 5G18A 1Y54A 3LY3A 4NKPA 3F1OB 2O99A 3QP2A 5DTKA 1H8MA 1YPRA 3BM6A 2CC1A 2C6WB 2J3TD 3NIAA 4DXBA 1BZAA 4D2OA 2WKIA 3NECA 1P9WA 1XA7A 3UDIA 4WZ4A 3S7PA 4DKIA 4EESA 5J4EA 3VFFA 2R9XA 1GCEA 4U0TA 2VV7A 1BLCA 1M6KA 1BLSA 3BLMA 2O0YA 3IS2B 2EXAA 5GLCA 3NOPC 5FA7A 3GDIA 1ES4A 5J8XA 4S2OA 1RGZA 3GECA 5E2HA 3FC7A 5FQIA 4DDYA 4B88A 3NOUC 3UPNA 2XF3A 1IYQA 4S2NC 1GA0A 4KZ4A 1C3BA 3IHBA 1EI5A 4UA9A 3ISGA 3HCYA 4C6YA 4S2LA 5FSRA 1EROA 2ZOHA 3Q07A 3UMEA 3QP1A 2J80A 1CQAA 3QNCA 2ZOIA 3Q7VA 1VETB 4S2PA 4UAAA 2BLSA 1Y4OA 4UQIM 3LFVA 1FCOA 4BENA 5FEFA 2YKHA 4BBVA 4GD8A 3IXHA 1IKGA 3UE1A 4GKUA 4JKTA 3K3DA 4E6XA 3C2WA 3ZDJA 3NOTC 2JHEA 2HP9A 4QU3A 2ZL1A 3W4OA 4FOFA 1MZUA 2WGIA 2EXBA 4F3LB 2HJEA 2J3WA 3CG5A 5KSHA 2QJ5A 4DRTA 4U3TA 4NEED 1F9IA 4I3AA 2L4RA 1JVJA 1OTAA 2W27A 3RFBA 3IWIA 2Q0OA 4MNRA 5FQMA 2LB9A 3N7WA 2IWBA 2ZD8A 3T1RA 2RCXA 1TVFA 3B42A 1QMFA 3VP3A 2Y2GA 1PNEA 1I2WA 2W1TA 3ZG7B 2V20A 4EETB 4X1MA 4KENB 4BQMA 5HDSA 4IBXA 1W8YA 4MCWA 2EFUA 3WS0A 1NXYA 4X68A 3P7NA 2QJ7A 3O3VA 1BSGA 2J9PA 4OPZA 1KE3A 1T1BA 3FPWA 1Z6FA 5A8BA 1TS6A 1BLHA 3E2KA 5DJTA 3VE4A 5IU1A 3ZQ5A 1MC0A 3CUEC 5FI7A 4Q8IA 3O5YA 4DE3A 1XPBA 3L9KA 2ZC4B 3BYDA 4KZAA 5DFXA 2KX6A 3NCKA 3Q82A 1VHMA 2PYPA 2PHYA 1MBLA 4E3LA 4I39A 1ERQA 4Y17A 4OKPA 2OOLA 3UB5P 3VMAA 5F82A 2B95A 3UE0A 5AQ7A 2I9VA 5E2EA 3T1XA 1V9YA 5CERA 4O8GA 1D06A 3FZCA 4I5SA 3QP4A 4QB8A 2XGNA 2ZQDA 5AQ9A 1K38A 3GRJA 4EBNA 4E3IA 3K3CA 3SS5A 4IVKA 3KX0X 5HD3A 3RH8B 1NYMA 2JKFA 2VZWA 1XKZA 3OOVA 2Z6CA 1LI9A 3BFEA 1D7EA 3ICYA 1BLPA 4Q0JA 4BLMA 3QHYA 4E3OA 4RYEA 5E2FA 1SZVA 4G3WA 4WEKA 3OC2A 4WM9A 4Y5FA 3EQUA 1HZOA 4S2IA 3AGDA 4WBGA 2VGLM 5HPFA 2WKEA 2H0YA 5F6AA 4MBFA 4QY6A 3LUQA 5FAPA 2D02A 4CLCA 1W79A 3E4OA 2EA9A 3IH8A 1HVBA 1PWGA 3W8KA 5HAIA 5HZHA 4E3NA 3D9YA 4ME4A 1OT6A 1ESIA 3BY9A 1L0FA 5JYPA 3SS3A 1MWTA 1PFLA 1UGUA 4XT2A 3IXBA 3MXSA 2QHKA 1OT9A 5FAQA 3UN7A 4BL3A 4OQIA 3IXDA 4EWFA 3GTCA 2ZQAA 1OPXA 3PAGA 5LBRA 1NZOA 5DF9A 2O9AA 3VE3A 1FIKA 4EEPA 1K55A 2PT7A 1S4RA 2WGWA 2XFTA 4OVDA 2Y2IA 4PMAA 3HREA 1MWSA 5DJUA 2PD8A 1A0KA 3VSKA 4N1HA 4EV4A 3LIBA 3GMWA 4OPQA 5EVEA 1IFQA 4EEUA 1T18A 1KVLA 1K56A 4WMCA 4LV3A 5HWVA 5FATA 5EVID 3IBRA 2EX6A 2FFYA 4RQ9A 5EPHA 1L3LA 2A24B 3UDFA 2OAQ1 3NHQA 4HESA 1KVMA 3C30A 3ZYTA 2ZQ9A 1W5DA 2PD7A 5HPIA 3IX3A 1SHVA 4EERA 3A3IA 4EU0A 4KQRA 2PR6A 4N9LA 3IT9A 3JPUA 4FCFA 3N6IA 2QPNA 4DMZA 1MXOA 5G4ZA 1IKIA 2IWDA 2EX2A 3CHWP 3MZFA 4L9GA 1XJ4A 2Y91A 1YKDA 4Q0HA 3OPHA 2P9VA 1PWDA 2KLIA 4WF0A 3L7HA 1KDSA 3H7WA 2OLVA 1K57A 4S2NA 4Y0TA 2ZC3B 1GSXA 5CGWA 2P7JA 4RVAA 1OTEA 3GSGA 3T4LA 2Y2LA 4R3AA 1PI5A 2FZ0A 2EWWA 5FQ9A 4OOLA 3T4KA 3SW1A 5L8MA 3A3JA 4NETA 1STZA 1X0OA 1N9OA 1G6OA 4QJGA 4H8RA 4PAUA 1CEGA 1XJ2A 4LENA 1NY0A 4MBKA 5I5LA 3BQ8A 2QMIA 4GHIA 3KSHA 2Z2LB 4LCLA 2Y79A 4YOFA 1PRQA 4AFIA 3Q7ZA 4XUZA 4S2JA 4D60A 1XJ3A 3NBLA 3KYQA 4KZ7A 4E3MA 3UB9A 5E2GA 3F1NB 1DP9A 2M1CA 4B4ZA 1YSQA 5EOOA 5F1FA 5TBMB 2Y59A 3MQQA 2W3DA 5EECA 1V9ZA 1XJ6A 3V39A 4LRZE 2R9WA 1MY8A 3LR3A 1T19A 2W3FA 4BD1A 1YMXA 4E04A 3G32A 1E3UD 2OWJA 3T12B 4WL9A 2VA0A 3IXGA 2PAVP 1H8YA 2FFFB 3AGEA 1MWRA 1YLPA 3HLDA 4JBFA 2M7VA 4GHIB 3V3SA 1G28A 2P04A 4JGRA 4OP8A 4ETXA 4R4SA 3OPLA 5J7EA 2ZM0A 1XGIA 2QKPA 4ARZA 3T1SA 3VV4A 2JN7A 3TW8A 1EWZA 3DTEA 2XRNA 5EOEA 5FL3A 3LR4A 3KSFA 4JXVA 4R3BA 1N9LA 3WS1A 2Y2OA 3FPVA 3T4QA 3BQAA 1MPLA 2W0NA 2WYXA 5GLDA 1FCNA 1QMEA 5L10A 1IYPA 4NK3A 3IX8A 4U0XA 1VQQA 3ITBA 5I94A 4KQOA 3C7UA 3G6OA 2XDMA 1SKFA 1XA1A 1VEUA 2JKTI 4HI4A 4DE1A 3F1PB 5AQAA 2BTFP 5J3WA 4DJ3A 3CUEA 1O7EA 4PM6A 4IBRA 1FCMA 5FDSA 4JXSA 5CGXA 1S1YA 4IUHA 3RXWA 4ARZB 3U2AA 1IELA 3G34A 4Q0IA 4QD4A 5HARA 2ZJ9A 2ZMFA 2PBDP 3JVUA 4X25A 1WYBA 1K57C 4E3JA 2PU2A 1ODVA 2JKGA 3T4OA 4FH2A 5CGSA 2JC7A 5EE8A 3I7JA 5EUAA 1E4DA 4BBTA 1LT0A 3BW6A 4HEFA 1G6AA 4PM7A 3VP1A 3A3EA 1G68A 3IQAA 2KDKA 2ZC6B 5JYOA 4L9EA 3EEHA 5L09A 4E3KA 4JGQA 3BLSA 1D1JA 1YSPA 4OLGA 3A3FA 3UO9A 1KGGA 4QPRA 4RX2A 2DNSA 3WS4A 2KOIA 4H6JA 1L0DA 3LY4A 3DTIA 1K6RA 4GZBA 4DF6A 2Y2NA 4NXBA 2J3TC 2Y2MA 3S7OA 1W63Q 1HTZA 3VOYA 5F5YA 2XFSA 5DTSA 1TF1A 1NZUA 5TJJA 1FSWA 3JYIA 4X55A 1S1ZA 4R1GA 2Y2KA 3OCLA 3Q7VB 3PYPA 3A3DA 5AVEA 2AVXA 5DF7A 1PIOA 5FDHA 3UY6A 2WAFA 3H82A 5FEGA 4GLQA 3HLGA 4WLAA 5DKKA 3GVBA 2X02A 2Y2JA 3BFFA 3TRCA 2VJWA 2WUQA 4MDZA 3JVVA 4OP5A 1ERMA 2JKRM 3PBRA 4JF5A 2ZL1B 3FYZA 4HJ3A 2VK3A 5CTMA 3LR0A 4R38A 1K25A 3C8CA 3DAVA 4P0MA 1IOUA 1NRFA 2UV0E 3ZHHA 2VGKA 3SH8A 3AGFA 5L07A 4M3KA 5HW3A 4DE0A 2O9BA 3ZNTA 3VOLA 4NXGA 4OPRA 2PYRA 2WKPA 3SOIA 4ZAMA 2V2FF 3WRZA 3PBNA 3LIEA 1H0MA 5HX9A 4XUXA 2W1TB 5DF8A 2WK0A 4GNUA 4I3JA 1T1AA 2XD1A 1OTDA 4IHQA 4KZ6A 2XK1A 5CHMA 3O87A 4N92A 3PBTA 1XX2A 2K7SA 1P97A 2VX8A 4LCMA 5GHYA
chains in the Genus database with same CATH topology
2A24B 5MC7A 1OTIA 3CLOA 4K08A 4BJPA 3LI9A 2K31A 4II7A 2OAQ1 5AVFA 2QWSA 3R4KA 3NHQA 1LSWA 2B18A 3BJNA 4GS9B 3C30A 1S4SA 3MF0A 3F1PA 3ZYTA 2VV8A 3MFXA 2V9AA 2PD7A 5HPIA 2OAP1 4HQAA 2H28A 4EERA 2R78A 3MQOA 3B33A 3PBQA 4EU0A 2V0UA 2PR6A 1N9NA 2BASA 2VLGA 4NXFA 4IJGA 4Y2FA 3A0SA 3A0VA 2VEAA 2W3GA 3KYZA 1MKMA 2V0WA 4HP9A 4ZRRA 4DMZA 5G4ZA 2QYBA 4HP4A 4NKPA 3F1OB 4P6ZM 2O99A 2FH5A 3LR5A 1H8MA 4WEJA 2J3TD 4L9GA 1UWPX 1XJ4A 1YKDA 4Q0HA 3TE8A 1P9WA 2GX5A 3E4QA 3C38A 2KLIA 5G4YA 4WF0A 5HSQA 2K2NA 3S7PA 4H6JB 3EWKA 3H7WA 4EESA 4BBUA 5J4EA 5KIZA 4LRXC 3T4TA 4HIAA 4HY8A 4YWZA 1GSXA 1ZTUA 2XA7S 2VV7A 4HH2A 5HDDA 2P7JA 3DBAA 4MMNA 1OTEA 3UB6A 2O0YA 3IS2B 3T4LA 4R3AA 4KUKA 2FZ0A 2EWWA 3NOPC 4OOLA 3GDIA 3T4KA 3SW1A 3EEAA 4R70A 5L8MA 3GECA 1STZA 1X0OA 1N9OA 1G6OA 3FC7A 4PKYG 4PAUA 1XJ2A 3T50A 5I5LA 3BQ8A 3H82B 1LSXA 4GHIA 3KSHA 3NOUC 3EGDC 2Y79A 4YOFA 3KO6A 3UE6A 3R7WA 4AFIA 3MXQA 4MN6A 4CLCB 1XJ3A 3KYQA 5EFWA 3UB9A 3HCYA 3F1NB 1DP9A 2M1CA 1LL8A 1YSQA 2ZOHA 2W1RA 1DP8A 3UMEA 2J80A 5TBMB 4FSFA 2ZOIA 3B47A 3T4SA 3MQQA 2W3DA 1V9ZA 4UQIM 3LFVA 2GJ3A 1XJ6A 5HWTA 4LRZE 4XT2B 4Y3IA 2YKHA 3LR3A 1T19A 2W3FA 4YNRA 4BBVA 2Z6DA 4E04A 4LRYC 3LI8A 2A2LA 2OWJA 1VB6A 4WL9A 2VA0A 3K3DA 3CAXA 2VKSA 3C2WA 3S7QA 1P0ZA 3NOTC 2JHEA 5K5BA 2M7VA 3A0RA 5HWWA 3OLOA 4GHIB 4ETZA 1G28A 2P04A 4JGRA 4ETXA 4FOFA 3PHYA 1MZUA 5HL6A 3LIAA 4F3LB 1NWZA 2HJEA 2J3WA 5J7EA 3FG8A 5KSHA 1OJ5A 1YAXA 2QKPA 1XFNA 2QJ5A 4ARZA 4NEED 4PKYA 3TJZC 3VV4A 1F9IA 2JN7A 4I3AA 3TW8A 2L4RA 4CQHA 2W27A 1OTAA 2P08A 2CMNA 1TS7A 3KSGA 2JKTM 1GSWA 2XRNA 5IT5A 5FL3A 3LR4A 3RFBA 3KSFA 5DKLA 3CITA 1N9LA 3IBJA 3FPVA 2LB9A 3NJAA 3T4QA 3BQAA 4JGPA 3UE3A 2W0NA 3H9WA 3PXPA 5IS1A 4L9FA 3B42A 4Z1WA 3K2NA 4CLCE 4KQOA 3ULFA 3G6OA 3LIFA 2WKQA 1TS8A 4HJ4A 3T4JA 3PBOA 4UQIS 4HI4A 2JKTI 2W1TA 3P01A 3RTYA 3F1PB 1NRJA 1DRMA 3OCNA 5J3WA 4DJ3A 4EETB 3CUEA 4HH3A 3LIDA 4EQ1A 4KQDA 4R6LA 3EOIA 2HJ9C 1F5MA 5HDSA 2Y8HA 1S1YA 4IUHA 2V1AA 2VV6A 1XFQA 4MCWA 4ARZB 3U2AA 4Q0IA 3KSIA 3P7NA 2QJ7A 3BWLA 3W2ZA 4EW7A 2ZMFA 2GZAA 3JVUA 4DN0A 4WELA 3HJIA 4GJ4A 4O0PA 1T1BA 2A24A 1H3QA 3FPWA 4EUVA 5A8BA 1ODVA 1TS6A 5F68A 4B93A 5DJTA 3VE4A 3T4OA 2HV1A 1Y28A 4GS9A 5IU1A 1OTBA 3ZQ5A 1MC0A 3CUEC 3D3OA 4P6ZS 3O5YA 2XROA 2YKFA 4I3IA 4CLCD 3MMHA 5CX7A 5DFXA 2WKRA 3H7WB 2KX6A 1VHMA 4BBTA 2PYPA 2PHYA 4I39A 1LT0A 3BW6A 2V1BA 4G3VA 2OOLA 4KUOA 1WA9A 2PR5A 5C5KA 2XSSA 2D01A 2KDKA 3F1OA 4BMWA 2I9VA 4L9EA 3EEHA 1P9RA 4JGQA 1V9YA 4O8GA 4LLOB 1D06A 1YSPA 5HD5A 4I5SA 3UMDA 2XA7M 2HF6A 4QPRA 2KOIA 3K3CA 4H6JA 4HOIA 3KX0X 5HD3A 1JNUA 3R7WB 3RH8B 2VZWA 4NXEA 4BWIA 4NXBA 2J3TC 3OOVA 2Z6CA 3S7OA 4DJ2A 1W63Q 2HGVA 2NUTC 5F5YA 2O9CA 1TF1A 5TJJA 1OJGA 1D7EA 2ZMVA 3ICYA 2MJ6A 3IS2A 3LICA 4Q0JA 2INWA 1S1ZA 4O01A 3HJKA 3OCLA 4G3WA 4WEKA 3PYPA 5AVEA 3OC2A 2GNXA 1NLZA 4Y5FA 3EQUA 1GSVA 1DP6A 2ZBBA 3PBSA 2EWVA 4M4XA 4WUJA 3H82A 2VGLM 5HPFA 4GLQA 3PR6A 2LB5A 4WLAA 5DKKA 1NLYA 1TS0A 5F6AA 3CI6A 3UB8A 2L0WA 3CWFA 3LUQA 4EXOA 2D02A 3TRCA 2VJWA 3EGXC 4CLCA 1EW0A 3E4OA 2W3HA 2EA9A 3MJQA 4MDZA 2B02A 1KOUA 3JVVA 3F1NA 5AJGA 3D72A 2JKRM 3PBRA 5HZHA 3E98A 2PDRA 4HJ3A 1TD5A 4ME4A 3UB7A 4B9OA 5TBMA 2IA2A 1OT6A 3BY9A 3LR0A 4OOMA 4GCZA 2L1MA 4LPZA 4R38A 4WN5A 3C8CA 3OBFA 1UGUA 4XT2A 1IOUA 4IUKA 4HHDA 2QHKA 1OT9A 1LSVA 4UEYA 1S66L 1T1CA 1UWNX 4JGOA 4HJ6A 4CLCC 1OPXA 1F98A 5LBRA 2OWHA 4GW9A 4MN7A 5DF9A 2JKRI 2O9AA 2O9BA 3VE3A 2DMWA 4EEPA 2PT7A 1S4RA 3VOLA 5HDCA 1W63M 1BYWA 4NXGA 3E4PA 2PYRA 2WKPA 4F3LA 4I38A 3E0YA 2M7UA 5DJUA 2PD8A 3MQ0A 3PBNA 3V67A 2G7UA 3LIEA 5DFYA 2W1TB 3LIBA 5F69A 2VGLS 3MR0A 3EQVA 4I3JA 1T1AA 1ZHHB 1IFQA 2W3EA 4EEUA 1OTDA 4IHQA 1T18A 5HWVA 3S7NA 3IBRA 1S67L 3BY8A 3LYXA 2NUPC 4PHTA 3PBTA 4L0LA 2K7SA 1P97A 4HNBA 4RQ9A 4MN5A 2VX8A 4G3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P08 A;  2P04 A;  4GJ4 A; 
#chains in the Genus database with same CATH topology
 5MC7 A;  2XQZ A;  3W4Q A;  4LV2 A;  4K08 A;  4BJP A;  1K6S A;  3IF6 A;  2K31 A;  2HDR A;  3M6B A;  4UA7 A;  3BFG A;  3MFD A;  4Y15 A;  3NY4 A;  4KZ9 A;  4EBL A;  3MFX A;  2G2W A;  5CHU A;  3QP6 A;  2H28 A;  2R78 A;  3B33 A;  1N9N A;  1YQS A;  3TOI A;  4ZJ1 A;  1F2K A;  2J9O A;  1I5Q A;  5CED A;  3V50 A;  4NXF A;  3TG9 A;  3A0V A;  4HBT A;  2V0W A;  3WWX A;  4R0Q A;  2OV5 A;  1GHM A;  2QYB A;  3DW0 A;  4HP4 A;  3UDX A;  3UNW A;  1XXM A;  4WEJ A;  3QP5 A;  2HDS A;  4OQH A;  1UWP X;  4DDS A;  5EM1 A;  1FOF A;  3C38 A;  4FTX A;  4QHC A;  3ZVW A;  3BEB A;  2HP5 A;  2K2N A;  4OQ0 A;  1YLJ A;  4BBU A;  5KIZ A;  1W7F A;  3T4T A;  1O07 A;  4HIA A;  4HY8 A;  1ZTU A;  4MEZ A;  4HH2 A;  3ZNY A;  1SDN A;  3DBA A;  3V5M A;  3UB6 A;  5EVI A;  4KUK A;  3S1Y A;  1YLT A;  4R70 A;  1NJ4 A;  1YLW A;  3SH9 A;  4C3Q A;  4PKY G;  1CI8 A;  4R23 A;  3T50 A;  2EFX A;  4XXR A;  2Q9N A;  3BRM A;  4Y13 A;  2C5W B;  3EGD C;  3KO6 A;  1KDW A;  3R7W A;  1L0G A;  5TGF A;  5L2F A;  5DTT A;  4CLC B;  4LFU A;  1PWC A;  4X6T A;  5U47 A;  2EX9 A;  3CJM A;  3OZH A;  1Q2Q A;  3ITA A;  4R3J A;  2W1R A;  4ZDX A;  3G2Z A;  1WYC A;  3FKW A;  3B47 A;  1GHI A;  5IHV A;  3B3X A;  3T4S A;  3HUN A;  3ZCZ A;  4Y7P A;  4B4X A;  2HZ5 A;  4O7D A;  2GJ3 A;  2Q9M A;  4XT2 B;  4Y3I A;  1H5X A;  4GDN A;  3HUO A;  3LI8 A;  1VB6 A;  3CAX A;  2VKS A;  3BFC A;  1K4E A;  5K5B A;  2WGW B;  5HFO A;  3A0R A;  4UA6 A;  4Y0U A;  5HWW A;  4ETZ A;  1HLU P;  3LCE A;  3PHY A;  4FD8 A;  5HL6 A;  1NWZ A;  1PZO A;  1OJ5 A;  1YAX A;  3TJZ C;  2QZ6 A;  5CHJ A;  4JXW A;  3IF5 A;  2P08 A;  3HLF A;  2CMN A;  5DVA A;  1TS7 A;  3KSG A;  1PI4 A;  1GSW A;  1JWP A;  4PPR A;  3IF6 C;  3DWK A;  5DKL A;  3IBJ A;  2EX8 A;  4RA7 A;  4KG2 A;  5BOH A;  1DJB A;  1S6R A;  2UWX A;  4JGP A;  3UE3 A;  1J9M A;  2H10 A;  3H9W A;  2PBY A;  1H8Z A;  2HPB A;  1YLY A;  4K91 A;  4L9F A;  1GHP A;  1TDG A;  4CLC E;  4BD0 A;  1IEM A;  1SDE A;  1TS8 A;  2WKQ A;  3FKV A;  4K0W A;  3CPT A;  4UQI S;  1ES2 A;  4GOG A;  1NRJ A;  3OCN A;  4HH3 A;  3LID A;  4EQ1 A;  5FQQ A;  3EOI A;  3ZVT A;  2HJ9 C;  4PM9 A;  1F5M A;  2ZLY A;  2WAE A;  5GHX A;  2Y8H A;  2V1A A;  1BT5 A;  1XFQ A;  4HBU A;  3KSI A;  1E3U A;  3BWL A;  4WZ5 C;  3W2Z A;  5FQK A;  2GZA A;  5GLA A;  3VSL A;  4DN0 A;  4YIN A;  4WEL A;  3HJI A;  4O0P A;  3D4F A;  4EUV A;  2H0T A;  4RX3 A;  1BUL A;  1S0W A;  1Y28 A;  2HV1 A;  2P9V B;  3FV7 A;  4GS9 A;  1OTB A;  2Y2Q A;  2Y55 A;  3RJU A;  5EVI C;  2Y4A A;  4P6Z S;  2XRO A;  2YKF A;  4I3I A;  4KZ5 A;  3H7W B;  1U60 A;  1MWU A;  4G3V A;  3BEC A;  4YFM A;  2ZQC A;  5D3O A;  2D01 A;  3F1O A;  1JTG A;  4UHU A;  5M19 A;  3C4P A;  1GA9 A;  2BG1 A;  3VFH A;  5GLB A;  5KSC A;  3G31 A;  2GDN A;  2HF6 A;  1YT4 A;  4JLF A;  5CRF A;  4HOI A;  4WYY A;  1JNU A;  3HLW A;  1LHY A;  3N8S A;  4NXE A;  5EV0 A;  1FR1 A;  2XD5 A;  2XEP A;  2NUT C;  2O9C A;  4JF4 A;  2ZMV A;  3IS2 A;  2I72 A;  3LIC A;  3BFD A;  2INW A;  3V3R A;  3G30 A;  3C5A A;  2WAD A;  1ZC2 A;  5CTN A;  2GNX A;  1NLZ A;  4OON A;  4P87 A;  2ACG A;  1GSV A;  3SS4 A;  5KMW A;  3PBS A;  2EWV A;  5HAP A;  3PR6 A;  1NLY A;  1YLZ A;  3O86 A;  4EXO A;  2Z2M B;  1EW0 A;  1ES3 A;  2B02 A;  2PRF A;  3LEZ A;  1PW8 A;  3E98 A;  1TD5 A;  3UB7 A;  2Y2H A;  4B9O A;  2IA2 A;  2RL3 A;  3PAE A;  1VET A;  4OOM A;  5F1G A;  4GCZ A;  4WN5 A;  3Q81 A;  3MKE A;  3OBF A;  4KZB A;  1ESU A;  4HHD A;  3ZG0 A;  1UWN X;  4PM8 A;  2OWH A;  4GW9 A;  3UPP A;  4MN7 A;  3NDE A;  2DMW A;  2ZM8 A;  5HDC A;  1IYO A;  1BYW A;  3MSH A;  3E4P A;  4KQQ A;  3ZG8 B;  4F3L A;  4FUW A;  2M7U A;  4OPY A;  2IWC A;  3V67 A;  3VOZ A;  1BTL A;  3N8L A;  1KGE A;  4ZBE A;  1VEU B;  4GD6 A;  3HBR A;  5F69 A;  5A93 A;  1PZP A;  2VGL S;  3EQV A;  4OH0 A;  3HLE A;  5EVL A;  3KYE A;  1MKI A;  3WS5 A;  3S7N A;  3W4P A;  4OOY A;  1JWV A;  3LYX A;  2NUP C;  4PHT A;  4R4R A;  2HP6 A;  5TR7 A;  4HNB A;  1OTI A;  3LI9 A;  5AVF A;  2QWS A;  3R4K A;  4ZJ2 A;  1LSW A;  3BJN A;  5FI2 A;  5CXW A;  3MF0 A;  1NYY A;  1CK3 A;  3N8R A;  5KZH A;  2J7V A;  2OAP 1;  2ZC7 A;  4HQA A;  3LEQ A;  3PBQ A;  2V0U A;  2BAS A;  1I2S A;  2WZZ A;  2V8F A;  1FSY A;  2HDQ A;  3A0S A;  5GHZ A;  2JBF A;  4HP9 A;  3E2L A;  4P6Z M;  2FH5 A;  4ESP A;  3LR5 A;  3C7V A;  3Q1F A;  3TE8 A;  2GX5 A;  3E4Q A;  4JF6 A;  5G4Y A;  5HSQ A;  4GN2 A;  4H6J B;  4KZ3 A;  3EWK A;  3SZT A;  1LL9 A;  3G2Y A;  3P09 A;  1E25 A;  5FAS A;  2V1Z A;  4Z9Q A;  1ACF A;  4LRX C;  4IED A;  4DXC A;  4YWZ A;  2VGJ A;  2XA7 S;  1ALQ A;  5HDD A;  3DTK A;  3IWO A;  4MMN A;  4X56 A;  1CEF A;  3EEA A;  2ZM2 A;  1IYS A;  3GV9 A;  4MLL A;  3H82 B;  1LSX A;  5M1A A;  3ZG5 A;  3S22 A;  3ZFZ A;  3UE6 A;  3MXQ A;  4MN6 A;  5AQB A;  1HD8 A;  4EUZ A;  2Y2P A;  5EFW A;  4CPK A;  5EM0 A;  1LL8 A;  1DP8 A;  5F83 A;  5HL1 A;  3P98 A;  4FSF A;  4IVI A;  1W8Q A;  3TSG A;  5CEB A;  1LLB A;  5HWT A;  4S2M A;  5M18 A;  1XGJ A;  1RGY A;  4ID4 A;  4YNR A;  1OME A;  2Z6D A;  4K0X A;  3IWQ A;  3NUL A;  2E8I A;  2OLU A;  4LRY C;  2A2L A;  4OLD A;  3DTM A;  1M40 A;  3S7Q A;  1K4F A;  1P0Z A;  5FQJ A;  3OLO A;  1CJF A;  3WRT A;  4EBP A;  1AWI A;  1YMS A;  3LIA A;  3MZD A;  3FG8 A;  1XFN A;  4S2K A;  4PKY A;  5FAO A;  5A90 A;  1DJC A;  4CQH A;  2X01 A;  3LGO A;  1FR6 A;  3VP0 A;  3M6H A;  1CI9 A;  2JKT M;  5IT5 A;  2A3U A;  3CIT A;  1KE0 A;  1VM1 A;  3NJA A;  3NC8 A;  4LV1 A;  1SCW A;  4WZ5 A;  2XH9 A;  3PXP A;  5IS1 A;  3O88 A;  1LI0 A;  4Z1W A;  3K2N A;  3ULF A;  3LIF A;  3IF6 B;  4HJ4 A;  3T4J A;  3PBO A;  1YM1 A;  3P01 A;  3RTY A;  3T1Q B;  2A49 A;  1DRM A;  3DWZ A;  5HAQ A;  4KQD A;  4R6L A;  4JXG A;  2WGV A;  2JE5 A;  2VV6 A;  1FIL A;  5TFQ A;  3UPO A;  1FQG A;  4EW7 A;  3VP4 A;  4KG5 A;  3ZGA B;  1ZG4 A;  2WZX A;  4GJ4 A;  3OPP A;  2A24 A;  1H3Q A;  4E6W A;  5F68 A;  3GQZ A;  4B93 A;  3M2K A;  3D3O A;  1LL5 A;  1Q2P A;  3QP8 A;  4JPM A;  4BL2 A;  4CLC D;  3HL9 A;  3MMH A;  4F94 A;  5CX7 A;  2WKR A;  3HVF A;  1JTD A;  4FH4 A;  3M2J A;  1JWZ A;  4GB7 A;  2V1B A;  4KG6 A;  4KUO A;  1WA9 A;  2PR5 A;  5C5K A;  4NG2 A;  2XSS A;  1G5U A;  4ZTK A;  5EVI B;  3QNB A;  4Y0O A;  3NDG A;  4BMW A;  1P9R A;  1TDL A;  3LO7 A;  5E43 A;  4A5R A;  4LLO B;  4C75 A;  2ZQ7 A;  3S4X A;  3HLC A;  5HD5 A;  3UMD A;  2XA7 M;  1K54 A;  4QWO A;  1CF0 A;  3PTE A;  1XP4 A;  4P85 A;  1DJA A;  3RXX A;  3R7W B;  2ZQ8 A;  4BWI A;  3GR2 A;  3ZG9 B;  4DJ2 A;  3MKF A;  2HGV A;  2DRW A;  1OJG A;  2MJ6 A;  4O01 A;  3HJK A;  3G4P A;  5A91 A;  3IH9 A;  3MXR A;  1RP5 A;  2PU4 A;  2H5S A;  3IHA A;  1ZKJ A;  4MBH A;  4LGW A;  1RCJ A;  1DP6 A;  2ZBB A;  4M4X A;  4WUJ A;  3MS6 A;  4QY5 A;  1K56 D;  4WMC D;  2LB5 A;  1TS0 A;  2DCF A;  3CI6 A;  3UB8 A;  4OQG A;  2X71 A;  2L0W A;  3CWF A;  4PM5 A;  3CMZ A;  1TEM A;  3EGX C;  1Z09 A;  4ZJ3 A;  2W3H A;  3MJQ A;  2XR0 A;  5CEC A;  2HDU A;  1KOU A;  3F1N A;  5AJG A;  3CZD A;  3D72 A;  1AXB A;  4N1X A;  2PDR A;  3WS2 A;  5A92 A;  1L2S A;  2J8Y A;  5TBM A;  2OSU A;  2L1M A;  4LPZ A;  4KZ8 A;  1SKO A;  4IUK A;  3HUM A;  4UEY A;  1LSV A;  1KE4 A;  1S66 L;  1T1C A;  4JGO A;  4HJ6 A;  3MBZ A;  1ONH A;  4CLC C;  1F98 A;  1L0E A;  4X1L A;  4CJN A;  3IX4 A;  4N9K A;  4GDB A;  2JKR I;  4EQI A;  2ZMA A;  3G35 A;  1J3W A;  1DY6 A;  1W63 M;  2ZC5 B;  2V8C A;  4P6B A;  2B5R A;  4I38 A;  3E0Y A;  1N4O A;  3MQ0 A;  2G7U A;  5DFY A;  3CPT B;  3OPR A;  3U4L P;  1ZG6 A;  3MR0 A;  1ZHH B;  2W3E A;  1BUE A;  3HLB A;  2JCH A;  3VP2 A;  1KGF A;  1ONG A;  2WKH A;  4X69 A;  1S67 L;  3BY8 A;  1K55 C;  1ES5 A;  4DE2 A;  2XLN A;  4L0L A;  1SKO B;  3N4I A;  5GL9 A;  3NI9 A;  4MN5 A;  4LV0 A;  4G3K A;  4X53 A;  3CLO A;  4II7 A;  3SH7 A;  1K0K A;  3MZE A;  2E8J A;  2B18 A;  4GS9 B;  1S4S A;  3F1P A;  2VV8 A;  2V9A A;  1WE4 A;  3C4O A;  3MQO A;  1PW1 A;  5FI6 A;  2G2U A;  2P74 A;  1PYY A;  3FWL A;  1K54 C;  2VLG A;  4IJG A;  4Y2F A;  2VEA A;  2W3G A;  3KYZ A;  1MKM A;  4ZRR A;  1N9B A;  5G18 A;  1Y54 A;  3LY3 A;  4NKP A;  3F1O B;  2O99 A;  3QP2 A;  5DTK A;  1H8M A;  1YPR A;  3BM6 A;  2CC1 A;  2C6W B;  2J3T D;  3NIA A;  4DXB A;  1BZA A;  4D2O A;  2WKI A;  3NEC A;  1P9W A;  1XA7 A;  3UDI A;  4WZ4 A;  3S7P A;  4DKI A;  4EES A;  5J4E A;  3VFF A;  2R9X A;  1GCE A;  4U0T A;  2VV7 A;  1BLC A;  1M6K A;  1BLS A;  3BLM A;  2O0Y A;  3IS2 B;  2EXA A;  5GLC A;  3NOP C;  5FA7 A;  3GDI A;  1ES4 A;  5J8X A;  4S2O A;  1RGZ A;  3GEC A;  5E2H A;  3FC7 A;  5FQI A;  4DDY A;  4B88 A;  3NOU C;  3UPN A;  2XF3 A;  1IYQ A;  4S2N C;  1GA0 A;  4KZ4 A;  1C3B A;  3IHB A;  1EI5 A;  4UA9 A;  3ISG A;  3HCY A;  4C6Y A;  4S2L A;  5FSR A;  1ERO A;  2ZOH A;  3Q07 A;  3UME A;  3QP1 A;  2J80 A;  1CQA A;  3QNC A;  2ZOI A;  3Q7V A;  1VET B;  4S2P A;  4UAA A;  2BLS A;  1Y4O A;  4UQI M;  3LFV A;  1FCO A;  4BEN A;  5FEF A;  2YKH A;  4BBV A;  4GD8 A;  3IXH A;  1IKG A;  3UE1 A;  4GKU A;  4JKT A;  3K3D A;  4E6X A;  3C2W A;  3ZDJ A;  3NOT C;  2JHE A;  2HP9 A;  4QU3 A;  2ZL1 A;  3W4O A;  4FOF A;  1MZU A;  2WGI A;  2EXB A;  4F3L B;  2HJE A;  2J3W A;  3CG5 A;  5KSH A;  2QJ5 A;  4DRT A;  4U3T A;  4NEE D;  1F9I A;  4I3A A;  2L4R A;  1JVJ A;  1OTA A;  2W27 A;  3RFB A;  3IWI A;  2Q0O A;  4MNR A;  5FQM A;  2LB9 A;  3N7W A;  2IWB A;  2ZD8 A;  3T1R A;  2RCX A;  1TVF A;  3B42 A;  1QMF A;  3VP3 A;  2Y2G A;  1PNE A;  1I2W A;  2W1T A;  3ZG7 B;  2V20 A;  4EET B;  4X1M A;  4KEN B;  4BQM A;  5HDS A;  4IBX A;  1W8Y A;  4MCW A;  2EFU A;  3WS0 A;  1NXY A;  4X68 A;  3P7N A;  2QJ7 A;  3O3V A;  1BSG A;  2J9P A;  4OPZ A;  1KE3 A;  1T1B A;  3FPW A;  1Z6F A;  5A8B A;  1TS6 A;  1BLH A;  3E2K A;  5DJT A;  3VE4 A;  5IU1 A;  3ZQ5 A;  1MC0 A;  3CUE C;  5FI7 A;  4Q8I A;  3O5Y A;  4DE3 A;  1XPB A;  3L9K A;  2ZC4 B;  3BYD A;  4KZA A;  5DFX A;  2KX6 A;  3NCK A;  3Q82 A;  1VHM A;  2PYP A;  2PHY A;  1MBL A;  4E3L A;  4I39 A;  1ERQ A;  4Y17 A;  4OKP A;  2OOL A;  3UB5 P;  3VMA A;  5F82 A;  2B95 A;  3UE0 A;  5AQ7 A;  2I9V A;  5E2E A;  3T1X A;  1V9Y A;  5CER A;  4O8G A;  1D06 A;  3FZC A;  4I5S A;  3QP4 A;  4QB8 A;  2XGN A;  2ZQD A;  5AQ9 A;  1K38 A;  3GRJ A;  4EBN A;  4E3I A;  3K3C A;  3SS5 A;  4IVK A;  3KX0 X;  5HD3 A;  3RH8 B;  1NYM A;  2JKF A;  2VZW A;  1XKZ A;  3OOV A;  2Z6C A;  1LI9 A;  3BFE A;  1D7E A;  3ICY A;  1BLP A;  4Q0J A;  4BLM A;  3QHY A;  4E3O A;  4RYE A;  5E2F A;  1SZV A;  4G3W A;  4WEK A;  3OC2 A;  4WM9 A;  4Y5F A;  3EQU A;  1HZO A;  4S2I A;  3AGD A;  4WBG A;  2VGL M;  5HPF A;  2WKE A;  2H0Y A;  5F6A A;  4MBF A;  4QY6 A;  3LUQ A;  5FAP A;  2D02 A;  4CLC A;  1W79 A;  3E4O A;  2EA9 A;  3IH8 A;  1HVB A;  1PWG A;  3W8K A;  5HAI A;  5HZH A;  4E3N A;  3D9Y A;  4ME4 A;  1OT6 A;  1ESI A;  3BY9 A;  1L0F A;  5JYP A;  3SS3 A;  1MWT A;  1PFL A;  1UGU A;  4XT2 A;  3IXB A;  3MXS A;  2QHK A;  1OT9 A;  5FAQ A;  3UN7 A;  4BL3 A;  4OQI A;  3IXD A;  4EWF A;  3GTC A;  2ZQA A;  1OPX A;  3PAG A;  5LBR A;  1NZO A;  5DF9 A;  2O9A A;  3VE3 A;  1FIK A;  4EEP A;  1K55 A;  2PT7 A;  1S4R A;  2WGW A;  2XFT A;  4OVD A;  2Y2I A;  4PMA A;  3HRE A;  1MWS A;  5DJU A;  2PD8 A;  1A0K A;  3VSK A;  4N1H A;  4EV4 A;  3LIB A;  3GMW A;  4OPQ A;  5EVE A;  1IFQ A;  4EEU A;  1T18 A;  1KVL A;  1K56 A;  4WMC A;  4LV3 A;  5HWV A;  5FAT A;  5EVI D;  3IBR A;  2EX6 A;  2FFY A;  4RQ9 A;  5EPH A;  1L3L A;  2A24 B;  3UDF A;  2OAQ 1;  3NHQ A;  4HES A;  1KVM A;  3C30 A;  3ZYT A;  2ZQ9 A;  1W5D A;  2PD7 A;  5HPI A;  3IX3 A;  1SHV A;  4EER A;  3A3I A;  4EU0 A;  4KQR A;  2PR6 A;  4N9L A;  3IT9 A;  3JPU A;  4FCF A;  3N6I A;  2QPN A;  4DMZ A;  1MXO A;  5G4Z A;  1IKI A;  2IWD A;  2EX2 A;  3CHW P;  3MZF A;  4L9G A;  1XJ4 A;  2Y91 A;  1YKD A;  4Q0H A;  3OPH A;  2P9V A;  1PWD A;  2KLI A;  4WF0 A;  3L7H A;  1KDS A;  3H7W A;  2OLV A;  1K57 A;  4S2N A;  4Y0T A;  2ZC3 B;  1GSX A;  5CGW A;  2P7J A;  4RVA A;  1OTE A;  3GSG A;  3T4L A;  2Y2L A;  4R3A A;  1PI5 A;  2FZ0 A;  2EWW A;  5FQ9 A;  4OOL A;  3T4K A;  3SW1 A;  5L8M A;  3A3J A;  4NET A;  1STZ A;  1X0O A;  1N9O A;  1G6O A;  4QJG A;  4H8R A;  4PAU A;  1CEG A;  1XJ2 A;  4LEN A;  1NY0 A;  4MBK A;  5I5L A;  3BQ8 A;  2QMI A;  4GHI A;  3KSH A;  2Z2L B;  4LCL A;  2Y79 A;  4YOF A;  1PRQ A;  4AFI A;  3Q7Z A;  4XUZ A;  4S2J A;  4D60 A;  1XJ3 A;  3NBL A;  3KYQ A;  4KZ7 A;  4E3M A;  3UB9 A;  5E2G A;  3F1N B;  1DP9 A;  2M1C A;  4B4Z A;  1YSQ A;  5EOO A;  5F1F A;  5TBM B;  2Y59 A;  3MQQ A;  2W3D A;  5EEC A;  1V9Z A;  1XJ6 A;  3V39 A;  4LRZ E;  2R9W A;  1MY8 A;  3LR3 A;  1T19 A;  2W3F A;  4BD1 A;  1YMX A;  4E04 A;  3G32 A;  1E3U D;  2OWJ A;  3T12 B;  4WL9 A;  2VA0 A;  3IXG A;  2PAV P;  1H8Y A;  2FFF B;  3AGE A;  1MWR A;  1YLP A;  3HLD A;  4JBF A;  2M7V A;  4GHI B;  3V3S A;  1G28 A;  2P04 A;  4JGR A;  4OP8 A;  4ETX A;  4R4S A;  3OPL A;  5J7E A;  2ZM0 A;  1XGI A;  2QKP A;  4ARZ A;  3T1S A;  3VV4 A;  2JN7 A;  3TW8 A;  1EWZ A;  3DTE A;  2XRN A;  5EOE A;  5FL3 A;  3LR4 A;  3KSF A;  4JXV A;  4R3B A;  1N9L A;  3WS1 A;  2Y2O A;  3FPV A;  3T4Q A;  3BQA A;  1MPL A;  2W0N A;  2WYX A;  5GLD A;  1FCN A;  1QME A;  5L10 A;  1IYP A;  4NK3 A;  3IX8 A;  4U0X A;  1VQQ A;  3ITB A;  5I94 A;  4KQO A;  3C7U A;  3G6O A;  2XDM A;  1SKF A;  1XA1 A;  1VEU A;  2JKT I;  4HI4 A;  4DE1 A;  3F1P B;  5AQA A;  2BTF P;  5J3W A;  4DJ3 A;  3CUE A;  1O7E A;  4PM6 A;  4IBR A;  1FCM A;  5FDS A;  4JXS A;  5CGX A;  1S1Y A;  4IUH A;  3RXW A;  4ARZ B;  3U2A A;  1IEL A;  3G34 A;  4Q0I A;  4QD4 A;  5HAR A;  2ZJ9 A;  2ZMF A;  2PBD P;  3JVU A;  4X25 A;  1WYB A;  1K57 C;  4E3J A;  2PU2 A;  1ODV A;  2JKG A;  3T4O A;  4FH2 A;  5CGS A;  2JC7 A;  5EE8 A;  3I7J A;  5EUA A;  1E4D A;  4BBT A;  1LT0 A;  3BW6 A;  4HEF A;  1G6A A;  4PM7 A;  3VP1 A;  3A3E A;  1G68 A;  3IQA A;  2KDK A;  2ZC6 B;  5JYO A;  4L9E A;  3EEH A;  5L09 A;  4E3K A;  4JGQ A;  3BLS A;  1D1J A;  1YSP A;  4OLG A;  3A3F A;  3UO9 A;  1KGG A;  4QPR A;  4RX2 A;  2DNS A;  3WS4 A;  2KOI A;  4H6J A;  1L0D A;  3LY4 A;  3DTI A;  1K6R A;  4GZB A;  4DF6 A;  2Y2N A;  4NXB A;  2J3T C;  2Y2M A;  3S7O A;  1W63 Q;  1HTZ A;  3VOY A;  5F5Y A;  2XFS A;  5DTS A;  1TF1 A;  1NZU A;  5TJJ A;  1FSW A;  3JYI A;  4X55 A;  1S1Z A;  4R1G A;  2Y2K A;  3OCL A;  3Q7V B;  3PYP A;  3A3D A;  5AVE A;  2AVX A;  5DF7 A;  1PIO A;  5FDH A;  3UY6 A;  2WAF A;  3H82 A;  5FEG A;  4GLQ A;  3HLG A;  4WLA A;  5DKK A;  3GVB A;  2X02 A;  2Y2J A;  3BFF A;  3TRC A;  2VJW A;  2WUQ A;  4MDZ A;  3JVV A;  4OP5 A;  1ERM A;  2JKR M;  3PBR A;  4JF5 A;  2ZL1 B;  3FYZ A;  4HJ3 A;  2VK3 A;  5CTM A;  3LR0 A;  4R38 A;  1K25 A;  3C8C A;  3DAV A;  4P0M A;  1IOU A;  1NRF A;  2UV0 E;  3ZHH A;  2VGK A;  3SH8 A;  3AGF A;  5L07 A;  4M3K A;  5HW3 A;  4DE0 A;  2O9B A;  3ZNT A;  3VOL A;  4NXG A;  4OPR A;  2PYR A;  2WKP A;  3SOI A;  4ZAM A;  2V2F F;  3WRZ A;  3PBN A;  3LIE A;  1H0M A;  5HX9 A;  4XUX A;  2W1T B;  5DF8 A;  2WK0 A;  4GNU A;  4I3J A;  1T1A A;  2XD1 A;  1OTD A;  4IHQ A;  4KZ6 A;  2XK1 A;  5CHM A;  3O87 A;  4N92 A;  3PBT A;  1XX2 A;  2K7S A;  1P97 A;  2VX8 A;  4LCM A;  5GHY A; 
#chains in the Genus database with same CATH homology
 2A24 B;  5MC7 A;  1OTI A;  3CLO A;  4K08 A;  4BJP A;  3LI9 A;  2K31 A;  4II7 A;  2OAQ 1;  5AVF A;  2QWS A;  3R4K A;  3NHQ A;  1LSW A;  2B18 A;  3BJN A;  4GS9 B;  3C30 A;  1S4S A;  3MF0 A;  3F1P A;  3ZYT A;  2VV8 A;  3MFX A;  2V9A A;  2PD7 A;  5HPI A;  2OAP 1;  4HQA A;  2H28 A;  4EER A;  2R78 A;  3MQO A;  3B33 A;  3PBQ A;  4EU0 A;  2V0U A;  2PR6 A;  1N9N A;  2BAS A;  2VLG A;  4NXF A;  4IJG A;  4Y2F A;  3A0S A;  3A0V A;  2VEA A;  2W3G A;  3KYZ A;  1MKM A;  2V0W A;  4HP9 A;  4ZRR A;  4DMZ A;  5G4Z A;  2QYB A;  4HP4 A;  4NKP A;  3F1O B;  4P6Z M;  2O99 A;  2FH5 A;  3LR5 A;  1H8M A;  4WEJ A;  2J3T D;  4L9G A;  1UWP X;  1XJ4 A;  1YKD A;  4Q0H A;  3TE8 A;  1P9W A;  2GX5 A;  3E4Q A;  3C38 A;  2KLI A;  5G4Y A;  4WF0 A;  5HSQ A;  2K2N A;  3S7P A;  4H6J B;  3EWK A;  3H7W A;  4EES A;  4BBU A;  5J4E A;  5KIZ A;  4LRX C;  3T4T A;  4HIA A;  4HY8 A;  4YWZ A;  1GSX A;  1ZTU A;  2XA7 S;  2VV7 A;  4HH2 A;  5HDD A;  2P7J A;  3DBA A;  4MMN A;  1OTE A;  3UB6 A;  2O0Y A;  3IS2 B;  3T4L A;  4R3A A;  4KUK A;  2FZ0 A;  2EWW A;  3NOP C;  4OOL A;  3GDI A;  3T4K A;  3SW1 A;  3EEA A;  4R70 A;  5L8M A;  3GEC A;  1STZ A;  1X0O A;  1N9O A;  1G6O A;  3FC7 A;  4PKY G;  4PAU A;  1XJ2 A;  3T50 A;  5I5L A;  3BQ8 A;  3H82 B;  1LSX A;  4GHI A;  3KSH A;  3NOU C;  3EGD C;  2Y79 A;  4YOF A;  3KO6 A;  3UE6 A;  3R7W A;  4AFI A;  3MXQ A;  4MN6 A;  4CLC B;  1XJ3 A;  3KYQ A;  5EFW A;  3UB9 A;  3HCY A;  3F1N B;  1DP9 A;  2M1C A;  1LL8 A;  1YSQ A;  2ZOH A;  2W1R A;  1DP8 A;  3UME A;  2J80 A;  5TBM B;  4FSF A;  2ZOI A;  3B47 A;  3T4S A;  3MQQ A;  2W3D A;  1V9Z A;  4UQI M;  3LFV A;  2GJ3 A;  1XJ6 A;  5HWT A;  4LRZ E;  4XT2 B;  4Y3I A;  2YKH A;  3LR3 A;  1T19 A;  2W3F A;  4YNR A;  4BBV A;  2Z6D A;  4E04 A;  4LRY C;  3LI8 A;  2A2L A;  2OWJ A;  1VB6 A;  4WL9 A;  2VA0 A;  3K3D A;  3CAX A;  2VKS A;  3C2W A;  3S7Q A;  1P0Z A;  3NOT C;  2JHE A;  5K5B A;  2M7V A;  3A0R A;  5HWW A;  3OLO A;  4GHI B;  4ETZ A;  1G28 A;  2P04 A;  4JGR A;  4ETX A;  4FOF A;  3PHY A;  1MZU A;  5HL6 A;  3LIA A;  4F3L B;  1NWZ A;  2HJE A;  2J3W A;  5J7E A;  3FG8 A;  5KSH A;  1OJ5 A;  1YAX A;  2QKP A;  1XFN A;  2QJ5 A;  4ARZ A;  4NEE D;  4PKY A;  3TJZ C;  3VV4 A;  1F9I A;  2JN7 A;  4I3A A;  3TW8 A;  2L4R A;  4CQH A;  2W27 A;  1OTA A;  2P08 A;  2CMN A;  1TS7 A;  3KSG A;  2JKT M;  1GSW A;  2XRN A;  5IT5 A;  5FL3 A;  3LR4 A;  3RFB A;  3KSF A;  5DKL A;  3CIT A;  1N9L A;  3IBJ A;  3FPV A;  2LB9 A;  3NJA A;  3T4Q A;  3BQA A;  4JGP A;  3UE3 A;  2W0N A;  3H9W A;  3PXP A;  5IS1 A;  4L9F A;  3B42 A;  4Z1W A;  3K2N A;  4CLC E;  4KQO A;  3ULF A;  3G6O A;  3LIF A;  2WKQ A;  1TS8 A;  4HJ4 A;  3T4J A;  3PBO A;  4UQI S;  4HI4 A;  2JKT I;  2W1T A;  3P01 A;  3RTY A;  3F1P B;  1NRJ A;  1DRM A;  3OCN A;  5J3W A;  4DJ3 A;  4EET B;  3CUE A;  4HH3 A;  3LID A;  4EQ1 A;  4KQD A;  4R6L A;  3EOI A;  2HJ9 C;  1F5M A;  5HDS A;  2Y8H A;  1S1Y A;  4IUH A;  2V1A A;  2VV6 A;  1XFQ A;  4MCW A;  4ARZ B;  3U2A A;  4Q0I A;  3KSI A;  3P7N A;  2QJ7 A;  3BWL A;  3W2Z A;  4EW7 A;  2ZMF A;  2GZA A;  3JVU A;  4DN0 A;  4WEL A;  3HJI A;  4GJ4 A;  4O0P A;  1T1B A;  2A24 A;  1H3Q A;  3FPW A;  4EUV A;  5A8B A;  1ODV A;  1TS6 A;  5F68 A;  4B93 A;  5DJT A;  3VE4 A;  3T4O A;  2HV1 A;  1Y28 A;  4GS9 A;  5IU1 A;  1OTB A;  3ZQ5 A;  1MC0 A;  3CUE C;  3D3O A;  4P6Z S;  3O5Y A;  2XRO A;  2YKF A;  4I3I A;  4CLC D;  3MMH A;  5CX7 A;  5DFX A;  2WKR A;  3H7W B;  2KX6 A;  1VHM A;  4BBT A;  2PYP A;  2PHY A;  4I39 A;  1LT0 A;  3BW6 A;  2V1B A;  4G3V A;  2OOL A;  4KUO A;  1WA9 A;  2PR5 A;  5C5K A;  2XSS A;  2D01 A;  2KDK A;  3F1O A;  4BMW A;  2I9V A;  4L9E A;  3EEH A;  1P9R A;  4JGQ A;  1V9Y A;  4O8G A;  4LLO B;  1D06 A;  1YSP A;  5HD5 A;  4I5S A;  3UMD A;  2XA7 M;  2HF6 A;  4QPR A;  2KOI A;  3K3C A;  4H6J A;  4HOI A;  3KX0 X;  5HD3 A;  1JNU A;  3R7W B;  3RH8 B;  2VZW A;  4NXE A;  4BWI A;  4NXB A;  2J3T C;  3OOV A;  2Z6C A;  3S7O A;  4DJ2 A;  1W63 Q;  2HGV A;  2NUT C;  5F5Y A;  2O9C A;  1TF1 A;  5TJJ A;  1OJG A;  1D7E A;  2ZMV A;  3ICY A;  2MJ6 A;  3IS2 A;  3LIC A;  4Q0J A;  2INW A;  1S1Z A;  4O01 A;  3HJK A;  3OCL A;  4G3W A;  4WEK A;  3PYP A;  5AVE A;  3OC2 A;  2GNX A;  1NLZ A;  4Y5F A;  3EQU A;  1GSV A;  1DP6 A;  2ZBB A;  3PBS A;  2EWV A;  4M4X A;  4WUJ A;  3H82 A;  2VGL M;  5HPF A;  4GLQ A;  3PR6 A;  2LB5 A;  4WLA A;  5DKK A;  1NLY A;  1TS0 A;  5F6A A;  3CI6 A;  3UB8 A;  2L0W A;  3CWF A;  3LUQ A;  4EXO A;  2D02 A;  3TRC A;  2VJW A;  3EGX C;  4CLC A;  1EW0 A;  3E4O A;  2W3H A;  2EA9 A;  3MJQ A;  4MDZ A;  2B02 A;  1KOU A;  3JVV A;  3F1N A;  5AJG A;  3D72 A;  2JKR M;  3PBR A;  5HZH A;  3E98 A;  2PDR A;  4HJ3 A;  1TD5 A;  4ME4 A;  3UB7 A;  4B9O A;  5TBM A;  2IA2 A;  1OT6 A;  3BY9 A;  3LR0 A;  4OOM A;  4GCZ A;  2L1M A;  4LPZ A;  4R38 A;  4WN5 A;  3C8C A;  3OBF A;  1UGU A;  4XT2 A;  1IOU A;  4IUK A;  4HHD A;  2QHK A;  1OT9 A;  1LSV A;  4UEY A;  1S66 L;  1T1C A;  1UWN X;  4JGO A;  4HJ6 A;  4CLC C;  1OPX A;  1F98 A;  5LBR A;  2OWH A;  4GW9 A;  4MN7 A;  5DF9 A;  2JKR I;  2O9A A;  2O9B A;  3VE3 A;  2DMW A;  4EEP A;  2PT7 A;  1S4R A;  3VOL A;  5HDC A;  1W63 M;  1BYW A;  4NXG A;  3E4P A;  2PYR A;  2WKP A;  4F3L A;  4I38 A;  3E0Y A;  2M7U A;  5DJU A;  2PD8 A;  3MQ0 A;  3PBN A;  3V67 A;  2G7U A;  3LIE A;  5DFY A;  2W1T B;  3LIB A;  5F69 A;  2VGL S;  3MR0 A;  3EQV A;  4I3J A;  1T1A A;  1ZHH B;  1IFQ A;  2W3E A;  4EEU A;  1OTD A;  4IHQ A;  1T18 A;  5HWV A;  3S7N A;  3IBR A;  1S67 L;  3BY8 A;  3LYX A;  2NUP C;  4PHT A;  3PBT A;  4L0L A;  2K7S A;  1P97 A;  4HNB A;  4RQ9 A;  4MN5 A;  2VX8 A;  4G3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...