4GJYA

Jmjd5 in complex with n-oxalylglycine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
228
Chain Sequence
STVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing protein 5
publication title Crystal Structure and Functional Analysis of JMJD5 Indicate an Alternate Specificity and Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 56
structure length 228
sequence length 235
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4gjyA00
3K3NA 2OT7A 2Q8EA 2Q8CA 2GP5A 3PUQA 5FPBA 3N9OA 2W2IA 4EYUA 5FZFA 4BXFA 2VD7A 3UYJA 5FY1A 5FYMA 4CCNA 5F3CA 5F37A 5A7WA 3PUSA 3AL5A 2YPDA 5FUPA 3LD8A 4EZ4A 5F2WA 4CCMA 5FXXA 2XMLA 5FJHA 4CCKA 4EZHA 4HONA 5FZHA 2YBKA 5LW9A 4V2WA 3KV9A 5KR7A 5FZAA 2GP3A 5FZ8A 5E6HA 5FY7A 4V2VA 3K3OA 2OX0A 3N9NA 4ASKA 3U4SA 4QX7A 4DIQA 5F3GA 2XXZA 3KVAA 3K2OA 4UF0A 4XDPA 4D6SA 5FZ9A 5CEHA 5FZ4A 4IGPA 5FZIA 3DXTA 4D6QA 5FP8A 5A7WB 5IVEA 4IGQA 5FYSA 4Y3OA 5FY8A 5FZLA 5IVJA 5IVYA 3PUAA 3AL6A 5FYIA 5FYZA 4QXCA 4CCJA 4XDOA 5FZOA 4HOOA 5ISLA 5F32A 5FYUA 4QU1A 5F5AA 5FZKA 5FBJA 5FZ7A 5FZMA 5FJKA 3NJYA 5FZBA 3N9PA 4AI9A 3PU8A 5FP4A 5FYBA 5F39A 5FYCA 5IVCA 5FZCA 5FYVA 3ZLIA 4AAPA 4QXHA 3OPTA 5FZ0A 2OQ7A 4GJZA 3DXUA 2PXJA 5F3IA 5A7PA 4UF0B 5F5IA 4GD4A 4BU2A 4CCOA 4D6RA 5FPVA 5FY9A 2OQ6A 5LY2A 2YU1A 4Y4RA 5FZ1A 5A7QA 3KVBA 5IVVA 5F2SA 4DO0A 5FPUA 5LWBA 5FY5A 3N9LA 3N9MA 2XDVA 5FY0A 4CCLA 4LIUA 5IVBA 5A3WA 5FWEA 3KV6A 5FP7A 5IW0A 4CSWA 3ZPOA 5A1LA 5A3NA 4LXLA 5LY1A 5A7SA 5FZOB 2YU2A 3PU3A 4LITA 5FXWA 5A7NA 4QX8A 5K4LA 5A1FA 3AVRA 5FY4A 5FZEA 2Q8DA 5FZ3A 4LIVA 5FP9A 4GJYA 5FWJA 4E4HA 5IVFA 5FUNA 3KV4A 5F3EA 4BISA 4GAZA 5A3PA 4Y33A 2OS2A 3OPWA 5FZ6A 5ANQA 4CUGA 5FZGA 2WWJA 3KV5A 3N9QA 5F5CA 5FYYA 1VRBA 5A80A 3AVSA 3RVHA 4URAA 2YBSA 5FV3A 5FXZA 3PURA 4TN7A 4QWNA 5FPAA 3PTRB 5FYTA 3LDBA 5FZDA 2YBPA 2WWUA 5IWFA 5FYHA 2P5BA 3U78A 5FPLA 5A7OA 4NUBA 5A3TA 5FXVA 2XUEA 4IGOA 4QXBA 4C8DA 5FP3A 3PDQA
chains in the Genus database with same CATH superfamily
2Q0AA 2RS11 2C9KA 4FFGA 4XFHA 5SV5A 5JVVA 1OOPB 4FPGA 5LZ6A 1G86A 1CAUB 1S0GA 1BXHA 2ARAA 4OHVA 5H9RA 2Y6LA 1OLRA 2AENA 4B1MA 5FMBA 4DXTA 1PO12 3B01A 4CA9A 1LR5A 2PHRA 1UU6A 3MW2A 1SEFA 3MIEA 1H9PA 2B9UA 1ZRCA 1HW5A 1DFQA 4LLOA 4D3WA 4XUQA 2TBVA 4XXPA 3THCA 1SLLA 4IV3B 1MZ6A 2JD9A 3EO6A 3NWKA 2ZXQA 2WUHA 4L11A 4CZSA 4HK9A 1STMA 1S2EA 3T2QA 1SDWA 1E5RA 2VR4A 3CZJA 1HB3A 1HX6A 2PLV2 1NE6A 4XPVA 5T3NA 2BW8A 1SBDA 3T1LA 4UW3A 2P3JA 1HRV1 1LESA 2V09A 4W50A 1RXGA 3WDYA 1MZFA 3HNBM 2VJXA 2PYTA 1N1TA 1ZA4A 5I0UA 2W95A 1BLZA 1YLLA 1OF4A 2IUWA 2VO5A 4MGQA 4YM1A 5BNOC 2ARCA 1TMF2 2WN2A 1F31A 3B9CA 5A32B 2NLRA 1GKBA 4UW4A 1DYOA 1XNDA 3IWZA 1IG0A 4CDUC 5IUQA 4OQ9A 1QXPA 1QJX2 1RMU1 3C7HA 4CDUA 2PHUA 1GV9A 1ZNPA 4AVTA 2E26A 2PHTA 3ACIA 4QU1A 2JD4A 4ZU5A 4AL9A 4MO3M 5FZBA 4MSVA 4OHZA 3KF3A 2CWMA 3ZN6A 4K1YA 1CAWA 1Q8OA 1F4AA 1W6MA 4FTSA 3PMEA 1RVF3 5K0UB 1OA3A 2XJSA 3POEA 4DS0A 4UW6A 3I2IA 4NIDA 2ZGOA 4IE0A 3LA7A 3T4VA 2WR9A 5C7GA 1PO13 3GBWA 2RJ2A 1DGLA 4W8JA 1AYN2 4DUWA 2GSYA 4JGZB 4XFIA 4XVHA 4FCAA 5IVVA 3RI8A 5F2SA 5JXGA 4M3CE 4ZPIA 5A3WA 2E7QA 2EXKA 2WJSA 5HCHA 5A1LA 4LOTA 3ZYHA 5FO7B 3D3AA 3FFQA 4H7LA 3OY8A 1WW4A 1QIQA 4LIVA 1WW5A 1RUF3 4AG4A 3LE0A 3E97A 2K2SA 3MIHA 1L7LA 5A6XA 4CDWC 5A3PA 5CKNA 5FLIA 4DY3A 3IAQA 4QB2A 1PVC1 4KMQA 5ANQA 4CDWA 1CR7A 1UZWA 1X33A 3HIFA 5KC6A 2VCCA 3POBA 2GNMA 1K5JA 4LQRA 1TMF3 3LIHA 1UIKA 1H8TA 2FDGA 5JSRA 4FP2A 1GZWB 4YZ1A 4JRAA 3KSCA 3GZUC 3PLQA 4M00A 4URAA 1MQTB 2F17A 4LBQA 4Z07A 2DYCA 2Y0IA 3RYRA 5J09A 4QDQA 1QJX3 1KJRA 1FOD3 2FBEA 1HXS3 3OEBA 4XJ9A 4DXSA 1P8JA 2BZDA 3TAYA 2D5FA 2ZEZA 1DU3D 3JQXA 4XFFA 1MS8A 4PF1A 5IJRA 5A3LA 2D3SA 4W6WA 4NAMA 2JENA 4LR4A 3WY6A 2XJVA 5J37A 3VGIA 1KDMA 2W08A 2XJQA 4L97A 1RL3A 1H2MA 2WABA 3UYJA 5FYMA 4QQ2A 1VAMA 2QQWA 1CIYA 1VB2A 3N7JA 2PHXA 3MHZA 3ZFGA 3FZ3A 2R1DA 3I2JA 3NQHA 4DXZA 1IPKA 4GQ7A 5FTTC 5FZHA 5LK5A 5A6ZA 5LW9A 2MEV2 3POFA 3KV9A 3J8F2 2Q1ZB 1AR82 2E9QA 2VBBA 3V65A 1W03A 1UZZA 5JLVA 3SITA 3UL2A 4C91A 5BNPC 4Y1VA 4DRVA 3U4SA 1DGWX 3ZN5A 2VOWA 3DEMA 4QX7A 1XE0A 4CP1A 3LAGA 1DLCA 1W9WA 3VBRC 1PMIA 1MVQA 4FVVA 5FZ9A 5T5OA 3VBRA 4MG2A 2HWF2 1LGCA 4N53B 4NRQA 1OLMA 4I3GA 1JXNA 2J1SA 1OSGA 1UY3A 2A7AA 4M0NA 4GWMA 3HBZA 1ZBE1 4CUAA 4RHV3 4LBQD 1LHWA 4NVPA 5CADA 2UURA 2WO3A 4NR1A 2ZMLA 2FDKA 5JMOA 4BQXA 4GALA 1U5XA 4N43B 1YI7A 1PX4A 2CV6A 2JEMA 5FYZA 3T0BA 4A7KA 2VUDA 1GR3A 3OGRA 3ZSKA 5AFEA 5JXJA 4A42A 1Z0HA 4LO8A 1IKPA 1LU2A 2WKKA 3MFAA 2B9VA 3ACFA 3H1MA 4XMIA 1DCSA 2ZTNA 1RHI2 2WS92 3ZLIA 5FPZA 3OPTA 4XTPA 4AI8A 1X8MA 3LEGA 3FHIB 3B00A 3RQ0A 4GD4A 3ZN4A 5L36A 5FY9A 2BBVA 4QKNA 4FAHA 5HCAA 4Y5Z0 5LY2A 1W99A 4LO7A 4EQVA 1ULOA 5DG1A 1DQ6A 4JHZA 2WNUC 1O4ZA 1TEIA 5AFBA 4WZCA 4GH4C 3QACA 4GWIA 2WNUA 4RR3B 2CGOA 1VMHA 3C3VA 4GH4A 5FP7A 1PM4A 2Q1MA 4PLMA 3LOIA 1GQGA 1PGL1 1F4HA 1JS9A 4JTNA 4MGZE 3HOBA 1HB1A 1WA4A 3VDAA 1JZ5A 5DUVA 2WNOA 3J8F3 1AR71 4AVVA 5FY4A 3U10A 5A6YA 3T0DA 3ZYGA 3DKWA 2J1AA 2VNRA 1PIV2 2XBO2 1BYHA 2IZWA 3IDCB 2ZMKA 1Y4WA 5FUNA 1AHSA 2W92A 1VBA1 4FTEA 3UJQA 1RINA 4OFGA 2Y8KA 4AFCA 1KRIA 4PQ9A 1VRH1 3KV5A 4HKOA 3RFRA 3S5AA 4AHZA 4BK5A 4F3JA 3M3IA 5JOYA 3WV6A 4Q0PA 2PTMA 3VD9A 4Y1ZA 1J1TA 3JD73 4A44A 1JZ4A 3LA3A 2VZSA 3WDUA 4U2AA 4PHZA 4B7KA 1HRI1 5FZDA 3W5MA 3IDBB 4ZHNA 1VJ2A 3WP6A 3VBOB 1KS5A 3VD5A 4IGOA 5DABA 3IPVA 1BEV3 1SBEA 3E6BA 4LBLA 4PT6A 2Q8EA 3ZM8A 2G9ZA 2GP5A 2VTXA 1AUYA 2VECA 4AFDA 1W8NA 4C0HA 2I07B 4GIQA 5JSPA 4GWNA 1Q8PA 4PDWB 5F5QA 4ATEA 5KHKA 5F37A 1DZQA 2I45A 2B45X 4FPJA 3Q8BA 1ST8A 3PUSA 4DEVA 5IK4A 1YQ6A 3CDZB 5FUPA 1XRUA 2WZPP 3N4MA 1L7QA 2AUYA 2CHHA 1BCXA 3AK0A 3I3QA 3JQWA 3WNLA 4EWEA 4LE3A 3VB9A 2J1VA 5GLUA 2H6CA 4KH9A 4B3NA 5HXMA 1GWLA 4V2WA 5FZAA 1JHJA 1LHVA 1V9U3 3AYCA 3J7MA 2DCTA 2WA4A 2X5IC 1UX7A 1O8SA 3MPPG 4BIFA 2EXIA 4FPLA 2YG0A 5CFDB 4MOAA 5CA6A 1PIV3 1J58A 5C3RA 5JPNB 1IS5A 4QPGC 1T6BX 3BTAA 5FZ4A 1YC61 1IKQA 2A6WA 3NV3A 1DLLA 3DYMA 4QPGA 3S7EA 3NSTA 4K20A 2PHLA 3VDDB 3G7DA 2AREA 2C24A 1AYM2 5FY8A 4NRPA 5IVYA 1RITA 3FE5A 4QPIA 1FATA 3IDEA 2C4XA 3A0NA 3FLTA 3VKLA 1ZBA2 2RS12 1MS5A 1PK6A 1UCXA 2JDKA 2NMNA 3VBFA 5FRAA 3HQUA 4Q5OA 4XJAA 5GZFA 2HWE3 3VBHB 4JDMA 3S7IA 1RUH3 3I49A 1W6OA 2QDNA 1QNYA 3SH4A 1EV11 5D1IA 3WNKA 4DNYA 1QWRA 1Q8QA 5IHRA 3CQOA 4I0BA 3BPSA 3TN91 1AL23 3O0VA 4UF0B 5F5IA 5APAA 3NRUA 1O4YA 2WO1A 4AEDB 2PAKA 5F6LB 1WLCA 2Q8OA 1K12A 2JG9C 4ASMB 5JIUA 4K8FA 1ZM1A 3N7MA 1XYOA 3POJA 4CCLA 4LIUA 4MHUA 3KV6A 3ZYBA 3JCIA 2YGLA 3IBMA 3CJIC 1QNWA 4XHBA 5JOZA 4LEJA 2XJRA 1HRV2 4M3CB 2EF6A 4IEPA 3FMGA 3CKHA 5ANNA 2W9XA 5FZEA 3J7LA 3AZVA 1Y43B 1QOSA 2P17A 1YYNA 1DYKA 1XNBA 1YQCA 4NPMA 2VTFA 5JDBA 3MW4A 3U75A 4A2UA 5CKQA 2ZHMA 1RVF1 2JG8C 4P9IA 1JZ3A 3O0WA 2D43A 3N36A 1RMU2 2DCZA 5C3PA 1W6NB 2VUAA 4I01A 3ZMOA 3RVHA 1W6PA 4PQQA 3UGGA 4XILA 2HYXA 4IE6A 5L7OA 2Y64A 3E5XA 2UWBA 1JYCA 2RR11 3KCCA 2A3WA 3QD6A 1XNAA 2R49A 3NW4A 5L19A 4MGIE 4HSLA 5BNNB 1ZZ9A 1N1YA 5CIRA 1LHNA 1RIRA 5I8SA 4YW3A 4ARXA 4EN9B 2CAUA 1HQNA 5EZWA 3I4IA 1OFNA 2FQPA 3LEIA 1VP6A 3KS7A 3WDXA 5FY1A 5H9PA 3VN4A 1RUF1 3N35A 2QDRA 3F2ZA 1FI2A 1NOVA 2DFCA 2IWGB 2ZAHA 3A23A 1E5SA 3W21A 1WCSA 5IK7A 3FUQA 4JTOA 4FAGA 4A7ZA 4LULA 5FKBA 2XPJA 4CCMA 5FXXA 1O4TA 3PUIA 1H6YA 4WM8C 5EWSA 3NAPB 2VZ1A 3DECA 4K6BA 4WM8A 4ONUA 3N7KA 5HCBA 1UY0A 1C5HA 3EHKA 1QOTA 1Q5OA 3APBA 3HQXA 1FOD1 4RGGA 1HXS1 2XLFA 3N9NA 1PVC2 4WVZA 5C71A 1W2AX 4Q2FA 1LENA 1F35A 2EALA 3AP7A 2VMGA 1SCRA 3INAA 2BFUL 1IG3A 3QH6A 2P6CA 5D8AB 3K48A 2VXJA 1RMU3 3EQEA 1IS6A 3M2MA 4IGQA 5IVEA 1G9CA 3H1WA 1WUVA 3K77A 1ZZCA 1PGW1 2YZ4A 3WEZA 5FZLA 4TZDA 1DQ4A 2BJSA 2WWSA 3I59B 3JBG1 2DUOA 1IQAA 3WOGA 3PJYA 2EXJA 3SNMA 4Y26A 1WGPA 4CCJA 2DBNA 4YWAA 4RS5B 3UKVA 4AYUA 2QZ2A 5F5AA 3F95A 1NYWA 4BCUA 2RHPA 4D0QA 4MV2A 5G04L 1S0EA 2R0HA 3H7JA 3WLUA 1DZTA 4YM3A 1H6XA 3RG0A 3ALQA 3JU9A 1UX6A 1K5MC 4BLIA 2BVBA 2VZUA 4KWKA 4NPLA 2D40A 4Z2AA 3ZXAC 4Y4RA 1PNGA 2IC1A 2K0GA 3KVBA 1WBFA 4ITCA 3SKVA 2AR6A 4CP9B 2XDVA 5FR3A 3ZDSA 2VMDA 1W8WA 3H1YA 3WW2A 3ZPOA 1OH3A 1REDA 2G1MA 2Y60A 5JZGA 3MZHA 4RHV1 2X10A 2A1XA 3BN6A 5FZOB 4LITA 2HJIA 2VPVA 4QX8A 5K4LA 5A1FA 1GNHA 4QQLA 2Q8DA 4CXXA 1WA6X 4JV4A 4HN0A 4MUVA 2XHKA 2IXKA 3OUHA 5CU1A 1PVC3 4KBZA 1HLCA 1NLSA 4OHXA 4AWDA 1W0OA 1LOAA 1WCUA 1ZBE2 3M8LA 4JVAA 2ZZJA 3POYA 2RMU1 4YVSA 1B35C 5C8CB 3BIWE 1BQPA 4YFZA 4N8MA 4UFMA 1B35A 3WHTA 2QZ3A 5B4XA 3DF0A 5FV3A 2GNTA 3V0AB 4TXWA 4KWUA 3H42B 1URXA 5GKAC 2FZ2A 2D3RA 1COV3 2JDUA 2ET1A 5FXVA 3FX3A 3BPZA 3RMYA 5LEJA 1Q56A 2RDSA 2Y6KA 4UFJA 4XCAA 4XF3A 4CDXB 3AMPA 3ITQA 3JB4C 3SKJE 2B46X 2F4LA 5E8AA 4P9XA 5CFCA 1UYXA 5CFCB 3D6EA 3Q8CA 4CUBA 2DUQA 3ZSMA 3OF1A 4E8CA 1V00A 1W90A 1PGL2 2P37A 2ARXA 5KXBA 5DG2A 5LBBA 3S30A 4W4ZA 2VOXA 3ELNA 1UZ0A 3I3BA 4TWTA 1AR72 2BP6A 1NE4A 2QVSB 4NHLA 4Q0UA 2FDIA 1XB9A 1YXWA 3OJBA 4LTAA 5BYNA 3JD71 1AJOA 1VBA2 1WCDJ 4LE4A 3E5QA 2PA7A 1SCSA 4JQTA 4BQ3A 2ZPXA 1VRH2 4MGTA 4J1WA 4ATFA 5LRSA 3AXEA 3KQ4B 1J3QA 2K46A 1BEV1 5GZEA 2XGXA 5CISA 1K45A 5GZDA 1QF3A 1ZBE3 4PIYA 4Q26A 4D6QA 3H8RA 1SHWB 4Y5SA 1N1VA 4FQZA 1GP4A 5DZGA 3ZIXA 4W6YA 1HRI2 3C7GA 4ISQA 5T5PA 5B4NA 2FCUA 3DCQA 3O12A 4Z1VA 1TZOA 2XR4A 3RYPA 3KCYA 3AL6A 2RS53 2CTVA 1I3HA 5LBFA 3DN7A 5ISLA 4E4SA 1VBC3 1NLQA 2UU8A 2X29A 3CNAA 4BQ4A 4MXWB 1JYTA 2ZGRA 2JKXA 5FBJA 1HV0A 1Y9QA 1QJZA 3ES1A 3POSA 2KM2A 1YQ2A 1BJQA 2ADDA 3RSJA 4BQYA 3RRDA 2X8KA 3GZAA 3MUZ1 5F39A 3ZO0B 1HN1A 1OLME 4AAPA 3RZMA 5F8PA 3P5BA 2R6QA 1PZ9A 5JPMB 4OI4A 1C8M1 3R05A 5A3UA 5C33A 1V70A 1ZRRA 3USUB 5KBFA 3LWCA 4BDVB 4Y20A 3AKSA 1EY2A 3AJZA 4MGKE 1MS3A 4P02B 5DUUA 5A7QA 4BYYA 1KS4A 5LWBA 3PIGA 2WSUA 4AW7A 5ABJB 5FY0A 1D7PM 5CNAA 2MPFA 4CSWA 1AR73 3OGSA 1OA2A 1NA1C 3HN3A 3O1VA 1ND3C 2QCSB 2CY6A 2YU2A 5FXWA 3GBFA 1NA1A 2AZ5A 2EIBA 1Q43A 2PHDA 3VL8A 1VBA3 2LW8A 3R0RA 2VQTA 1ZRIA 2R1BA 3ZFEC 4PBOA 1VAKA 5CB7A 1JZ8A 2HWE1 1VRH3 1RUH1 3I3DA 2B5HA 1V6KA 4FPCA 4GZ9A 3ZFEA 4BISA 4OI0A 3OPWA 4D7YA 4CUGA 3VZNA 3EXUA 4QKFA 3D4KA 4OULA 5FYYA 4CP0A 3AYAA 1HRI3 1BVVA 2C5DA 2VGDA 3NV4A 1AL21 5SV8A 2O1QA 4W6XA 5C6CA 3AP5A 1XU1A 3R4UA 1W9TA 3PTRB 3WUDA 2P5BA 3U11A 1EV12 1QJEA 4KGQA 5JXHA 2NPIA 3CZUA 4QKBA 2OQ6A 1NT0A 1W2UA 3C8XA 4FPFA 5FK8A 2P34A 3TN92 1KDKA 2WT0A 3PUQA 3N9OA 4FFIA 3WX5A 1YIPA 5I0DA 5FZFA 4NPRA 4NIIA 1E5HA 1FPN3 3VDBA 4JCKA 4CDQB 2EIEA 2R0FA 2QFEA 1Q8SA 1W9YA 3H0OA 4FPKA 4KL1A 2JWPA 5JAXA 1V6JA 4EZ4A 3GDBA 3VZJA 1OURA 3D5OA 2W1SA 4AOCA 3V0BA 3L9JT 4UFHA 4HONA 1REEA 5EV7A 1FNYA 3T4HB 4RQPB 3KMHA 5K8SA 4AHYA 3AMNA 1CJPA 5DPNA 1NCRB 2FD8A 2QQNA 3LEMA 4IL7A 2V72A 2W46A 5FLHA 2FMDA 4CCOA 1ND2B 2BGOA 1MS0A 1RVF2 4IEXA 1CZVA 2E33A 2JIGA 3WUCA 1UPSA 1VPHA 3LCPA 4Y22A 4Q0VA 5FIXA 4AGRA 3H3UA 1QJFA 1ASJ3 4XDPA 2QBXA 4N7IA 4H14A 4LOSA 3VKNA 4I02A 4QDRA 4XACA 3JUUA 4K3UA 1ULDA 4XE9A 1ACCA 2VNOA 4OMCA 4LMFA 2RR12 4M4PA 3TYJA 2OUHA 5FYIA 3RZLA 3JZVA 1W2TA 1HV1A 3ME2A 2X05A 2J1RA 3WW4A 1OOPC 1US2A 3HWJA 1WCQA 2BTVC 4XF1A 4DB5A 1EV13 4D94A 4FT8A 3HBKA 2XOMA 3O7OA 4YW1A 2DV9A 1A6CA 3D0SA 4MX3A 1RUF2 1GANA 1XSRA 1S55A 2OVUA 1ZVFA 3ZFFC 2VQUA 1UMZA 5KXDA 1GFF2 3ZFFA 2P1BA 3POIA 4L8QA 1PHMA 4KBBA 3SCHA 2ZKNA 4XUOA 2JE8A 3RZZA 2PAMA 4YZ3A 3LDKA 3EYPA 3WDWA 4E4ZA 1UIJA 1OF3A 5BNOA 5BNOB 4H7MA 3OBTA 5CYYA 5T52A 3AZWA 4LBMA 3BTXA 3WF4A 4IV1C 1NY71 1WLDA 3AKPA 4KU8A 1FOD2 1F15A 1HXS2 4IV1A 4MXVA 4OMDA 2VNGA 4CDUB 2O8QA 4COYA 3LOBA 3PU3A 3OD4A 5HPOA 2XQXA 1M06G 4XUNA 1CWPA 5FBZA 4OZOA 2ZOEB 3ZN6B 4JDOA 1CAWB 2EIGA 3VUOA 1W6MB 1WMXA 4FOVA 5F3EA 5HXVA 3U14A 4GAZA 4OYUA 2QNKA 4EN8B 1GU3A 4BPZA 1PGW2 1S1AA 2ZGMA 3B7MA 3M3QA 1YQ8A 1SFNA 3JBG2 1GZ9A 1G9DA 4YNIA 2W39A 1W9FA 2VMFA 1HQWA 5C70A 3ROUA 5AC91 5ACA1 2RR13 5FXZA 3W20A 3GNEA 3BALA 1DQ1A 2WWUA 1AVBA 5FYHA 1MS1A 5K0UC 1HB2A 2VNVA 1IGOA 4P9JA 3VKMA 3NV1A 4IEOA 4O9GA 3GHNA 1PVXA 1SLAA 4UFIA 4QXBA 3OY8B 3DPRC 4F83A 1E57A 4OI2A 3WQ1A 4AHWA 3DPRA 2UYAA 2WLPA 3QBQA 1IQDC 2R063 4JGZC 1VB4A 2VBDA 4BXFA 3JXSA 3D0JA 3TEWA 3OTFA 2JDNA 1TNRA 4CDWB 2A70A 2OIIA 4FQ4A 4BXSV 1YFXA 1SBFA 1W6QA 3LD8A 1H8TB 1WZXA 4RHV2 4WBBA 3T0AA 5FJHA 4Z92B 1RJ8A 2MHFA 2CDPA 1X7NA 4S2HA 1Q8VA 4LBQB 5GLWA 4O61A 2DVBA 2VVFA 4R8HA 2VVDA 1LTEA 2VH9A 5KR7A 3OB8A 2GP3A 1UXZA 2A75A 1AR61 3ZPYA 4EN0A 3PJQA 1UYYA 4GWJA 1H0BA 5F1RA 3GCXA 4TYSA 1COV1 1Y9MA 5JSOA 2RMU2 5FMDA 2YGMA 2JDAA 4YRDA 4YZ4A 3VZLA 4CE8A 1UPIA 4HPKA 1UO9A 3KVAA 4WM7C 4A6OA 2FCVA 3BI3A 2QE3A 4COVA 4WM7A 1MQTC 2A6ZA 2VXRA 3JBG3 2VZPA 5H9SA 3MW3A 1BK1A 1UOBA 3L2YA 5FP8A 4AXOA 1NQJA 1C28A 1U5ZA 2GC0A 2W1UA 5CAZA 4HG6B 4JC1A 1Y7BA 4Q4X3 3ZFGB 1XNCA 3HT2A 4MHRA 2ZHNA 3RDIA 2WT2A 1XE7A 4FPOB 3KF5A 1QY4A 1X82A 2CYFA 3I8TA 2PAEA 2VVEA 2QQVA 1OBNA 4NRMA 2BNMA 2BVVA 1OQEA 1JODA 1W2NA 4ZU4A 1O3SA 1L3JA 1SMVA 2Y6FA 1GQHA 4XQDA 1BZWA 1POQA 1W39A 3ILFA 1IZ3A 2BOIA 4K40A 3GZEA 3SQOA 5BNPA 2HEWF 1GOFA 2UWAA 4N9IA 1OPMA 1GYKA 4WVMA 5J3UA 3USSA 4D6RA 3OUIA 3VBRB 2W5FA 3GXUA 1ZZ7A 2E7TA 2ORXA 3I54A 4NIAA 2D93A 3JD72 1YFUA 1DGRA 3H3LA 4XZUG 3MF9A 3PNAA 1LOEA 5DN2A 3ZIWA 3PVEA 2VY0A 3WP3A 1LOFC 1ULEA 3PTYA 4UT5A 2W68A 4YVWC 4EN6B 1LOFA 2BDRA 2RS51 4YVWA 4DINB 5EIYB 3CF6E 3O1OA 2Y6GA 1TE1B 1VBC1 1BEV2 2JDMA 3OBZA 3T2OA 3WVJA 3O1PA 2O14A 2WC2A 4N53C 1DZRA 1UMHA 2XJTA 2VZTA 3WR0A 1D0GA 2RMU3 1W2OA 1TME1 3ILNA 2WFPA 3ZYIB 5KHJA 4LT5A 2ZS6B 4I2OA 1JUIA 2BNNA 2E63A 2G9GA 2B42B 2GAUA 1RC6A 3N9QA 4MGSA 4Q4V3 2E51A 3TN93 1MZ5A 4N43C 5A80A 2BWAA 1RUG3 2HEYF 4AVSA 5GLVA 3CLPA 4R52A 4D8MA 3BGAA 3WCRA 2BV4A 4LHSA 2O8OA 1UD1A 2PHWA 4LBNA 3M1HA 2DVDA 2WNUB 4GH4B 1LOBA 1S2BA 3P1IA 1V9U2 2XUEA 4XF0A 4B4PA 3BCWA 3FC0A 4I0AA 3K75B 1C8M2 1W8OA 3KT4A 3HN1A 4M01A 3O1MA 1EPWA 2D97A 4PJYA 5EYXA 3VHRA 1H2LA 1FMD3 3MI8A 4ZS3A 1IPSA 1CGPA 4CEWC 2W0XA 4QU2A 4DUVA 3HR9A 3AKTA 2VW0A 3EJKA 4CEWA 1FYUA 4RR3C 3UETA 3VHPA 3AL5A 3MICA 4W65A 2C6SA 1R64A 2B39A 5C3QA 4QMAA 2DWRA 3LPFA 4GKYA 2VOKA 5DDJ1 2ORZA 4QM8A 3IMMA 3WG2A 1TG7A 2I74A 5LK7B 1KQRA 4NROA 2OUJA 3B69A 1SQ4A 5BUVA 2HYKA 1ZZ6A 3UK9A 4ZKTB 2HWE2 1RUH2 3GJBA 1REFA 4IEYA 2BWCA 1K3IA 2DURA 2G4IA 5I8TA 3M3EA 3IPVB 2Z5WA 3AZZA 4ASKA 3AM2A 5I91A 1N1SA 5IAVA 4LK7A 4XBQA 4I3PA 2FDHA 5CEHA 4QX0A 1IOAA 1CN1A 2ES3A 1AL22 3QCWA 3ZXLA 5F7UA 1SLIA 3WZ1A 4UAPA 2ZABA 1D2SA 2DU1A 1FPN1 2NN8A 5HCFA 5DMYA 1PO23 1CPMA 2JDZA 3H8XA 1AX2A 3VBOC 3AXDA 5LA1A 3H8OA 4XJWA 5BPXA 4QXCA 3OUJA 4Q4Y1 2P2KA 3PHMA 4Z82A 2YC0A 3CBNA 1CIWA 4DRRA 3S0MA 2R043 5FZMA 3MLKA 3SCFA 4HK8A 1C8M3 4G9SB 2A6YA 2HEVF 2X5IA 1SZBA 3DKQA 1ODNA 3POGA 4P5YA 5FUIA 4DEQA 2W47A 4JGYC 4Y1YA 3K4AA 3U4XA 1W8HA 4JGYA 1IS4A 1OKOA 2DVAA 1OUSA 2EXHA 3RZHA 4QPGB 3RMXA 4CU6A 1ASJ1 3ACGA 3ABZA 3ZVXA 5IK5A 3P6BA 1QDOA 1WMDA 1W28A 4HT1T 4G4FA 4V1PA 2VUJA 3N9LA 3HEIA 3IDAA 4YG3A 1GP6A 1CX4A 1NZIA 2QUOA 4QPIB 5FKCA 3J7NA 2BUKA 1OLQA 2P3IA 1PK6B 4M3CF 3VBFB 3I2GA 5JOWA 2PHFA 3A7QA 4XURA 1W6OB 1Z7S3 3AFGA 1QXJA 4IEZA 1UOJA 1YUDA 4OUEA 4P9WA 4BMBA 3ZKUA 2YV8A 4LPLA 4JKLA 4BQ2A 3B9IA 1VBE3 3OD0A 1VRBA 4PI0A 3T30A 3OSDA 4DY5A 2D6KA 4XJ8A 3FBMA 1JOBA 1GUIA 2JG9A 2RE9A 4YLZA 5FPAA 4EZHA 1ULFA 2HLEA 1EAH3 2ZKLA 1ZZ8A 3OG2A 1MS9A 2ADEA 1RUJ3 1SG3A 3CJIA 2GNBA 4FI9A 5FP3A 4BH9A 3MYXA 1YWKA 3ON7A 1AR91 1JH5A 1VAVA 1VBD3 3NV2A 3UESA 1PZ7A 5FPBA 1SFPA 3M4FA 2AEYA 2LTNA 5FREA 4AEDC 4CCNA 5LEKA 1G8WA 3DV8A 4E8DA 2XVGA 5F3CA 4BLJA 4YW2A 3E5UA 1V6OA 4Z8BA 1NY72 4K21A 2JG8A 4Y1XA 3OPZA 3LIGA 2YPDA 2JG8B 4PI2A 5JUVA 1PM7A 4XF4A 4AI3A 2XMLA 1RUC1 1W6PB 2VOVA 3LFIA 1DGRN 1IHMA 3AZXA 5BV6A 4QHBA 5JMCA 2YBKA 3AC0A 4XHXA 4R9CA 2VMCA 5L7OB 1CAVA 1VR3A 4XC9A 2WZR1 3M7AA 1O3RA 5EXOA 4LA3A 3T2TA 1OPOA 3WP4A 4LK6A 1OD5A 4A4AA 4KWJA 4Q1RA 2GALA 4DIQA 2Y6HA 5AVPA 5FQ0A 2XXZA 4X8PA 2ZX4A 2JDPA 1ONAA 1WLWA 1F5FA 1C4RA 1J1LA 1XBFA 4NHKA 4P00B 4AI0A 1QQP3 5AC92 2SLIA 3DL3A 4XIOA 2G19A 2R061 3POWA 4RSUA 4QGMA 4GXLA 1W0NA 4XETA 3D8CA 4Y5TA 4BJ0A 3E1F1 1D4M3 3BVCA 1GBGA 1QU0A 4NAOA 2VZRA 5CVRA 5L9VA 1MACA 5BNNC 2CAVA 2HWD3 3PVNA 3FFZA 2VZQA 1GP5A 4NJ4A 4WM8B 2XVLA 3H8UA 4HETA 4MGYE 5FP4A 3ZR6A 4BK4A 4XTMA 4CUCA 5C5UA 1UN1A 5FZCA 3LEKA 3GGLA 1JYWA 2ATFA 5FZ0A 1HJGA 2CDOA 4RGKA 5DAPA 3IIAA 1X9TA 1DYPA 4B1LA 2C0ZA 1PMJX 3OYWA 4AI1A 4L92A 2XWJB 1JU3A 3NAPC 4NWWA 1QHDA 4PIZA 4BM8A 3KHCA 4NE9A 4FOYA 5L73A 4JRLA 4OZXA 3O1TA 1U0AA 2D7FA 5FOJB 2JECA 1AR62 4FFHA 3I2OA 2XONA 5A3NA 2ZGKA 1COV2 5FO8B 1U5YA 4UW5A 2GC2A 4Q4X1 3IIIA 2FCTA 4A3XA 4CCKA 4AF9A 4YGEA 1GSLA 3VV1A 1QH6A 1ENSA 4EE2A 1QKQA 1MZEA 3KLSA 3TRSB 2XQRA 5D8AC 2YC4A 2QQUA 3IAPA 3I2HA 4ES8A 4Y33A 1E5IA 4BQ5A 3MDPA 1YCIA 2WYFA 1I5ZA 3KCXA 3CL1A 2YFUA 4EJRA 4WV8A 4YW5A 1K5MA 5ACA3 5AC93 4LO5B 3FUOA 1EPZA 3KD4A 4FOWA 2KXLA 2YBSA 1LCLA 4CPBA 2Y34A 4HN1A 1UKRA 2D6NA 4BE3A 5JWPA 3LDBA 2RDNA 1HKDA 2RDRA 2WAAA 2WAOA 5A7OA 2RV9A 4M0HA 5LATA 4QT6A 5JZGB 1VBB1 4L99A 3K3NA 4FXKB 1WW6A 3WNXA 3VBSC 4O7XA 5A6QA 3VBSA 2VMIA 1XE8A 2JDYA 4LHNA 1H1MA 1SACA 3UJOA 3W59A 4CEYC 5JR7B 3GYDA 2QQKA 1UF2C 5A7WA 4CEYA 2HWB1 2OW4A 2A6VA 5A1AA 3SH3A 4HXCA 4CCEA 4YVSB 2WA3A 5EFUA 2JB4A 3ZR5A 3NKGA 4R9AA 4Q4V1 1B35B 2OPKA 1W04A 2RS52 2X09A 1IPJA 1AR63 1RUG1 3U1XA 1VBC2 2J1TA 2VQAA 2EVXA 1FXZA 3WNNA 1GOHA 4HVQA 1D4VB 1V6LA 2BBAA 2Y6JA 5CZKA 5JI9A 4LBJA 4LUMA 1TME2 1V6IA 3FLPA 5C9AC 4B7EA 1N3PA 2ZGSA 2XUMA 4QHOA 4ZZ5A 4BB3A 3QOPA 4Q4W3 5C9AA 2HH9A 4ORFA 4O9EA 1YO8A 2CL2A 3KWVA 4LKFA 4UOJA 4DZGA 5GLTA 3WNPA 4QQPA 1XU2A 3D82A 5C8CC 4D6SA 4S2GA 2WO2A 3B5LB 3SH5A 1HB4A 1OFSA 4IGPA 1AXKA 3DXTA 1JOPA 1FMD1 4RGAA 4A6SA 1CESA 3ZDVA 1KGYA 3GM8A 4P9LA 4B29A 2LROA 4GB33 1R093 5GZGA 3WDVA 1S0JA 1MEC3 5J1XA 2A71A 2ID4A 2P6HA 2WQZC 4AI2A 2N7GA 4PIXA 5IFTA 5LASA 5IT6A 3WSOA 3T1MA 4Q8KA 5KHGA 4H2AA 1XYPA 2DCJA 3CHXA 1YHFA 3LSEA 5C5TA 4R4ZA 3NNGA 1KFXL 4JKMA 3ZOIA 3S57A 2VCMA 4PCRA 1WD4A 1I6XA 4Y4YA 3IB3A 4E2GA 2CU5A 1UY4A 2R071 2Z69A 3I2FA 3DXUA 3FLRA 1F8VA 5DDJ2 2VZOA 3AJYA 1QXRA 3O1UA 5HV0A 2WNVC 1GZCA 3MIGA 1R083 3N9MA 2WNVA 1CZTA 4QQOA 5FK7A 1JZ6A 1PO21 3OBRA 3OOXA 5A7SA 1LECA 1C8NA 4RD7A 4AQSA 2OA2A 5A7NA 4P9YA 3FHAA 4KU7A 5FZ3A 3U07A 5FP9A 4XABA 1TME3 3MLLA 2YXSA 2WNEA 4WVVA 2R041 5IVFA 4Q29A 4X6QB 4J25A 5J96B 3ETPA 5I0SA 2A6XA 3TEXA 1FPN2 5A33A 2E53A 4ZXEA 4CP2A 2WFF1 1L7RA 3WF3A 2YYOA 1LJ7A 1W8TA 5KC5A 3MIBA 5F5CA 2ERFA 3PVOA 1LHUA 4Q4Y2 5BNQA 4Y20B 1ZYBA 4TLFA 2Q1FA 1DDLA 2DCYA 2GNDA 5FMOS 1RUE1 2VG9A 3P3NA 1W9SA 4LLFA 3UNPA 3L2HA 4X6RB 5FYTA 2WO7A 1RUI1 4IEQA 2ZGTA 4RL7A 4BQWA 4C90A 4YZ5A 3ZSJA 1NA1B 1ND3A 4C8DA 3B3QE 1JYNA 2XB6C 3IM0A 1S0BA 4AQ2A 5C4WC 5JOXA 1VIWB 1PGSA 1JYXA 3O14A 4MADA 4A7YA 2Z2SB 1ASJ2 2VE1A 2VD7A 4P14A 1S2KA 3ZX7A 2BOJA 3ZFEB 3ECQA 3ZXJA 5CG9A 1Z7S1 5ABJC 3VZKA 4Z2WA 3ETQA 3I2DA 5DDJ3 2C26A 2VMHA 4XF9A 3RJ2X 1OD3A 4YM2A 4FBFA 4YGBA 1JHNA 1O7FA 1QJY1 3VL9A 1T2XA 1VBE1 2GZWA 4BOWA 4ES9A 3WW1A 4LBKA 2Z42A 3OCPA 4JHTA 1AZDA 1LOGA 1YFYA 3NJXA 2LS6A 1XJAA 2GH2A 2IVJA 2WLQA 3B94A 4QDSA 4A45A 5E6HA 1YFWA 1C1FA 1G9AA 1ENRA 1EAH1 2W87A 2TUNA 1RUJ1 4YPJA 5J36A 3WG4A 1UU4A 4QB1A 2Y33A 4AGVA 1VBD1 3W5NA 1YEWA 2ET7A 4XZPA 3J4UH 4HANA 4COWA 4LUKA 1NCQC 2ZGNA 1SLCA 3SISA 4EV0A 4Q4Y3 4XUPA 4Y3OA 1NCQA 5IVJA 1I5PA 4QX1A 5A70A 4YW4A 5IATA 4CRQA 4Y1UA 3VZOA 2WIIB 1DF0A 3AFKA 4XDOA 1GICA 3J9SA 2AGSA 4HOOA 5T5JA 3V0BB 2B4KA 1R1A3 1AR92 1JMUB 3AMHA 4GMP1 3MGUA 3WG3A 5FJKA 3J7HA 3O1RA 2Z79A 3HJRA 2EIDA 4FOQA 2J22A 5LA0A 3NJVA 1PNFA 3FHQA 3ACLA 5FYBA 1CAXA 2HBTA 4BHPA 5J48A 4XJZA 1N3QA 5IK8A 2JICA 4IE4A 2D98A 4QPWA 5EYYA 2OQ7A 4Y22B 4HVRA 4H55A 3WINE 4GJZA 5A7PA 4XDQA 1RUC2 4GKXA 3VKOA 2VMEA 5FMCA 4RQPC 2NM1A 3HT1A 1UYPA 4DO0A 4QD2A 5FPUA 3I7DA 1QQP1 4HSJA 2WZR2 4J6GA 1LODA 3PVBB 5FWEA 5IW0A 4LA2A 3OGVA 4IESA 4LXLA 1UU5A 2FHRA 3ZXFA 4B4RA 3VBUC 5A3MA 4DOUA 5LY1A 1D4M1 2QQOA 3VBUA 1OOPA 1CD3G 2HWD1 3ZYFA 4O65A 3BTYA 1CAUA 5K9YA 2FDFA 5HV4A 3TBDA 2R062 1UKGA 2WINB 1DQ5A 1Z78A 4D69A 1NUKA 2OS2A 2TNFA 1NZCA 1EYBA 2J7MA 5D21A 1LULA 3ZFFB 4ZZ8A 3VZMA 4MH0E 3SCGA 1CJDA 5CG8A 4IV3C 5LBCA 4FPYA 2EA7A 1OT5A 4UYBA 4IV3A 2GH8A 2YB7A 4XXAA 4AVCA 2QQLA 1GMMA 5AVAA 4XAAA 3WF2A 1LNSA 3ZSEA 2YUEA 4TLGA 3PURA 2DUPA 1ZRDA 1TVGA 3RJRA 1CPNA 2ZEYA 4J1XA 4NUBA 1WMEA 3GZTB 3MV11 1AR93 4IV1B 5FPLA 1SLTA 2RS31 2VW1A 3ZXGA 1K42A 2SBAA 4CVUA 5T55A 4AFBA 2ZGPA 1G9FA 1BMV1 3VHOA 4I09A 3R4DB 1JYIA 2W2IA 3MV01 4E27A 1OXCA 1UMIA 1JU4A 3CU7A 1X9PA 2VQ0A 4X8NA 1A78A 2ZEWA 4R9DA 4IQPA 1RUC3 1C3HA 5A32A 1RXFA 2R16A 4HKLA 1QEXA 4QPYA 2L9LA 4ET7A 4QGNA 3LDRA 4Q4X2 2JXAA 5EHDA 4CXWA 1Y9GA 3UKTA 2WZR3 4AR2A 4AEMA 3TEZA 2WYSA 4MVTA 4L0PA 4NO4A 3AZYA 3U37A 1MR5A 5FY7A 5EJ3A 5K0UA 2VBPA 1F9KA 2LRPA 5ERLA 3C7EA 2XJUA 4AEJA 1Y3TA 2VZ3A 3THTA 1WD3A 2ZX3A 3DPRB 1US3A 3NO8A 4D7SA 2QQMA 4LORA 3RZGA 2GC3A 4BQ1A 4JGZA 1CVNA 2IFWA 5I93A 5JIAA 3RZKA 3IT8A 3A4UA 2EAAA 3AP6A 1AX0A 1VLNA 1WW7A 4IW3A 5GZCA 1NQDA 1QH7A 3HVDA 1LEMA 4XFAA 5F6KA 4QM9A 3LSDA 1H9WA 1W6QB 2AH2A 1D0HA 2ZBJA 2WRAA 1VBB2 3FL7A 3BTZA 5T54A 1YIFA 3KHBA 5F32A 2XKOA 1WCKA 4XW3A 2P3YA 2XVKA 2GN3A 2XKPA 5DAQA 2IXIA 2VU9A 1VALA 2XL7A 2PLV3 4QB6A 2HWB2 1S0DA 1RUD1 3MF6A 5B2GB 2XH6A 2VUCA 3BOPA 4Q4W1 1WKYA 3MIDA 1H8TC 4HPKB 1W0PA 4IEWA 4NN0A 4Q4V2 4XMAA 3KB5A 4IUGA 4LBOA 4BU2A 1GZWA 5HBAA 5A3OA 4WM7B 1H1AA 1RUG2 4N9HA 1MQTA 5LA2A 3WQ0A 3WNOA 1HIXA 2BEOA 5FY5A 1W06A 3FWEA 3T2PA 4QX2A 4P9GA 3AKRA 4AFAA 4AFMA 4EROA 3I3EA 4Q0QA 1LU1A 2TEPA 4GB31 1R091 4LNVA 4C1XA 2QQJA 5M0TA 1ZA7A 1GNZA 2R32A 1MEC1 1O5UA 2HKXA 3H9AA 2NMOA 1VE0A 2KR2A 3C7OA 4GULA 1UZYA 1FMD2 1BBT1 3X29B 3WT3A 1GLHA 1OVSA 4PLNA 1W8FA 2VTXJ 4LHLA 5FZ6A 1O3QA 5BNPB 2JE7A 4LKDA 1LB2A 1UNBA 1GWKA 1BHGA 4G3YC 1AYN3 1DP0A 4WVMB 5EJ1B 3RGBA 3ZFGC 3BKZA 2W52A 1NG0A 2Y26A 2NP0A 3EB7A 4JQRA 1O8PA 2QQIA 5T50A 3RPQA 2VM9A 4AHXA 2YC2A 1A3KA 3SEEA 3O0XA 3THDA 3EBRA 1VBB3 5FMOL 5A3TA 1JN2P 1N3OA 1R081 1XSQA 4IEUA 1T6GC 2NZ9A 3AKQA 5LCWL 3VBUB 3WQ7A 3PDQA 3GALA 4YVWB 2R072 4RFRB 2Q8CA 4AEKA 1XQNA 5EJZB 2YMZA 2BFUS 4QKDA 4EYUA 1ZX5A 2HWB3 4FXGB 4N53A 3ZSLA 3ZXEA 2K9ZA 4B4QA 2R30A 1H2NA 4K1ZA 1S4CA 4N7UA 4UBGA 5I0RA 3THPA 3M3CA 1PO22 3DGTA 1QJU1 2D5HA 4N43A 1RYYA 3K4ZA 3ZYJB 4DQAA 5HI0A 2R042 1XOYA 5CBLA 3FBYA 5DAVA 3I3MA 4V2VA 3SEPA 1O59A 2WFF2 3FJSA 1KFUL 1YNAA 4A3ZA 3WF1A 1JBCA 2FMYA 1LAJA 3K2OA 1FT9A 1UL9A 4IXLA 4YW6A 5DQ0A 4SLIA 1YQ5A 1RUE2 4CEWB 2YROA 1UWWA 2VC9A 1J3RA 2A73B 4HFSA 1RUI2 2DF7A 4RR3A 1HDKA 1W8ZA 4HLTA 5GALA 4ZS2A 3BUCA 1EUTA 4KG8A 4XEZA 4AK3A 2ZZQA 1M4WA 3E6CC 4YW7A 4LKSA 2MEV3 1AJKA 2V73A 3NMBA 1AR83 3KQRA 4Q8LA 4UI9L 2WDBA 5FYCA 4OQ8A 4AVBA 1Z7S2 2DVGA 2R073 1POV3 1POV0 3MPBA 4XIKA 4AZZA 2YDEA 1GOGA 4XFGA 5EQUA 5DAXA 1OKQA 2HWF3 3LQCA 3OBAA 3ZYRA 1X8EA 3RWNA 1S0FA 1OVPA 2XJPA 1QJY2 5FPVA 3VD4A 1VBE2 1NX9A 1RGSA 2E31A 2VAUA 5FZ1A 1APNA 1LKNA 5FAXA 3RNSA 4NHYA 4QGLA 5IVBA 1WBLA 4F8AA 4FO9A 1A8MA 1UY1A 1ZREA 2UY8A 3MBWA 3HMYA 3VBOA 3K4DA 1EAH2 3HNYM 4BZ4A 1XPWA 3PMSA 4CU9A 1RUJ2 2BRTA 4UBHA 2YHJA 5H9QA 3A0KA 5LA9A 3AP4A 3LKJA 2WZEA 4JDNA 4GJYA 1R1A1 1VBD2 4HKWA 4PDWC 1RHI3 2WFF3 2WS93 1G6NA 3KV4A 4PDWA 1DIWA 3URFA 1SFYA 2X5IB 5KWRA 4R9BA 4ZONA 4YSFA 2D3PA 4QX5A 5FZGA 3TWIA 2Q4SA 4JGYB 2DCKA 2UY9A 5EPAA 2HWC1 2RM21 2JB8A 1ULPA 1RUE3 3RWKX 1S0CA 3H50A 4KG0A 2GMMA 1KJLA 4CU7A 1RUI3 3B02A 1H1IA 2OKXA 1G7YA 4HL0A 2WQ4A 2RVAA 2F6BA 1NLRA 1W3VA 2VULA 5CFDC 3VKFC 2ZX1A 4COZA 2YY1A 3T08A 5CFDA 3LGRA 2A5ZA 2BU9A 2XBO3 4YZ2A 2DBIA 2AYHA 4AVAA 1VMJA 3DYPA 3HD8B 3HPNA 4YARA 1H4GA 1JOJA 3LF7A 2BERA 2JKBA 3VDDC 1FV2A 1XYNA 3SHRA 1QQP2 4U36A 3VDDA 3GCWA 3M3OA 5JR2A 1QJY3 4QPIC 4INDA 1WMFA 1V6NA 3C2UA 5F2WA 1D4M2 1KD7A 4P5HA 5C8WA 1PK6C 3VBFC 2LALA 3CJXA 3VBHC 1OUXA 2CGNA 2CSGA 2V5DA 2DTYA 2HWD2 4LO6B 3SXWA 2JG9B 4LO4B 3VBHA 3WQBA 2VW2A 3ASIA 2IXHA 2GDFA 3ENRA 1FAYA 5FZ8A 3LFMA 3WXPA 1AL0G 1AXZA 1RJ7A 2UWCA 3ATGA 3Q8EA 4KWLA 4NHXA 5L9RA 2OX0A 3CJIB 3IMNA 3PIJA 2OPWA 1LRHA 1B09A 1I9RA 2LM3A 2NQYA 4EWDA 2VCBA 4UF0A 2C9AA 1HQLA 2DU0A 2JJ6A 4DMIA 3ACHA 5T5LA 4AEDA 3B93A 5FCCA 1ULCA 2O0OA 3KGZA 2GMEA 2GU9A 4OI1A 4ARYA 4DPNA 1AF9A 4HZFA 1RTVA 3GF6A 2ZEXA 2AC1A 1JTZX 1H2KA 3NJZA 2VZVA 3PUAA 2ZGQA 2RS32 4GMP0 2HBUA 4GMP3 4K9SA 1CONA 3VD7A 2BGCA 4H3WA 4DFSA 4DXRA 4E2QA 4NIHA 2LUWA 2QJVA 3AMQA 3Q8FA 4M3CA 2DDUA 1BMV2 2WN3A 3NNMA 1W8UA 2DVFA 1CAVB 3MUY1 2ILMA 4XUTA 3LA2A 4YG0A 4Y24A 3MEPA 3KZ4C 1ENXA 3BOWA 5FYVA 2WT1A 3NNJA 4XQWA 1O91A 2AACA 1DGWA 4JX0A 3ZXDA 5FQ0B 5IFPA 3AMMA 2D6LX 3P3PA 4HVOA 2BYVE 2ETEA 2PXJA 4RN5A 2IXCA 4CYDA 1W6NA 4QXKA 4C0BA 3WW3A 1ZZBA 2ZX2A 1TQ5A 2XLAA 4AAXA 2A3YA 5ACA2 5FO9B 2IXJA 3IKWA 4CU8A 1IS3A 1PO11 4FTBA 1AYM3 5J7MA 5L7OC 2GN7A 4RYDA 3LB9A 4IERA 2CWSA 2KA3A 1ZBA3 1JI6A 1NXMA 2X53S 4K8RB 2RS13 2ARBA 4XCBA 5BNNA 5F9TA 3GHMA 1GNYA 1V0AA 3T09A 1KEXA 1X36A 2QKDA 3AYEA 5F3IA 2W3JA 3MIFA 1O5LA 1UQXA 1GQPA 4YGCA 5G05L 3UT0A 3QH7A 5FWJA 4E4HA 3WNMA 1ENQA 2VOTA 4XOGA 5FDBA 2YPJA 2RG4A 5KHHA 3BIEA 4YG6A 4WZFA 1RUOA 2PLV1 4XFCA 1LHOA 4OUSA 1QDCA 2V4VA 5JXIA 4OHYA 1X50A 3OYWB 4NWVA 1JYVA 5FFOC 1XC6A 2H0BA 3NAPA 1TMF1 4FPEA 1EP0A 1N47A 1SPPA 2P3KA 3E6DA 2RS33 1SPPB 3I97A 4QWNA 2ZX0A 3QLQA 5IWFA 3KT7A 3U78A 5C3OA 1MS4A 3PUHA 1QJX1 1JW6A 2XWBB 1HRV3 3NVCA 1RUD2 4KI5M 4UFLA 3V56A 2CGPA 3M70A 5GLZA 4YM0A 4YGDA 5DZFA 4S2DA 4Q4W2 2WZ8A 3ST7A 2W91A 3PL0A 4E4DX 4LHKA 2DTWA 4KGGA 4MZUA 5D8AA 2F4PA 5FOBB 2D44A 3BYWA 3R6SA 1XXNA 3TNPB 2AEZA 5BY5A 5LB6A 2OZ6A 4URTA 4P08A 3BODA 3DYOA 1K5MB 1YI9A 3I59A 3NL1A 3KT1A 4RS5C 4GB32 3HNMA 1R092 5DAWA 3WDTA 5K7PA 1OH4A 1PMHX 3ORJA 4OLLA 1AYN1 3OGGA 4RS5A 1MEC2 4XBNA 4I0WB 4YYOA 4CCDA 1XNTA 2RJKA 1R1ZA 1C1LA 2PFWA 2XG3A 5LRRA 2BQPA 4AQ6A 2Y0OA 3JB8A 1OI6A 2B7YA 5E88A 1BBT2 2BNOA 3NNLA 4PF5A 1NAEA 3TB0A 4IETA 2V4AA 1D2QA 1UYZA 4ZY9A 5C3SA 3W58A 1XNKA 2XL9A 5F3GA 1EUUA 1OHFA 1UW8A 2ZCWA 2PELA 4EN7B 1AX1A 3NNFA 3RS6A 3VBSB 1KXGA 1OA4A 3OEAA 2OZJA 5A7WB 4CEYB 2PQQA 3C7FA 3WHUA 4ASLA 3HAGA 4N90A 4CP9A 1R082 1FX5A 5JZGC 3T3YA 2W94A 5FZOA 4TTGA 4ZXKA 3WF0A 5FYUA 5FZKA 2Q5TA 2ZA9A 4CXYA 5FZ7A 3BU7A 3NJYA 4RA0A 4PLOA 3LZZA 3CEWA 1RUD3 4Q1PA 5I8YA 2ZJCA 5DZEA 2BPA2 1F2NA 3AX4A 4FSJA 1J83A 1MVEA 1SDDB 2WSVA 3O5SA 5E16A 3UKNA 5C9AB 3BB6A 3H3ZA 4UFKA 4R4XA 3N3HA 4YVSC 1ODMA 3EMRA 1DHKB 2C1FA 2CNAA 2WBKA 5C8CA 1QJU2 2ZGLA 3KM5A 1UAIA 2GC1A 4QAWA 4AGGA 3IZOA 5JI7A 2J1UA 1JZ2A 1DG6A 1C57A 3V0AA 1PZ8A 2EAKA 2XLGA 3CMGA 4CPBD 4IE5A 5KHIA 1CQ9A 1VMFA 1V6MA 1TNFA 3H7YA 4XBLA 3S5QA 2H6BA 3RI9A 5LBEA 1FV3A 4K7JA 4XAEA 4OVEA 4COUA 2QQPA 2ZGUA 4CDXC 1O3TA 4RFT0 3GBGA 2Y38A 2NYYA 1U12A 3AVRA 4PBPA 4CDXA 1BBT3 5CFCC 2MEV1 1UXXX 4KQ7A 3J8F1 2WL1A 1AR81 2GMPA 3AYDA 1W3XA 4I30A 3W9AA 1DBNA 3Q9OA 5CKMA 1LGNA 3GJAA 4DUXA 1HN0A 3MFCA 5D2AA 1POV1 1BKZA 4FP3A 1ALYA 4JKKA 5BXXA 2G9FA 4IDZA 1S0IA 3ZMNA 1U5IA 1DQ0A 3ZYPA 3A21A 2E6VA 1NXD1 2HWF1 3AVSA 3HQRA 2YFZA 1DQ2A 4UXAA 3DUIA 1RB8G 1QGLA 2QTWB 4QX3A 2WNVB 4TN7A 4BWOA 1FNZA 3CIHA 2FZ1A 1CX1A 2YBPA 3IN9A 1BVP1 4LKEA 4IEVA 5EP9A 2P4EA 3R4SA 4OHWA 2W1WA 1C5IA 5IAXA 4L9BA 2FDJA 1OMIA 3SLIA 1J59A 2OT7A 1AXYA 1OQDA 1LEDA 2H0VA 4CCCA 2ZHLA 2XHNA 1Q3EA 5JCTA 4MYEA 4NIGA 1A8DA 4QQHA 2IVIB 2J42A 3CO2A 4E9KA 5TSWA 3OGJA 1G9BA 2VCAA 1RHI1 2W1QA 3U0ZA 5A33B 2WS91 4IE7A 1HJFA 4EWAA 3TNQA 1LOCA 1QJU3 1A34A 1J3PA 1SLBA 2VL4A 4MLOA 4OCTA 3WG1A 4NOTA 1PX3A 4UWDA 2D6PA 3NKTA 3O1SA 1GWMA 4QHZA 4NHMA 2JE9A 2ZHKA 2UYBA 4MXWA 5FPXA 3AP9A 1ULGA 1WLTA 1R1A2 4B8EA 1QMJA 5KXCA 4YFWA 5FLJA 3VLBB 4E2SA 3K3OA 4FPHA 4JAAA 1MPXA 1ND3B 1V9U1 2DFBA 4XJUA 4AE2A 2D6OX 3ILRA 3MO4A 2BGPA 2HWC2 5E89A 5I0TA 2RM22 5C4WA 5C4WB 3SC7X 3USUA 3TEYA 2ENRA 2RDQA 1PIV1 2XBO1 5FZIA 1I1EA 3S6PA 2OXBA 2A3XA 3J26N 4HBNA 4LJHA 4Q0SA 3ZKYA 1WWYA 4WVWA 2JIJA 2Z4FA 3K51A 5FYSA 1YJLA 5L9BA 5ABJA 2PN5A 2B8MA 1YJKA 1YRZA 4Q27A 4XYXA 1JUHA 4KNCA 3BU0A 5DUWA 1BK0A 4HMZA 3G6JB 2JDHA 4L2NA 4S2FA 1H8VA 3N9PA 4AI9A 3ZXKA 3PU8A 1F5JA 4CTEA 5IVCA 3RYKA 1J84A 4XQ4A 3WD5A 1O6UA 2ZMNA 5E1RA 4QXHA 4BMEA 3FN9A 1ZRFA 4FFFA 3TOJA 2D6MA 1JZ7A 2KD7A 3Q8AA 2WQ8A 3A22A 4M4RA 1OQ1A 1CZSA 1H4HA 2YU1A 4JZRA 1LGBA 2RJLA 3VD3A 3WCSA 4F7ZA 5KXEA 4NMIA 2PQSA 1QOOA 1GZTA 2E32A 3UV9A 2J1EA 1NCQB 1UZVA 4XFBA 1UOGA 2EICA 5IYYA 2JX9A 2ZAAA 2IFRA 2OYZA 3RZJA 3ES4A 2V5YA 2E7AA 1KITA 4SBVA 4TSVA 5GJ6A 4ZU7A 2MNGA 1RUNA 5DXDA 3UGFA 1UY2A 4CDQC 3WP5A 1CAXB 4CDQA 4AQTA 3N7LA 2HWC3 1UOFA 2RM23 1OC1A 3I2KA 1H30A 2Q30A 2WWJA 3K46A 3SMHA 5DUXA 3VHNA 4A41A 1NKGA 5GM0A 4ISRA 3UGHA 4META 2PMWB 1NCRC 1W05A 3V64A 4BIOA 4RQPA 2R7EB 2IXLA 3VDCA 4GA9A 1NCRA 5J98B 4C1WA 4OUMA 2I2SA 1ND2C 1AYM1 3LPGA 2ZACA 3AB0A 3KGLA 1ND2A 4D7TA 1ZBA1 4BA6A 3MLJA
chains in the Genus database with same CATH topology
3K3NA 2OT7A 2Q8EA 2Q8CA 2GP5A 3PUQA 5FPBA 3N9OA 2W2IA 4EYUA 5FZFA 4BXFA 2VD7A 3UYJA 5FY1A 5FYMA 4CCNA 5F3CA 5F37A 5A7WA 3PUSA 3AL5A 2YPDA 5FUPA 3LD8A 4EZ4A 5F2WA 4CCMA 5FXXA 2XMLA 5FJHA 4CCKA 4EZHA 4HONA 5FZHA 2YBKA 5LW9A 4V2WA 3KV9A 5KR7A 5FZAA 2GP3A 5FZ8A 5E6HA 5FY7A 4V2VA 3K3OA 2OX0A 3N9NA 4ASKA 3U4SA 4QX7A 4DIQA 5F3GA 2XXZA 3KVAA 3K2OA 4UF0A 4XDPA 4D6SA 5FZ9A 5CEHA 5FZ4A 4IGPA 5FZIA 3DXTA 4D6QA 5FP8A 5A7WB 5IVEA 4IGQA 5FYSA 4Y3OA 5FY8A 5FZLA 5IVJA 5IVYA 3PUAA 3AL6A 5FYIA 5FYZA 4QXCA 4CCJA 4XDOA 5FZOA 4HOOA 5ISLA 5F32A 5FYUA 4QU1A 5F5AA 5FZKA 5FBJA 5FZ7A 5FZMA 5FJKA 3NJYA 5FZBA 3N9PA 4AI9A 3PU8A 5FP4A 5FYBA 5F39A 5FYCA 5IVCA 5FZCA 5FYVA 3ZLIA 4AAPA 4QXHA 3OPTA 5FZ0A 2OQ7A 4GJZA 3DXUA 2PXJA 5F3IA 5A7PA 4UF0B 5F5IA 4GD4A 4BU2A 4CCOA 4D6RA 5FPVA 5FY9A 2OQ6A 5LY2A 2YU1A 4Y4RA 5FZ1A 5A7QA 3KVBA 5IVVA 5F2SA 4DO0A 5FPUA 5LWBA 5FY5A 3N9LA 3N9MA 2XDVA 5FY0A 4CCLA 4LIUA 5IVBA 5A3WA 5FWEA 3KV6A 5FP7A 5IW0A 4CSWA 3ZPOA 5A1LA 5A3NA 4LXLA 5LY1A 5A7SA 5FZOB 2YU2A 3PU3A 4LITA 5FXWA 5A7NA 4QX8A 5K4LA 5A1FA 3AVRA 5FY4A 5FZEA 2Q8DA 5FZ3A 4LIVA 5FP9A 4GJYA 5FWJA 4E4HA 5IVFA 5FUNA 3KV4A 5F3EA 4BISA 4GAZA 5A3PA 4Y33A 2OS2A 3OPWA 5FZ6A 5ANQA 4CUGA 5FZGA 2WWJA 3KV5A 3N9QA 5F5CA 5FYYA 1VRBA 5A80A 3AVSA 3RVHA 4URAA 2YBSA 5FV3A 5FXZA 3PURA 4TN7A 4QWNA 5FPAA 3PTRB 5FYTA 3LDBA 5FZDA 2YBPA 2WWUA 5IWFA 5FYHA 2P5BA 3U78A 5FPLA 5A7OA 4NUBA 5A3TA 5FXVA 2XUEA 4IGOA 4QXBA 4C8DA 5FP3A 3PDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3N A;  2OT7 A;  2Q8E A;  2Q8C A;  2GP5 A;  3PUQ A;  5FPB A;  3N9O A;  2W2I A;  4EYU A;  5FZF A;  4BXF A;  2VD7 A;  3UYJ A;  5FY1 A;  5FYM A;  4CCN A;  5F3C A;  5F37 A;  5A7W A;  3PUS A;  3AL5 A;  2YPD A;  5FUP A;  3LD8 A;  4EZ4 A;  5F2W A;  4CCM A;  5FXX A;  2XML A;  5FJH A;  4CCK A;  4EZH A;  4HON A;  5FZH A;  2YBK A;  5LW9 A;  4V2W A;  3KV9 A;  5KR7 A;  5FZA A;  2GP3 A;  5FZ8 A;  5E6H A;  5FY7 A;  4V2V A;  3K3O A;  2OX0 A;  3N9N A;  4ASK A;  3U4S A;  4QX7 A;  4DIQ A;  5F3G A;  2XXZ A;  3KVA A;  3K2O A;  4UF0 A;  4XDP A;  4D6S A;  5FZ9 A;  5CEH A;  5FZ4 A;  4IGP A;  5FZI A;  3DXT A;  4D6Q A;  5FP8 A;  5A7W B;  5IVE A;  4IGQ A;  5FYS A;  4Y3O A;  5FY8 A;  5FZL A;  5IVJ A;  5IVY A;  3PUA A;  3AL6 A;  5FYI A;  5FYZ A;  4QXC A;  4CCJ A;  4XDO A;  5FZO A;  4HOO A;  5ISL A;  5F32 A;  5FYU A;  4QU1 A;  5F5A A;  5FZK A;  5FBJ A;  5FZ7 A;  5FZM A;  5FJK A;  3NJY A;  5FZB A;  3N9P A;  4AI9 A;  3PU8 A;  5FP4 A;  5FYB A;  5F39 A;  5FYC A;  5IVC A;  5FZC A;  5FYV A;  3ZLI A;  4AAP A;  4QXH A;  3OPT A;  5FZ0 A;  2OQ7 A;  4GJZ A;  3DXU A;  2PXJ A;  5F3I A;  5A7P A;  4UF0 B;  5F5I A;  4GD4 A;  4BU2 A;  4CCO A;  4D6R A;  5FPV A;  5FY9 A;  2OQ6 A;  5LY2 A;  2YU1 A;  4Y4R A;  5FZ1 A;  5A7Q A;  3KVB A;  5IVV A;  5F2S A;  4DO0 A;  5FPU A;  5LWB A;  5FY5 A;  3N9L A;  3N9M A;  2XDV A;  5FY0 A;  4CCL A;  4LIU A;  5IVB A;  5A3W A;  5FWE A;  3KV6 A;  5FP7 A;  5IW0 A;  4CSW A;  3ZPO A;  5A1L A;  5A3N A;  4LXL A;  5LY1 A;  5A7S A;  5FZO B;  2YU2 A;  3PU3 A;  4LIT A;  5FXW A;  5A7N A;  4QX8 A;  5K4L A;  5A1F A;  3AVR A;  5FY4 A;  5FZE A;  2Q8D A;  5FZ3 A;  4LIV A;  5FP9 A;  4GJY A;  5FWJ A;  4E4H A;  5IVF A;  5FUN A;  3KV4 A;  5F3E A;  4BIS A;  4GAZ A;  5A3P A;  4Y33 A;  2OS2 A;  3OPW A;  5FZ6 A;  5ANQ A;  4CUG A;  5FZG A;  2WWJ A;  3KV5 A;  3N9Q A;  5F5C A;  5FYY A;  1VRB A;  5A80 A;  3AVS A;  3RVH A;  4URA A;  2YBS A;  5FV3 A;  5FXZ A;  3PUR A;  4TN7 A;  4QWN A;  5FPA A;  3PTR B;  5FYT A;  3LDB A;  5FZD A;  2YBP A;  2WWU A;  5IWF A;  5FYH A;  2P5B A;  3U78 A;  5FPL A;  5A7O A;  4NUB A;  5A3T A;  5FXV A;  2XUE A;  4IGO A;  4QXB A;  4C8D A;  5FP3 A;  3PDQ A; 
#chains in the Genus database with same CATH topology
 2Q0A A;  2RS1 1;  2C9K A;  4FFG A;  4XFH A;  5SV5 A;  5JVV A;  1OOP B;  4FPG A;  5LZ6 A;  1G86 A;  1CAU B;  1S0G A;  1BXH A;  2ARA A;  4OHV A;  5H9R A;  2Y6L A;  1OLR A;  2AEN A;  4B1M A;  5FMB A;  4DXT A;  1PO1 2;  3B01 A;  4CA9 A;  1LR5 A;  2PHR A;  1UU6 A;  3MW2 A;  1SEF A;  3MIE A;  1H9P A;  2B9U A;  1ZRC A;  1HW5 A;  1DFQ A;  4LLO A;  4D3W A;  4XUQ A;  2TBV A;  4XXP A;  3THC A;  1SLL A;  4IV3 B;  1MZ6 A;  2JD9 A;  3EO6 A;  3NWK A;  2ZXQ A;  2WUH A;  4L11 A;  4CZS A;  4HK9 A;  1STM A;  1S2E A;  3T2Q A;  1SDW A;  1E5R A;  2VR4 A;  3CZJ A;  1HB3 A;  1HX6 A;  2PLV 2;  1NE6 A;  4XPV A;  5T3N A;  2BW8 A;  1SBD A;  3T1L A;  4UW3 A;  2P3J A;  1HRV 1;  1LES A;  2V09 A;  4W50 A;  1RXG A;  3WDY A;  1MZF A;  3HNB M;  2VJX A;  2PYT A;  1N1T A;  1ZA4 A;  5I0U A;  2W95 A;  1BLZ A;  1YLL A;  1OF4 A;  2IUW A;  2VO5 A;  4MGQ A;  4YM1 A;  5BNO C;  2ARC A;  1TMF 2;  2WN2 A;  1F31 A;  3B9C A;  5A32 B;  2NLR A;  1GKB A;  4UW4 A;  1DYO A;  1XND A;  3IWZ A;  1IG0 A;  4CDU C;  5IUQ A;  4OQ9 A;  1QXP A;  1QJX 2;  1RMU 1;  3C7H A;  4CDU A;  2PHU A;  1GV9 A;  1ZNP A;  4AVT A;  2E26 A;  2PHT A;  3ACI A;  4QU1 A;  2JD4 A;  4ZU5 A;  4AL9 A;  4MO3 M;  5FZB A;  4MSV A;  4OHZ A;  3KF3 A;  2CWM A;  3ZN6 A;  4K1Y A;  1CAW A;  1Q8O A;  1F4A A;  1W6M A;  4FTS A;  3PME A;  1RVF 3;  5K0U B;  1OA3 A;  2XJS A;  3POE A;  4DS0 A;  4UW6 A;  3I2I A;  4NID A;  2ZGO A;  4IE0 A;  3LA7 A;  3T4V A;  2WR9 A;  5C7G A;  1PO1 3;  3GBW A;  2RJ2 A;  1DGL A;  4W8J A;  1AYN 2;  4DUW A;  2GSY A;  4JGZ B;  4XFI A;  4XVH A;  4FCA A;  5IVV A;  3RI8 A;  5F2S A;  5JXG A;  4M3C E;  4ZPI A;  5A3W A;  2E7Q A;  2EXK A;  2WJS A;  5HCH A;  5A1L A;  4LOT A;  3ZYH A;  5FO7 B;  3D3A A;  3FFQ A;  4H7L A;  3OY8 A;  1WW4 A;  1QIQ A;  4LIV A;  1WW5 A;  1RUF 3;  4AG4 A;  3LE0 A;  3E97 A;  2K2S A;  3MIH A;  1L7L A;  5A6X A;  4CDW C;  5A3P A;  5CKN A;  5FLI A;  4DY3 A;  3IAQ A;  4QB2 A;  1PVC 1;  4KMQ A;  5ANQ A;  4CDW A;  1CR7 A;  1UZW A;  1X33 A;  3HIF A;  5KC6 A;  2VCC A;  3POB A;  2GNM A;  1K5J A;  4LQR A;  1TMF 3;  3LIH A;  1UIK A;  1H8T A;  2FDG A;  5JSR A;  4FP2 A;  1GZW B;  4YZ1 A;  4JRA A;  3KSC A;  3GZU C;  3PLQ A;  4M00 A;  4URA A;  1MQT B;  2F17 A;  4LBQ A;  4Z07 A;  2DYC A;  2Y0I A;  3RYR A;  5J09 A;  4QDQ A;  1QJX 3;  1KJR A;  1FOD 3;  2FBE A;  1HXS 3;  3OEB A;  4XJ9 A;  4DXS A;  1P8J A;  2BZD A;  3TAY A;  2D5F A;  2ZEZ A;  1DU3 D;  3JQX A;  4XFF A;  1MS8 A;  4PF1 A;  5IJR A;  5A3L A;  2D3S A;  4W6W A;  4NAM A;  2JEN A;  4LR4 A;  3WY6 A;  2XJV A;  5J37 A;  3VGI A;  1KDM A;  2W08 A;  2XJQ A;  4L97 A;  1RL3 A;  1H2M A;  2WAB A;  3UYJ A;  5FYM A;  4QQ2 A;  1VAM A;  2QQW A;  1CIY A;  1VB2 A;  3N7J A;  2PHX A;  3MHZ A;  3ZFG A;  3FZ3 A;  2R1D A;  3I2J A;  3NQH A;  4DXZ A;  1IPK A;  4GQ7 A;  5FTT C;  5FZH A;  5LK5 A;  5A6Z A;  5LW9 A;  2MEV 2;  3POF A;  3KV9 A;  3J8F 2;  2Q1Z B;  1AR8 2;  2E9Q A;  2VBB A;  3V65 A;  1W03 A;  1UZZ A;  5JLV A;  3SIT A;  3UL2 A;  4C91 A;  5BNP C;  4Y1V A;  4DRV A;  3U4S A;  1DGW X;  3ZN5 A;  2VOW A;  3DEM A;  4QX7 A;  1XE0 A;  4CP1 A;  3LAG A;  1DLC A;  1W9W A;  3VBR C;  1PMI A;  1MVQ A;  4FVV A;  5FZ9 A;  5T5O A;  3VBR A;  4MG2 A;  2HWF 2;  1LGC A;  4N53 B;  4NRQ A;  1OLM A;  4I3G A;  1JXN A;  2J1S A;  1OSG A;  1UY3 A;  2A7A A;  4M0N A;  4GWM A;  3HBZ A;  1ZBE 1;  4CUA A;  4RHV 3;  4LBQ D;  1LHW A;  4NVP A;  5CAD A;  2UUR A;  2WO3 A;  4NR1 A;  2ZML A;  2FDK A;  5JMO A;  4BQX A;  4GAL A;  1U5X A;  4N43 B;  1YI7 A;  1PX4 A;  2CV6 A;  2JEM A;  5FYZ A;  3T0B A;  4A7K A;  2VUD A;  1GR3 A;  3OGR A;  3ZSK A;  5AFE A;  5JXJ A;  4A42 A;  1Z0H A;  4LO8 A;  1IKP A;  1LU2 A;  2WKK A;  3MFA A;  2B9V A;  3ACF A;  3H1M A;  4XMI A;  1DCS A;  2ZTN A;  1RHI 2;  2WS9 2;  3ZLI A;  5FPZ A;  3OPT A;  4XTP A;  4AI8 A;  1X8M A;  3LEG A;  3FHI B;  3B00 A;  3RQ0 A;  4GD4 A;  3ZN4 A;  5L36 A;  5FY9 A;  2BBV A;  4QKN A;  4FAH A;  5HCA A;  4Y5Z 0;  5LY2 A;  1W99 A;  4LO7 A;  4EQV A;  1ULO A;  5DG1 A;  1DQ6 A;  4JHZ A;  2WNU C;  1O4Z A;  1TEI A;  5AFB A;  4WZC A;  4GH4 C;  3QAC A;  4GWI A;  2WNU A;  4RR3 B;  2CGO A;  1VMH A;  3C3V A;  4GH4 A;  5FP7 A;  1PM4 A;  2Q1M A;  4PLM A;  3LOI A;  1GQG A;  1PGL 1;  1F4H A;  1JS9 A;  4JTN A;  4MGZ E;  3HOB A;  1HB1 A;  1WA4 A;  3VDA A;  1JZ5 A;  5DUV A;  2WNO A;  3J8F 3;  1AR7 1;  4AVV A;  5FY4 A;  3U10 A;  5A6Y A;  3T0D A;  3ZYG A;  3DKW A;  2J1A A;  2VNR A;  1PIV 2;  2XBO 2;  1BYH A;  2IZW A;  3IDC B;  2ZMK A;  1Y4W A;  5FUN A;  1AHS A;  2W92 A;  1VBA 1;  4FTE A;  3UJQ A;  1RIN A;  4OFG A;  2Y8K A;  4AFC A;  1KRI A;  4PQ9 A;  1VRH 1;  3KV5 A;  4HKO A;  3RFR A;  3S5A A;  4AHZ A;  4BK5 A;  4F3J A;  3M3I A;  5JOY A;  3WV6 A;  4Q0P A;  2PTM A;  3VD9 A;  4Y1Z A;  1J1T A;  3JD7 3;  4A44 A;  1JZ4 A;  3LA3 A;  2VZS A;  3WDU A;  4U2A A;  4PHZ A;  4B7K A;  1HRI 1;  5FZD A;  3W5M A;  3IDB B;  4ZHN A;  1VJ2 A;  3WP6 A;  3VBO B;  1KS5 A;  3VD5 A;  4IGO A;  5DAB A;  3IPV A;  1BEV 3;  1SBE A;  3E6B A;  4LBL A;  4PT6 A;  2Q8E A;  3ZM8 A;  2G9Z A;  2GP5 A;  2VTX A;  1AUY A;  2VEC A;  4AFD A;  1W8N A;  4C0H A;  2I07 B;  4GIQ A;  5JSP A;  4GWN A;  1Q8P A;  4PDW B;  5F5Q A;  4ATE A;  5KHK A;  5F37 A;  1DZQ A;  2I45 A;  2B45 X;  4FPJ A;  3Q8B A;  1ST8 A;  3PUS A;  4DEV A;  5IK4 A;  1YQ6 A;  3CDZ B;  5FUP A;  1XRU A;  2WZP P;  3N4M A;  1L7Q A;  2AUY A;  2CHH A;  1BCX A;  3AK0 A;  3I3Q A;  3JQW A;  3WNL A;  4EWE A;  4LE3 A;  3VB9 A;  2J1V A;  5GLU A;  2H6C A;  4KH9 A;  4B3N A;  5HXM A;  1GWL A;  4V2W A;  5FZA A;  1JHJ A;  1LHV A;  1V9U 3;  3AYC A;  3J7M A;  2DCT A;  2WA4 A;  2X5I C;  1UX7 A;  1O8S A;  3MPP G;  4BIF A;  2EXI A;  4FPL A;  2YG0 A;  5CFD B;  4MOA A;  5CA6 A;  1PIV 3;  1J58 A;  5C3R A;  5JPN B;  1IS5 A;  4QPG C;  1T6B X;  3BTA A;  5FZ4 A;  1YC6 1;  1IKQ A;  2A6W A;  3NV3 A;  1DLL A;  3DYM A;  4QPG A;  3S7E A;  3NST A;  4K20 A;  2PHL A;  3VDD B;  3G7D A;  2ARE A;  2C24 A;  1AYM 2;  5FY8 A;  4NRP A;  5IVY A;  1RIT A;  3FE5 A;  4QPI A;  1FAT A;  3IDE A;  2C4X A;  3A0N A;  3FLT A;  3VKL A;  1ZBA 2;  2RS1 2;  1MS5 A;  1PK6 A;  1UCX A;  2JDK A;  2NMN A;  3VBF A;  5FRA A;  3HQU A;  4Q5O A;  4XJA A;  5GZF A;  2HWE 3;  3VBH B;  4JDM A;  3S7I A;  1RUH 3;  3I49 A;  1W6O A;  2QDN A;  1QNY A;  3SH4 A;  1EV1 1;  5D1I A;  3WNK A;  4DNY A;  1QWR A;  1Q8Q A;  5IHR A;  3CQO A;  4I0B A;  3BPS A;  3TN9 1;  1AL2 3;  3O0V A;  4UF0 B;  5F5I A;  5APA A;  3NRU A;  1O4Y A;  2WO1 A;  4AED B;  2PAK A;  5F6L B;  1WLC A;  2Q8O A;  1K12 A;  2JG9 C;  4ASM B;  5JIU A;  4K8F A;  1ZM1 A;  3N7M A;  1XYO A;  3POJ A;  4CCL A;  4LIU A;  4MHU A;  3KV6 A;  3ZYB A;  3JCI A;  2YGL A;  3IBM A;  3CJI C;  1QNW A;  4XHB A;  5JOZ A;  4LEJ A;  2XJR A;  1HRV 2;  4M3C B;  2EF6 A;  4IEP A;  3FMG A;  3CKH A;  5ANN A;  2W9X A;  5FZE A;  3J7L A;  3AZV A;  1Y43 B;  1QOS A;  2P17 A;  1YYN A;  1DYK A;  1XNB A;  1YQC A;  4NPM A;  2VTF A;  5JDB A;  3MW4 A;  3U75 A;  4A2U A;  5CKQ A;  2ZHM A;  1RVF 1;  2JG8 C;  4P9I A;  1JZ3 A;  3O0W A;  2D43 A;  3N36 A;  1RMU 2;  2DCZ A;  5C3P A;  1W6N B;  2VUA A;  4I01 A;  3ZMO A;  3RVH A;  1W6P A;  4PQQ A;  3UGG A;  4XIL A;  2HYX A;  4IE6 A;  5L7O A;  2Y64 A;  3E5X A;  2UWB A;  1JYC A;  2RR1 1;  3KCC A;  2A3W A;  3QD6 A;  1XNA A;  2R49 A;  3NW4 A;  5L19 A;  4MGI E;  4HSL A;  5BNN B;  1ZZ9 A;  1N1Y A;  5CIR A;  1LHN A;  1RIR A;  5I8S A;  4YW3 A;  4ARX A;  4EN9 B;  2CAU A;  1HQN A;  5EZW A;  3I4I A;  1OFN A;  2FQP A;  3LEI A;  1VP6 A;  3KS7 A;  3WDX A;  5FY1 A;  5H9P A;  3VN4 A;  1RUF 1;  3N35 A;  2QDR A;  3F2Z A;  1FI2 A;  1NOV A;  2DFC A;  2IWG B;  2ZAH A;  3A23 A;  1E5S A;  3W21 A;  1WCS A;  5IK7 A;  3FUQ A;  4JTO A;  4FAG A;  4A7Z A;  4LUL A;  5FKB A;  2XPJ A;  4CCM A;  5FXX A;  1O4T A;  3PUI A;  1H6Y A;  4WM8 C;  5EWS A;  3NAP B;  2VZ1 A;  3DEC A;  4K6B A;  4WM8 A;  4ONU A;  3N7K A;  5HCB A;  1UY0 A;  1C5H A;  3EHK A;  1QOT A;  1Q5O A;  3APB A;  3HQX A;  1FOD 1;  4RGG A;  1HXS 1;  2XLF A;  3N9N A;  1PVC 2;  4WVZ A;  5C71 A;  1W2A X;  4Q2F A;  1LEN A;  1F35 A;  2EAL A;  3AP7 A;  2VMG A;  1SCR A;  3INA A;  2BFU L;  1IG3 A;  3QH6 A;  2P6C A;  5D8A B;  3K48 A;  2VXJ A;  1RMU 3;  3EQE A;  1IS6 A;  3M2M A;  4IGQ A;  5IVE A;  1G9C A;  3H1W A;  1WUV A;  3K77 A;  1ZZC A;  1PGW 1;  2YZ4 A;  3WEZ A;  5FZL A;  4TZD A;  1DQ4 A;  2BJS A;  2WWS A;  3I59 B;  3JBG 1;  2DUO A;  1IQA A;  3WOG A;  3PJY A;  2EXJ A;  3SNM A;  4Y26 A;  1WGP A;  4CCJ A;  2DBN A;  4YWA A;  4RS5 B;  3UKV A;  4AYU A;  2QZ2 A;  5F5A A;  3F95 A;  1NYW A;  4BCU A;  2RHP A;  4D0Q A;  4MV2 A;  5G04 L;  1S0E A;  2R0H A;  3H7J A;  3WLU A;  1DZT A;  4YM3 A;  1H6X A;  3RG0 A;  3ALQ A;  3JU9 A;  1UX6 A;  1K5M C;  4BLI A;  2BVB A;  2VZU A;  4KWK A;  4NPL A;  2D40 A;  4Z2A A;  3ZXA C;  4Y4R A;  1PNG A;  2IC1 A;  2K0G A;  3KVB A;  1WBF A;  4ITC A;  3SKV A;  2AR6 A;  4CP9 B;  2XDV A;  5FR3 A;  3ZDS A;  2VMD A;  1W8W A;  3H1Y A;  3WW2 A;  3ZPO A;  1OH3 A;  1RED A;  2G1M A;  2Y60 A;  5JZG A;  3MZH A;  4RHV 1;  2X10 A;  2A1X A;  3BN6 A;  5FZO B;  4LIT A;  2HJI A;  2VPV A;  4QX8 A;  5K4L A;  5A1F A;  1GNH A;  4QQL A;  2Q8D A;  4CXX A;  1WA6 X;  4JV4 A;  4HN0 A;  4MUV A;  2XHK A;  2IXK A;  3OUH A;  5CU1 A;  1PVC 3;  4KBZ A;  1HLC A;  1NLS A;  4OHX A;  4AWD A;  1W0O A;  1LOA A;  1WCU A;  1ZBE 2;  3M8L A;  4JVA A;  2ZZJ A;  3POY A;  2RMU 1;  4YVS A;  1B35 C;  5C8C B;  3BIW E;  1BQP A;  4YFZ A;  4N8M A;  4UFM A;  1B35 A;  3WHT A;  2QZ3 A;  5B4X A;  3DF0 A;  5FV3 A;  2GNT A;  3V0A B;  4TXW A;  4KWU A;  3H42 B;  1URX A;  5GKA C;  2FZ2 A;  2D3R A;  1COV 3;  2JDU A;  2ET1 A;  5FXV A;  3FX3 A;  3BPZ A;  3RMY A;  5LEJ A;  1Q56 A;  2RDS A;  2Y6K A;  4UFJ A;  4XCA A;  4XF3 A;  4CDX B;  3AMP A;  3ITQ A;  3JB4 C;  3SKJ E;  2B46 X;  2F4L A;  5E8A A;  4P9X A;  5CFC A;  1UYX A;  5CFC B;  3D6E A;  3Q8C A;  4CUB A;  2DUQ A;  3ZSM A;  3OF1 A;  4E8C A;  1V00 A;  1W90 A;  1PGL 2;  2P37 A;  2ARX A;  5KXB A;  5DG2 A;  5LBB A;  3S30 A;  4W4Z A;  2VOX A;  3ELN A;  1UZ0 A;  3I3B A;  4TWT A;  1AR7 2;  2BP6 A;  1NE4 A;  2QVS B;  4NHL A;  4Q0U A;  2FDI A;  1XB9 A;  1YXW A;  3OJB A;  4LTA A;  5BYN A;  3JD7 1;  1AJO A;  1VBA 2;  1WCD J;  4LE4 A;  3E5Q A;  2PA7 A;  1SCS A;  4JQT A;  4BQ3 A;  2ZPX A;  1VRH 2;  4MGT A;  4J1W A;  4ATF A;  5LRS A;  3AXE A;  3KQ4 B;  1J3Q A;  2K46 A;  1BEV 1;  5GZE A;  2XGX A;  5CIS A;  1K45 A;  5GZD A;  1QF3 A;  1ZBE 3;  4PIY A;  4Q26 A;  4D6Q A;  3H8R A;  1SHW B;  4Y5S A;  1N1V A;  4FQZ A;  1GP4 A;  5DZG A;  3ZIX A;  4W6Y A;  1HRI 2;  3C7G A;  4ISQ A;  5T5P A;  5B4N A;  2FCU A;  3DCQ A;  3O12 A;  4Z1V A;  1TZO A;  2XR4 A;  3RYP A;  3KCY A;  3AL6 A;  2RS5 3;  2CTV A;  1I3H A;  5LBF A;  3DN7 A;  5ISL A;  4E4S A;  1VBC 3;  1NLQ A;  2UU8 A;  2X29 A;  3CNA A;  4BQ4 A;  4MXW B;  1JYT A;  2ZGR A;  2JKX A;  5FBJ A;  1HV0 A;  1Y9Q A;  1QJZ A;  3ES1 A;  3POS A;  2KM2 A;  1YQ2 A;  1BJQ A;  2ADD A;  3RSJ A;  4BQY A;  3RRD A;  2X8K A;  3GZA A;  3MUZ 1;  5F39 A;  3ZO0 B;  1HN1 A;  1OLM E;  4AAP A;  3RZM A;  5F8P A;  3P5B A;  2R6Q A;  1PZ9 A;  5JPM B;  4OI4 A;  1C8M 1;  3R05 A;  5A3U A;  5C33 A;  1V70 A;  1ZRR A;  3USU B;  5KBF A;  3LWC A;  4BDV B;  4Y20 A;  3AKS A;  1EY2 A;  3AJZ A;  4MGK E;  1MS3 A;  4P02 B;  5DUU A;  5A7Q A;  4BYY A;  1KS4 A;  5LWB A;  3PIG A;  2WSU A;  4AW7 A;  5ABJ B;  5FY0 A;  1D7P M;  5CNA A;  2MPF A;  4CSW A;  1AR7 3;  3OGS A;  1OA2 A;  1NA1 C;  3HN3 A;  3O1V A;  1ND3 C;  2QCS B;  2CY6 A;  2YU2 A;  5FXW A;  3GBF A;  1NA1 A;  2AZ5 A;  2EIB A;  1Q43 A;  2PHD A;  3VL8 A;  1VBA 3;  2LW8 A;  3R0R A;  2VQT A;  1ZRI A;  2R1B A;  3ZFE C;  4PBO A;  1VAK A;  5CB7 A;  1JZ8 A;  2HWE 1;  1VRH 3;  1RUH 1;  3I3D A;  2B5H A;  1V6K A;  4FPC A;  4GZ9 A;  3ZFE A;  4BIS A;  4OI0 A;  3OPW A;  4D7Y A;  4CUG A;  3VZN A;  3EXU A;  4QKF A;  3D4K A;  4OUL A;  5FYY A;  4CP0 A;  3AYA A;  1HRI 3;  1BVV A;  2C5D A;  2VGD A;  3NV4 A;  1AL2 1;  5SV8 A;  2O1Q A;  4W6X A;  5C6C A;  3AP5 A;  1XU1 A;  3R4U A;  1W9T A;  3PTR B;  3WUD A;  2P5B A;  3U11 A;  1EV1 2;  1QJE A;  4KGQ A;  5JXH A;  2NPI A;  3CZU A;  4QKB A;  2OQ6 A;  1NT0 A;  1W2U A;  3C8X A;  4FPF A;  5FK8 A;  2P34 A;  3TN9 2;  1KDK A;  2WT0 A;  3PUQ A;  3N9O A;  4FFI A;  3WX5 A;  1YIP A;  5I0D A;  5FZF A;  4NPR A;  4NII A;  1E5H A;  1FPN 3;  3VDB A;  4JCK A;  4CDQ B;  2EIE A;  2R0F A;  2QFE A;  1Q8S A;  1W9Y A;  3H0O A;  4FPK A;  4KL1 A;  2JWP A;  5JAX A;  1V6J A;  4EZ4 A;  3GDB A;  3VZJ A;  1OUR A;  3D5O A;  2W1S A;  4AOC A;  3V0B A;  3L9J T;  4UFH A;  4HON A;  1REE A;  5EV7 A;  1FNY A;  3T4H B;  4RQP B;  3KMH A;  5K8S A;  4AHY A;  3AMN A;  1CJP A;  5DPN A;  1NCR B;  2FD8 A;  2QQN A;  3LEM A;  4IL7 A;  2V72 A;  2W46 A;  5FLH A;  2FMD A;  4CCO A;  1ND2 B;  2BGO A;  1MS0 A;  1RVF 2;  4IEX A;  1CZV A;  2E33 A;  2JIG A;  3WUC A;  1UPS A;  1VPH A;  3LCP A;  4Y22 A;  4Q0V A;  5FIX A;  4AGR A;  3H3U A;  1QJF A;  1ASJ 3;  4XDP A;  2QBX A;  4N7I A;  4H14 A;  4LOS A;  3VKN A;  4I02 A;  4QDR A;  4XAC A;  3JUU A;  4K3U A;  1ULD A;  4XE9 A;  1ACC A;  2VNO A;  4OMC A;  4LMF A;  2RR1 2;  4M4P A;  3TYJ A;  2OUH A;  5FYI A;  3RZL A;  3JZV A;  1W2T A;  1HV1 A;  3ME2 A;  2X05 A;  2J1R A;  3WW4 A;  1OOP C;  1US2 A;  3HWJ A;  1WCQ A;  2BTV C;  4XF1 A;  4DB5 A;  1EV1 3;  4D94 A;  4FT8 A;  3HBK A;  2XOM A;  3O7O A;  4YW1 A;  2DV9 A;  1A6C A;  3D0S A;  4MX3 A;  1RUF 2;  1GAN A;  1XSR A;  1S55 A;  2OVU A;  1ZVF A;  3ZFF C;  2VQU A;  1UMZ A;  5KXD A;  1GFF 2;  3ZFF A;  2P1B A;  3POI A;  4L8Q A;  1PHM A;  4KBB A;  3SCH A;  2ZKN A;  4XUO A;  2JE8 A;  3RZZ A;  2PAM A;  4YZ3 A;  3LDK A;  3EYP A;  3WDW A;  4E4Z A;  1UIJ A;  1OF3 A;  5BNO A;  5BNO B;  4H7M A;  3OBT A;  5CYY A;  5T52 A;  3AZW A;  4LBM A;  3BTX A;  3WF4 A;  4IV1 C;  1NY7 1;  1WLD A;  3AKP A;  4KU8 A;  1FOD 2;  1F15 A;  1HXS 2;  4IV1 A;  4MXV A;  4OMD A;  2VNG A;  4CDU B;  2O8Q A;  4COY A;  3LOB A;  3PU3 A;  3OD4 A;  5HPO A;  2XQX A;  1M06 G;  4XUN A;  1CWP A;  5FBZ A;  4OZO A;  2ZOE B;  3ZN6 B;  4JDO A;  1CAW B;  2EIG A;  3VUO A;  1W6M B;  1WMX A;  4FOV A;  5F3E A;  5HXV A;  3U14 A;  4GAZ A;  4OYU A;  2QNK A;  4EN8 B;  1GU3 A;  4BPZ A;  1PGW 2;  1S1A A;  2ZGM A;  3B7M A;  3M3Q A;  1YQ8 A;  1SFN A;  3JBG 2;  1GZ9 A;  1G9D A;  4YNI A;  2W39 A;  1W9F A;  2VMF A;  1HQW A;  5C70 A;  3ROU A;  5AC9 1;  5ACA 1;  2RR1 3;  5FXZ A;  3W20 A;  3GNE A;  3BAL A;  1DQ1 A;  2WWU A;  1AVB A;  5FYH A;  1MS1 A;  5K0U C;  1HB2 A;  2VNV A;  1IGO A;  4P9J A;  3VKM A;  3NV1 A;  4IEO A;  4O9G A;  3GHN A;  1PVX A;  1SLA A;  4UFI A;  4QXB A;  3OY8 B;  3DPR C;  4F83 A;  1E57 A;  4OI2 A;  3WQ1 A;  4AHW A;  3DPR A;  2UYA A;  2WLP A;  3QBQ A;  1IQD C;  2R06 3;  4JGZ C;  1VB4 A;  2VBD A;  4BXF A;  3JXS A;  3D0J A;  3TEW A;  3OTF A;  2JDN A;  1TNR A;  4CDW B;  2A70 A;  2OII A;  4FQ4 A;  4BXS V;  1YFX A;  1SBF A;  1W6Q A;  3LD8 A;  1H8T B;  1WZX A;  4RHV 2;  4WBB A;  3T0A A;  5FJH A;  4Z92 B;  1RJ8 A;  2MHF A;  2CDP A;  1X7N A;  4S2H A;  1Q8V A;  4LBQ B;  5GLW A;  4O61 A;  2DVB A;  2VVF A;  4R8H A;  2VVD A;  1LTE A;  2VH9 A;  5KR7 A;  3OB8 A;  2GP3 A;  1UXZ A;  2A75 A;  1AR6 1;  3ZPY A;  4EN0 A;  3PJQ A;  1UYY A;  4GWJ A;  1H0B A;  5F1R A;  3GCX A;  4TYS A;  1COV 1;  1Y9M A;  5JSO A;  2RMU 2;  5FMD A;  2YGM A;  2JDA A;  4YRD A;  4YZ4 A;  3VZL A;  4CE8 A;  1UPI A;  4HPK A;  1UO9 A;  3KVA A;  4WM7 C;  4A6O A;  2FCV A;  3BI3 A;  2QE3 A;  4COV A;  4WM7 A;  1MQT C;  2A6Z A;  2VXR A;  3JBG 3;  2VZP A;  5H9S A;  3MW3 A;  1BK1 A;  1UOB A;  3L2Y A;  5FP8 A;  4AXO A;  1NQJ A;  1C28 A;  1U5Z A;  2GC0 A;  2W1U A;  5CAZ A;  4HG6 B;  4JC1 A;  1Y7B A;  4Q4X 3;  3ZFG B;  1XNC A;  3HT2 A;  4MHR A;  2ZHN A;  3RDI A;  2WT2 A;  1XE7 A;  4FPO B;  3KF5 A;  1QY4 A;  1X82 A;  2CYF A;  3I8T A;  2PAE A;  2VVE A;  2QQV A;  1OBN A;  4NRM A;  2BNM A;  2BVV A;  1OQE A;  1JOD A;  1W2N A;  4ZU4 A;  1O3S A;  1L3J A;  1SMV A;  2Y6F A;  1GQH A;  4XQD A;  1BZW A;  1POQ A;  1W39 A;  3ILF A;  1IZ3 A;  2BOI A;  4K40 A;  3GZE A;  3SQO A;  5BNP A;  2HEW F;  1GOF A;  2UWA A;  4N9I A;  1OPM A;  1GYK A;  4WVM A;  5J3U A;  3USS A;  4D6R A;  3OUI A;  3VBR B;  2W5F A;  3GXU A;  1ZZ7 A;  2E7T A;  2ORX A;  3I54 A;  4NIA A;  2D93 A;  3JD7 2;  1YFU A;  1DGR A;  3H3L A;  4XZU G;  3MF9 A;  3PNA A;  1LOE A;  5DN2 A;  3ZIW A;  3PVE A;  2VY0 A;  3WP3 A;  1LOF C;  1ULE A;  3PTY A;  4UT5 A;  2W68 A;  4YVW C;  4EN6 B;  1LOF A;  2BDR A;  2RS5 1;  4YVW A;  4DIN B;  5EIY B;  3CF6 E;  3O1O A;  2Y6G A;  1TE1 B;  1VBC 1;  1BEV 2;  2JDM A;  3OBZ A;  3T2O A;  3WVJ A;  3O1P A;  2O14 A;  2WC2 A;  4N53 C;  1DZR A;  1UMH A;  2XJT A;  2VZT A;  3WR0 A;  1D0G A;  2RMU 3;  1W2O A;  1TME 1;  3ILN A;  2WFP A;  3ZYI B;  5KHJ A;  4LT5 A;  2ZS6 B;  4I2O A;  1JUI A;  2BNN A;  2E63 A;  2G9G A;  2B42 B;  2GAU A;  1RC6 A;  3N9Q A;  4MGS A;  4Q4V 3;  2E51 A;  3TN9 3;  1MZ5 A;  4N43 C;  5A80 A;  2BWA A;  1RUG 3;  2HEY F;  4AVS A;  5GLV A;  3CLP A;  4R52 A;  4D8M A;  3BGA A;  3WCR A;  2BV4 A;  4LHS A;  2O8O A;  1UD1 A;  2PHW A;  4LBN A;  3M1H A;  2DVD A;  2WNU B;  4GH4 B;  1LOB A;  1S2B A;  3P1I A;  1V9U 2;  2XUE A;  4XF0 A;  4B4P A;  3BCW A;  3FC0 A;  4I0A A;  3K75 B;  1C8M 2;  1W8O A;  3KT4 A;  3HN1 A;  4M01 A;  3O1M A;  1EPW A;  2D97 A;  4PJY A;  5EYX A;  3VHR A;  1H2L A;  1FMD 3;  3MI8 A;  4ZS3 A;  1IPS A;  1CGP A;  4CEW C;  2W0X A;  4QU2 A;  4DUV A;  3HR9 A;  3AKT A;  2VW0 A;  3EJK A;  4CEW A;  1FYU A;  4RR3 C;  3UET A;  3VHP A;  3AL5 A;  3MIC A;  4W65 A;  2C6S A;  1R64 A;  2B39 A;  5C3Q A;  4QMA A;  2DWR A;  3LPF A;  4GKY A;  2VOK A;  5DDJ 1;  2ORZ A;  4QM8 A;  3IMM A;  3WG2 A;  1TG7 A;  2I74 A;  5LK7 B;  1KQR A;  4NRO A;  2OUJ A;  3B69 A;  1SQ4 A;  5BUV A;  2HYK A;  1ZZ6 A;  3UK9 A;  4ZKT B;  2HWE 2;  1RUH 2;  3GJB A;  1REF A;  4IEY A;  2BWC A;  1K3I A;  2DUR A;  2G4I A;  5I8T A;  3M3E A;  3IPV B;  2Z5W A;  3AZZ A;  4ASK A;  3AM2 A;  5I91 A;  1N1S A;  5IAV A;  4LK7 A;  4XBQ A;  4I3P A;  2FDH A;  5CEH A;  4QX0 A;  1IOA A;  1CN1 A;  2ES3 A;  1AL2 2;  3QCW A;  3ZXL A;  5F7U A;  1SLI A;  3WZ1 A;  4UAP A;  2ZAB A;  1D2S A;  2DU1 A;  1FPN 1;  2NN8 A;  5HCF A;  5DMY A;  1PO2 3;  1CPM A;  2JDZ A;  3H8X A;  1AX2 A;  3VBO C;  3AXD A;  5LA1 A;  3H8O A;  4XJW A;  5BPX A;  4QXC A;  3OUJ A;  4Q4Y 1;  2P2K A;  3PHM A;  4Z82 A;  2YC0 A;  3CBN A;  1CIW A;  4DRR A;  3S0M A;  2R04 3;  5FZM A;  3MLK A;  3SCF A;  4HK8 A;  1C8M 3;  4G9S B;  2A6Y A;  2HEV F;  2X5I A;  1SZB A;  3DKQ A;  1ODN A;  3POG A;  4P5Y A;  5FUI A;  4DEQ A;  2W47 A;  4JGY C;  4Y1Y A;  3K4A A;  3U4X A;  1W8H A;  4JGY A;  1IS4 A;  1OKO A;  2DVA A;  1OUS A;  2EXH A;  3RZH A;  4QPG B;  3RMX A;  4CU6 A;  1ASJ 1;  3ACG A;  3ABZ A;  3ZVX A;  5IK5 A;  3P6B A;  1QDO A;  1WMD A;  1W28 A;  4HT1 T;  4G4F A;  4V1P A;  2VUJ A;  3N9L A;  3HEI A;  3IDA A;  4YG3 A;  1GP6 A;  1CX4 A;  1NZI A;  2QUO A;  4QPI B;  5FKC A;  3J7N A;  2BUK A;  1OLQ A;  2P3I A;  1PK6 B;  4M3C F;  3VBF B;  3I2G A;  5JOW A;  2PHF A;  3A7Q A;  4XUR A;  1W6O B;  1Z7S 3;  3AFG A;  1QXJ A;  4IEZ A;  1UOJ A;  1YUD A;  4OUE A;  4P9W A;  4BMB A;  3ZKU A;  2YV8 A;  4LPL A;  4JKL A;  4BQ2 A;  3B9I A;  1VBE 3;  3OD0 A;  1VRB A;  4PI0 A;  3T30 A;  3OSD A;  4DY5 A;  2D6K A;  4XJ8 A;  3FBM A;  1JOB A;  1GUI A;  2JG9 A;  2RE9 A;  4YLZ A;  5FPA A;  4EZH A;  1ULF A;  2HLE A;  1EAH 3;  2ZKL A;  1ZZ8 A;  3OG2 A;  1MS9 A;  2ADE A;  1RUJ 3;  1SG3 A;  3CJI A;  2GNB A;  4FI9 A;  5FP3 A;  4BH9 A;  3MYX A;  1YWK A;  3ON7 A;  1AR9 1;  1JH5 A;  1VAV A;  1VBD 3;  3NV2 A;  3UES A;  1PZ7 A;  5FPB A;  1SFP A;  3M4F A;  2AEY A;  2LTN A;  5FRE A;  4AED C;  4CCN A;  5LEK A;  1G8W A;  3DV8 A;  4E8D A;  2XVG A;  5F3C A;  4BLJ A;  4YW2 A;  3E5U A;  1V6O A;  4Z8B A;  1NY7 2;  4K21 A;  2JG8 A;  4Y1X A;  3OPZ A;  3LIG A;  2YPD A;  2JG8 B;  4PI2 A;  5JUV A;  1PM7 A;  4XF4 A;  4AI3 A;  2XML A;  1RUC 1;  1W6P B;  2VOV A;  3LFI A;  1DGR N;  1IHM A;  3AZX A;  5BV6 A;  4QHB A;  5JMC A;  2YBK A;  3AC0 A;  4XHX A;  4R9C A;  2VMC A;  5L7O B;  1CAV A;  1VR3 A;  4XC9 A;  2WZR 1;  3M7A A;  1O3R A;  5EXO A;  4LA3 A;  3T2T A;  1OPO A;  3WP4 A;  4LK6 A;  1OD5 A;  4A4A A;  4KWJ A;  4Q1R A;  2GAL A;  4DIQ A;  2Y6H A;  5AVP A;  5FQ0 A;  2XXZ A;  4X8P A;  2ZX4 A;  2JDP A;  1ONA A;  1WLW A;  1F5F A;  1C4R A;  1J1L A;  1XBF A;  4NHK A;  4P00 B;  4AI0 A;  1QQP 3;  5AC9 2;  2SLI A;  3DL3 A;  4XIO A;  2G19 A;  2R06 1;  3POW A;  4RSU A;  4QGM A;  4GXL A;  1W0N A;  4XET A;  3D8C A;  4Y5T A;  4BJ0 A;  3E1F 1;  1D4M 3;  3BVC A;  1GBG A;  1QU0 A;  4NAO A;  2VZR A;  5CVR A;  5L9V A;  1MAC A;  5BNN C;  2CAV A;  2HWD 3;  3PVN A;  3FFZ A;  2VZQ A;  1GP5 A;  4NJ4 A;  4WM8 B;  2XVL A;  3H8U A;  4HET A;  4MGY E;  5FP4 A;  3ZR6 A;  4BK4 A;  4XTM A;  4CUC A;  5C5U A;  1UN1 A;  5FZC A;  3LEK A;  3GGL A;  1JYW A;  2ATF A;  5FZ0 A;  1HJG A;  2CDO A;  4RGK A;  5DAP A;  3IIA A;  1X9T A;  1DYP A;  4B1L A;  2C0Z A;  1PMJ X;  3OYW A;  4AI1 A;  4L92 A;  2XWJ B;  1JU3 A;  3NAP C;  4NWW A;  1QHD A;  4PIZ A;  4BM8 A;  3KHC A;  4NE9 A;  4FOY A;  5L73 A;  4JRL A;  4OZX A;  3O1T A;  1U0A A;  2D7F A;  5FOJ B;  2JEC A;  1AR6 2;  4FFH A;  3I2O A;  2XON A;  5A3N A;  2ZGK A;  1COV 2;  5FO8 B;  1U5Y A;  4UW5 A;  2GC2 A;  4Q4X 1;  3III A;  2FCT A;  4A3X A;  4CCK A;  4AF9 A;  4YGE A;  1GSL A;  3VV1 A;  1QH6 A;  1ENS A;  4EE2 A;  1QKQ A;  1MZE A;  3KLS A;  3TRS B;  2XQR A;  5D8A C;  2YC4 A;  2QQU A;  3IAP A;  3I2H A;  4ES8 A;  4Y33 A;  1E5I A;  4BQ5 A;  3MDP A;  1YCI A;  2WYF A;  1I5Z A;  3KCX A;  3CL1 A;  2YFU A;  4EJR A;  4WV8 A;  4YW5 A;  1K5M A;  5ACA 3;  5AC9 3;  4LO5 B;  3FUO A;  1EPZ A;  3KD4 A;  4FOW A;  2KXL A;  2YBS A;  1LCL A;  4CPB A;  2Y34 A;  4HN1 A;  1UKR A;  2D6N A;  4BE3 A;  5JWP A;  3LDB A;  2RDN A;  1HKD A;  2RDR A;  2WAA A;  2WAO A;  5A7O A;  2RV9 A;  4M0H A;  5LAT A;  4QT6 A;  5JZG B;  1VBB 1;  4L99 A;  3K3N A;  4FXK B;  1WW6 A;  3WNX A;  3VBS C;  4O7X A;  5A6Q A;  3VBS A;  2VMI A;  1XE8 A;  2JDY A;  4LHN A;  1H1M A;  1SAC A;  3UJO A;  3W59 A;  4CEY C;  5JR7 B;  3GYD A;  2QQK A;  1UF2 C;  5A7W A;  4CEY A;  2HWB 1;  2OW4 A;  2A6V A;  5A1A A;  3SH3 A;  4HXC A;  4CCE A;  4YVS B;  2WA3 A;  5EFU A;  2JB4 A;  3ZR5 A;  3NKG A;  4R9A A;  4Q4V 1;  1B35 B;  2OPK A;  1W04 A;  2RS5 2;  2X09 A;  1IPJ A;  1AR6 3;  1RUG 1;  3U1X A;  1VBC 2;  2J1T A;  2VQA A;  2EVX A;  1FXZ A;  3WNN A;  1GOH A;  4HVQ A;  1D4V B;  1V6L A;  2BBA A;  2Y6J A;  5CZK A;  5JI9 A;  4LBJ A;  4LUM A;  1TME 2;  1V6I A;  3FLP A;  5C9A C;  4B7E A;  1N3P A;  2ZGS A;  2XUM A;  4QHO A;  4ZZ5 A;  4BB3 A;  3QOP A;  4Q4W 3;  5C9A A;  2HH9 A;  4ORF A;  4O9E A;  1YO8 A;  2CL2 A;  3KWV A;  4LKF A;  4UOJ A;  4DZG A;  5GLT A;  3WNP A;  4QQP A;  1XU2 A;  3D82 A;  5C8C C;  4D6S A;  4S2G A;  2WO2 A;  3B5L B;  3SH5 A;  1HB4 A;  1OFS A;  4IGP A;  1AXK A;  3DXT A;  1JOP A;  1FMD 1;  4RGA A;  4A6S A;  1CES A;  3ZDV A;  1KGY A;  3GM8 A;  4P9L A;  4B29 A;  2LRO A;  4GB3 3;  1R09 3;  5GZG A;  3WDV A;  1S0J A;  1MEC 3;  5J1X A;  2A71 A;  2ID4 A;  2P6H A;  2WQZ C;  4AI2 A;  2N7G A;  4PIX A;  5IFT A;  5LAS A;  5IT6 A;  3WSO A;  3T1M A;  4Q8K A;  5KHG A;  4H2A A;  1XYP A;  2DCJ A;  3CHX A;  1YHF A;  3LSE A;  5C5T A;  4R4Z A;  3NNG A;  1KFX L;  4JKM A;  3ZOI A;  3S57 A;  2VCM A;  4PCR A;  1WD4 A;  1I6X A;  4Y4Y A;  3IB3 A;  4E2G A;  2CU5 A;  1UY4 A;  2R07 1;  2Z69 A;  3I2F A;  3DXU A;  3FLR A;  1F8V A;  5DDJ 2;  2VZO A;  3AJY A;  1QXR A;  3O1U A;  5HV0 A;  2WNV C;  1GZC A;  3MIG A;  1R08 3;  3N9M A;  2WNV A;  1CZT A;  4QQO A;  5FK7 A;  1JZ6 A;  1PO2 1;  3OBR A;  3OOX A;  5A7S A;  1LEC A;  1C8N A;  4RD7 A;  4AQS A;  2OA2 A;  5A7N A;  4P9Y A;  3FHA A;  4KU7 A;  5FZ3 A;  3U07 A;  5FP9 A;  4XAB A;  1TME 3;  3MLL A;  2YXS A;  2WNE A;  4WVV A;  2R04 1;  5IVF A;  4Q29 A;  4X6Q B;  4J25 A;  5J96 B;  3ETP A;  5I0S A;  2A6X A;  3TEX A;  1FPN 2;  5A33 A;  2E53 A;  4ZXE A;  4CP2 A;  2WFF 1;  1L7R A;  3WF3 A;  2YYO A;  1LJ7 A;  1W8T A;  5KC5 A;  3MIB A;  5F5C A;  2ERF A;  3PVO A;  1LHU A;  4Q4Y 2;  5BNQ A;  4Y20 B;  1ZYB A;  4TLF A;  2Q1F A;  1DDL A;  2DCY A;  2GND A;  5FMO S;  1RUE 1;  2VG9 A;  3P3N A;  1W9S A;  4LLF A;  3UNP A;  3L2H A;  4X6R B;  5FYT A;  2WO7 A;  1RUI 1;  4IEQ A;  2ZGT A;  4RL7 A;  4BQW A;  4C90 A;  4YZ5 A;  3ZSJ A;  1NA1 B;  1ND3 A;  4C8D A;  3B3Q E;  1JYN A;  2XB6 C;  3IM0 A;  1S0B A;  4AQ2 A;  5C4W C;  5JOX A;  1VIW B;  1PGS A;  1JYX A;  3O14 A;  4MAD A;  4A7Y A;  2Z2S B;  1ASJ 2;  2VE1 A;  2VD7 A;  4P14 A;  1S2K A;  3ZX7 A;  2BOJ A;  3ZFE B;  3ECQ A;  3ZXJ A;  5CG9 A;  1Z7S 1;  5ABJ C;  3VZK A;  4Z2W A;  3ETQ A;  3I2D A;  5DDJ 3;  2C26 A;  2VMH A;  4XF9 A;  3RJ2 X;  1OD3 A;  4YM2 A;  4FBF A;  4YGB A;  1JHN A;  1O7F A;  1QJY 1;  3VL9 A;  1T2X A;  1VBE 1;  2GZW A;  4BOW A;  4ES9 A;  3WW1 A;  4LBK A;  2Z42 A;  3OCP A;  4JHT A;  1AZD A;  1LOG A;  1YFY A;  3NJX A;  2LS6 A;  1XJA A;  2GH2 A;  2IVJ A;  2WLQ A;  3B94 A;  4QDS A;  4A45 A;  5E6H A;  1YFW A;  1C1F A;  1G9A A;  1ENR A;  1EAH 1;  2W87 A;  2TUN A;  1RUJ 1;  4YPJ A;  5J36 A;  3WG4 A;  1UU4 A;  4QB1 A;  2Y33 A;  4AGV A;  1VBD 1;  3W5N A;  1YEW A;  2ET7 A;  4XZP A;  3J4U H;  4HAN A;  4COW A;  4LUK A;  1NCQ C;  2ZGN A;  1SLC A;  3SIS A;  4EV0 A;  4Q4Y 3;  4XUP A;  4Y3O A;  1NCQ A;  5IVJ A;  1I5P A;  4QX1 A;  5A70 A;  4YW4 A;  5IAT A;  4CRQ A;  4Y1U A;  3VZO A;  2WII B;  1DF0 A;  3AFK A;  4XDO A;  1GIC A;  3J9S A;  2AGS A;  4HOO A;  5T5J A;  3V0B B;  2B4K A;  1R1A 3;  1AR9 2;  1JMU B;  3AMH A;  4GMP 1;  3MGU A;  3WG3 A;  5FJK A;  3J7H A;  3O1R A;  2Z79 A;  3HJR A;  2EID A;  4FOQ A;  2J22 A;  5LA0 A;  3NJV A;  1PNF A;  3FHQ A;  3ACL A;  5FYB A;  1CAX A;  2HBT A;  4BHP A;  5J48 A;  4XJZ A;  1N3Q A;  5IK8 A;  2JIC A;  4IE4 A;  2D98 A;  4QPW A;  5EYY A;  2OQ7 A;  4Y22 B;  4HVR A;  4H55 A;  3WIN E;  4GJZ A;  5A7P A;  4XDQ A;  1RUC 2;  4GKX A;  3VKO A;  2VME A;  5FMC A;  4RQP C;  2NM1 A;  3HT1 A;  1UYP A;  4DO0 A;  4QD2 A;  5FPU A;  3I7D A;  1QQP 1;  4HSJ A;  2WZR 2;  4J6G A;  1LOD A;  3PVB B;  5FWE A;  5IW0 A;  4LA2 A;  3OGV A;  4IES A;  4LXL A;  1UU5 A;  2FHR A;  3ZXF A;  4B4R A;  3VBU C;  5A3M A;  4DOU A;  5LY1 A;  1D4M 1;  2QQO A;  3VBU A;  1OOP A;  1CD3 G;  2HWD 1;  3ZYF A;  4O65 A;  3BTY A;  1CAU A;  5K9Y A;  2FDF A;  5HV4 A;  3TBD A;  2R06 2;  1UKG A;  2WIN B;  1DQ5 A;  1Z78 A;  4D69 A;  1NUK A;  2OS2 A;  2TNF A;  1NZC A;  1EYB A;  2J7M A;  5D21 A;  1LUL A;  3ZFF B;  4ZZ8 A;  3VZM A;  4MH0 E;  3SCG A;  1CJD A;  5CG8 A;  4IV3 C;  5LBC A;  4FPY A;  2EA7 A;  1OT5 A;  4UYB A;  4IV3 A;  2GH8 A;  2YB7 A;  4XXA A;  4AVC A;  2QQL A;  1GMM A;  5AVA A;  4XAA A;  3WF2 A;  1LNS A;  3ZSE A;  2YUE A;  4TLG A;  3PUR A;  2DUP A;  1ZRD A;  1TVG A;  3RJR A;  1CPN A;  2ZEY A;  4J1X A;  4NUB A;  1WME A;  3GZT B;  3MV1 1;  1AR9 3;  4IV1 B;  5FPL A;  1SLT A;  2RS3 1;  2VW1 A;  3ZXG A;  1K42 A;  2SBA A;  4CVU A;  5T55 A;  4AFB A;  2ZGP A;  1G9F A;  1BMV 1;  3VHO A;  4I09 A;  3R4D B;  1JYI A;  2W2I A;  3MV0 1;  4E27 A;  1OXC A;  1UMI A;  1JU4 A;  3CU7 A;  1X9P A;  2VQ0 A;  4X8N A;  1A78 A;  2ZEW A;  4R9D A;  4IQP A;  1RUC 3;  1C3H A;  5A32 A;  1RXF A;  2R16 A;  4HKL A;  1QEX A;  4QPY A;  2L9L A;  4ET7 A;  4QGN A;  3LDR A;  4Q4X 2;  2JXA A;  5EHD A;  4CXW A;  1Y9G A;  3UKT A;  2WZR 3;  4AR2 A;  4AEM A;  3TEZ A;  2WYS A;  4MVT A;  4L0P A;  4NO4 A;  3AZY A;  3U37 A;  1MR5 A;  5FY7 A;  5EJ3 A;  5K0U A;  2VBP A;  1F9K A;  2LRP A;  5ERL A;  3C7E A;  2XJU A;  4AEJ A;  1Y3T A;  2VZ3 A;  3THT A;  1WD3 A;  2ZX3 A;  3DPR B;  1US3 A;  3NO8 A;  4D7S A;  2QQM A;  4LOR A;  3RZG A;  2GC3 A;  4BQ1 A;  4JGZ A;  1CVN A;  2IFW A;  5I93 A;  5JIA A;  3RZK A;  3IT8 A;  3A4U A;  2EAA A;  3AP6 A;  1AX0 A;  1VLN A;  1WW7 A;  4IW3 A;  5GZC A;  1NQD A;  1QH7 A;  3HVD A;  1LEM A;  4XFA A;  5F6K A;  4QM9 A;  3LSD A;  1H9W A;  1W6Q B;  2AH2 A;  1D0H A;  2ZBJ A;  2WRA A;  1VBB 2;  3FL7 A;  3BTZ A;  5T54 A;  1YIF A;  3KHB A;  5F32 A;  2XKO A;  1WCK A;  4XW3 A;  2P3Y A;  2XVK A;  2GN3 A;  2XKP A;  5DAQ A;  2IXI A;  2VU9 A;  1VAL A;  2XL7 A;  2PLV 3;  4QB6 A;  2HWB 2;  1S0D A;  1RUD 1;  3MF6 A;  5B2G B;  2XH6 A;  2VUC A;  3BOP A;  4Q4W 1;  1WKY A;  3MID A;  1H8T C;  4HPK B;  1W0P A;  4IEW A;  4NN0 A;  4Q4V 2;  4XMA A;  3KB5 A;  4IUG A;  4LBO A;  4BU2 A;  1GZW A;  5HBA A;  5A3O A;  4WM7 B;  1H1A A;  1RUG 2;  4N9H A;  1MQT A;  5LA2 A;  3WQ0 A;  3WNO A;  1HIX A;  2BEO A;  5FY5 A;  1W06 A;  3FWE A;  3T2P A;  4QX2 A;  4P9G A;  3AKR A;  4AFA A;  4AFM A;  4ERO A;  3I3E A;  4Q0Q A;  1LU1 A;  2TEP A;  4GB3 1;  1R09 1;  4LNV A;  4C1X A;  2QQJ A;  5M0T A;  1ZA7 A;  1GNZ A;  2R32 A;  1MEC 1;  1O5U A;  2HKX A;  3H9A A;  2NMO A;  1VE0 A;  2KR2 A;  3C7O A;  4GUL A;  1UZY A;  1FMD 2;  1BBT 1;  3X29 B;  3WT3 A;  1GLH A;  1OVS A;  4PLN A;  1W8F A;  2VTX J;  4LHL A;  5FZ6 A;  1O3Q A;  5BNP B;  2JE7 A;  4LKD A;  1LB2 A;  1UNB A;  1GWK A;  1BHG A;  4G3Y C;  1AYN 3;  1DP0 A;  4WVM B;  5EJ1 B;  3RGB A;  3ZFG C;  3BKZ A;  2W52 A;  1NG0 A;  2Y26 A;  2NP0 A;  3EB7 A;  4JQR A;  1O8P A;  2QQI A;  5T50 A;  3RPQ A;  2VM9 A;  4AHX A;  2YC2 A;  1A3K A;  3SEE A;  3O0X A;  3THD A;  3EBR A;  1VBB 3;  5FMO L;  5A3T A;  1JN2 P;  1N3O A;  1R08 1;  1XSQ A;  4IEU A;  1T6G C;  2NZ9 A;  3AKQ A;  5LCW L;  3VBU B;  3WQ7 A;  3PDQ A;  3GAL A;  4YVW B;  2R07 2;  4RFR B;  2Q8C A;  4AEK A;  1XQN A;  5EJZ B;  2YMZ A;  2BFU S;  4QKD A;  4EYU A;  1ZX5 A;  2HWB 3;  4FXG B;  4N53 A;  3ZSL A;  3ZXE A;  2K9Z A;  4B4Q A;  2R30 A;  1H2N A;  4K1Z A;  1S4C A;  4N7U A;  4UBG A;  5I0R A;  3THP A;  3M3C A;  1PO2 2;  3DGT A;  1QJU 1;  2D5H A;  4N43 A;  1RYY A;  3K4Z A;  3ZYJ B;  4DQA A;  5HI0 A;  2R04 2;  1XOY A;  5CBL A;  3FBY A;  5DAV A;  3I3M A;  4V2V A;  3SEP A;  1O59 A;  2WFF 2;  3FJS A;  1KFU L;  1YNA A;  4A3Z A;  3WF1 A;  1JBC A;  2FMY A;  1LAJ A;  3K2O A;  1FT9 A;  1UL9 A;  4IXL A;  4YW6 A;  5DQ0 A;  4SLI A;  1YQ5 A;  1RUE 2;  4CEW B;  2YRO A;  1UWW A;  2VC9 A;  1J3R A;  2A73 B;  4HFS A;  1RUI 2;  2DF7 A;  4RR3 A;  1HDK A;  1W8Z A;  4HLT A;  5GAL A;  4ZS2 A;  3BUC A;  1EUT A;  4KG8 A;  4XEZ A;  4AK3 A;  2ZZQ A;  1M4W A;  3E6C C;  4YW7 A;  4LKS A;  2MEV 3;  1AJK A;  2V73 A;  3NMB A;  1AR8 3;  3KQR A;  4Q8L A;  4UI9 L;  2WDB A;  5FYC A;  4OQ8 A;  4AVB A;  1Z7S 2;  2DVG A;  2R07 3;  1POV 3;  1POV 0;  3MPB A;  4XIK A;  4AZZ A;  2YDE A;  1GOG A;  4XFG A;  5EQU A;  5DAX A;  1OKQ A;  2HWF 3;  3LQC A;  3OBA A;  3ZYR A;  1X8E A;  3RWN A;  1S0F A;  1OVP A;  2XJP A;  1QJY 2;  5FPV A;  3VD4 A;  1VBE 2;  1NX9 A;  1RGS A;  2E31 A;  2VAU A;  5FZ1 A;  1APN A;  1LKN A;  5FAX A;  3RNS A;  4NHY A;  4QGL A;  5IVB A;  1WBL A;  4F8A A;  4FO9 A;  1A8M A;  1UY1 A;  1ZRE A;  2UY8 A;  3MBW A;  3HMY A;  3VBO A;  3K4D A;  1EAH 2;  3HNY M;  4BZ4 A;  1XPW A;  3PMS A;  4CU9 A;  1RUJ 2;  2BRT A;  4UBH A;  2YHJ A;  5H9Q A;  3A0K A;  5LA9 A;  3AP4 A;  3LKJ A;  2WZE A;  4JDN A;  4GJY A;  1R1A 1;  1VBD 2;  4HKW A;  4PDW C;  1RHI 3;  2WFF 3;  2WS9 3;  1G6N A;  3KV4 A;  4PDW A;  1DIW A;  3URF A;  1SFY A;  2X5I B;  5KWR A;  4R9B A;  4ZON A;  4YSF A;  2D3P A;  4QX5 A;  5FZG A;  3TWI A;  2Q4S A;  4JGY B;  2DCK A;  2UY9 A;  5EPA A;  2HWC 1;  2RM2 1;  2JB8 A;  1ULP A;  1RUE 3;  3RWK X;  1S0C A;  3H50 A;  4KG0 A;  2GMM A;  1KJL A;  4CU7 A;  1RUI 3;  3B02 A;  1H1I A;  2OKX A;  1G7Y A;  4HL0 A;  2WQ4 A;  2RVA A;  2F6B A;  1NLR A;  1W3V A;  2VUL A;  5CFD C;  3VKF C;  2ZX1 A;  4COZ A;  2YY1 A;  3T08 A;  5CFD A;  3LGR A;  2A5Z A;  2BU9 A;  2XBO 3;  4YZ2 A;  2DBI A;  2AYH A;  4AVA A;  1VMJ A;  3DYP A;  3HD8 B;  3HPN A;  4YAR A;  1H4G A;  1JOJ A;  3LF7 A;  2BER A;  2JKB A;  3VDD C;  1FV2 A;  1XYN A;  3SHR A;  1QQP 2;  4U36 A;  3VDD A;  3GCW A;  3M3O A;  5JR2 A;  1QJY 3;  4QPI C;  4IND A;  1WMF A;  1V6N A;  3C2U A;  5F2W A;  1D4M 2;  1KD7 A;  4P5H A;  5C8W A;  1PK6 C;  3VBF C;  2LAL A;  3CJX A;  3VBH C;  1OUX A;  2CGN A;  2CSG A;  2V5D A;  2DTY A;  2HWD 2;  4LO6 B;  3SXW A;  2JG9 B;  4LO4 B;  3VBH A;  3WQB A;  2VW2 A;  3ASI A;  2IXH A;  2GDF A;  3ENR A;  1FAY A;  5FZ8 A;  3LFM A;  3WXP A;  1AL0 G;  1AXZ A;  1RJ7 A;  2UWC A;  3ATG A;  3Q8E A;  4KWL A;  4NHX A;  5L9R A;  2OX0 A;  3CJI B;  3IMN A;  3PIJ A;  2OPW A;  1LRH A;  1B09 A;  1I9R A;  2LM3 A;  2NQY A;  4EWD A;  2VCB A;  4UF0 A;  2C9A A;  1HQL A;  2DU0 A;  2JJ6 A;  4DMI A;  3ACH A;  5T5L A;  4AED A;  3B93 A;  5FCC A;  1ULC A;  2O0O A;  3KGZ A;  2GME A;  2GU9 A;  4OI1 A;  4ARY A;  4DPN A;  1AF9 A;  4HZF A;  1RTV A;  3GF6 A;  2ZEX A;  2AC1 A;  1JTZ X;  1H2K A;  3NJZ A;  2VZV A;  3PUA A;  2ZGQ A;  2RS3 2;  4GMP 0;  2HBU A;  4GMP 3;  4K9S A;  1CON A;  3VD7 A;  2BGC A;  4H3W A;  4DFS A;  4DXR A;  4E2Q A;  4NIH A;  2LUW A;  2QJV A;  3AMQ A;  3Q8F A;  4M3C A;  2DDU A;  1BMV 2;  2WN3 A;  3NNM A;  1W8U A;  2DVF A;  1CAV B;  3MUY 1;  2ILM A;  4XUT A;  3LA2 A;  4YG0 A;  4Y24 A;  3MEP A;  3KZ4 C;  1ENX A;  3BOW A;  5FYV A;  2WT1 A;  3NNJ A;  4XQW A;  1O91 A;  2AAC A;  1DGW A;  4JX0 A;  3ZXD A;  5FQ0 B;  5IFP A;  3AMM A;  2D6L X;  3P3P A;  4HVO A;  2BYV E;  2ETE A;  2PXJ A;  4RN5 A;  2IXC A;  4CYD A;  1W6N A;  4QXK A;  4C0B A;  3WW3 A;  1ZZB A;  2ZX2 A;  1TQ5 A;  2XLA A;  4AAX A;  2A3Y A;  5ACA 2;  5FO9 B;  2IXJ A;  3IKW A;  4CU8 A;  1IS3 A;  1PO1 1;  4FTB A;  1AYM 3;  5J7M A;  5L7O C;  2GN7 A;  4RYD A;  3LB9 A;  4IER A;  2CWS A;  2KA3 A;  1ZBA 3;  1JI6 A;  1NXM A;  2X53 S;  4K8R B;  2RS1 3;  2ARB A;  4XCB A;  5BNN A;  5F9T A;  3GHM A;  1GNY A;  1V0A A;  3T09 A;  1KEX A;  1X36 A;  2QKD A;  3AYE A;  5F3I A;  2W3J A;  3MIF A;  1O5L A;  1UQX A;  1GQP A;  4YGC A;  5G05 L;  3UT0 A;  3QH7 A;  5FWJ A;  4E4H A;  3WNM A;  1ENQ A;  2VOT A;  4XOG A;  5FDB A;  2YPJ A;  2RG4 A;  5KHH A;  3BIE A;  4YG6 A;  4WZF A;  1RUO A;  2PLV 1;  4XFC A;  1LHO A;  4OUS A;  1QDC A;  2V4V A;  5JXI A;  4OHY A;  1X50 A;  3OYW B;  4NWV A;  1JYV A;  5FFO C;  1XC6 A;  2H0B A;  3NAP A;  1TMF 1;  4FPE A;  1EP0 A;  1N47 A;  1SPP A;  2P3K A;  3E6D A;  2RS3 3;  1SPP B;  3I97 A;  4QWN A;  2ZX0 A;  3QLQ A;  5IWF A;  3KT7 A;  3U78 A;  5C3O A;  1MS4 A;  3PUH A;  1QJX 1;  1JW6 A;  2XWB B;  1HRV 3;  3NVC A;  1RUD 2;  4KI5 M;  4UFL A;  3V56 A;  2CGP A;  3M70 A;  5GLZ A;  4YM0 A;  4YGD A;  5DZF A;  4S2D A;  4Q4W 2;  2WZ8 A;  3ST7 A;  2W91 A;  3PL0 A;  4E4D X;  4LHK A;  2DTW A;  4KGG A;  4MZU A;  5D8A A;  2F4P A;  5FOB B;  2D44 A;  3BYW A;  3R6S A;  1XXN A;  3TNP B;  2AEZ A;  5BY5 A;  5LB6 A;  2OZ6 A;  4URT A;  4P08 A;  3BOD A;  3DYO A;  1K5M B;  1YI9 A;  3I59 A;  3NL1 A;  3KT1 A;  4RS5 C;  4GB3 2;  3HNM A;  1R09 2;  5DAW A;  3WDT A;  5K7P A;  1OH4 A;  1PMH X;  3ORJ A;  4OLL A;  1AYN 1;  3OGG A;  4RS5 A;  1MEC 2;  4XBN A;  4I0W B;  4YYO A;  4CCD A;  1XNT A;  2RJK A;  1R1Z A;  1C1L A;  2PFW A;  2XG3 A;  5LRR A;  2BQP A;  4AQ6 A;  2Y0O A;  3JB8 A;  1OI6 A;  2B7Y A;  5E88 A;  1BBT 2;  2BNO A;  3NNL A;  4PF5 A;  1NAE A;  3TB0 A;  4IET A;  2V4A A;  1D2Q A;  1UYZ A;  4ZY9 A;  5C3S A;  3W58 A;  1XNK A;  2XL9 A;  5F3G A;  1EUU A;  1OHF A;  1UW8 A;  2ZCW A;  2PEL A;  4EN7 B;  1AX1 A;  3NNF A;  3RS6 A;  3VBS B;  1KXG A;  1OA4 A;  3OEA A;  2OZJ A;  5A7W B;  4CEY B;  2PQQ A;  3C7F A;  3WHU A;  4ASL A;  3HAG A;  4N90 A;  4CP9 A;  1R08 2;  1FX5 A;  5JZG C;  3T3Y A;  2W94 A;  5FZO A;  4TTG A;  4ZXK A;  3WF0 A;  5FYU A;  5FZK A;  2Q5T A;  2ZA9 A;  4CXY A;  5FZ7 A;  3BU7 A;  3NJY A;  4RA0 A;  4PLO A;  3LZZ A;  3CEW A;  1RUD 3;  4Q1P A;  5I8Y A;  2ZJC A;  5DZE A;  2BPA 2;  1F2N A;  3AX4 A;  4FSJ A;  1J83 A;  1MVE A;  1SDD B;  2WSV A;  3O5S A;  5E16 A;  3UKN A;  5C9A B;  3BB6 A;  3H3Z A;  4UFK A;  4R4X A;  3N3H A;  4YVS C;  1ODM A;  3EMR A;  1DHK B;  2C1F A;  2CNA A;  2WBK A;  5C8C A;  1QJU 2;  2ZGL A;  3KM5 A;  1UAI A;  2GC1 A;  4QAW A;  4AGG A;  3IZO A;  5JI7 A;  2J1U A;  1JZ2 A;  1DG6 A;  1C57 A;  3V0A A;  1PZ8 A;  2EAK A;  2XLG A;  3CMG A;  4CPB D;  4IE5 A;  5KHI A;  1CQ9 A;  1VMF A;  1V6M A;  1TNF A;  3H7Y A;  4XBL A;  3S5Q A;  2H6B A;  3RI9 A;  5LBE A;  1FV3 A;  4K7J A;  4XAE A;  4OVE A;  4COU A;  2QQP A;  2ZGU A;  4CDX C;  1O3T A;  4RFT 0;  3GBG A;  2Y38 A;  2NYY A;  1U12 A;  3AVR A;  4PBP A;  4CDX A;  1BBT 3;  5CFC C;  2MEV 1;  1UXX X;  4KQ7 A;  3J8F 1;  2WL1 A;  1AR8 1;  2GMP A;  3AYD A;  1W3X A;  4I30 A;  3W9A A;  1DBN A;  3Q9O A;  5CKM A;  1LGN A;  3GJA A;  4DUX A;  1HN0 A;  3MFC A;  5D2A A;  1POV 1;  1BKZ A;  4FP3 A;  1ALY A;  4JKK A;  5BXX A;  2G9F A;  4IDZ A;  1S0I A;  3ZMN A;  1U5I A;  1DQ0 A;  3ZYP A;  3A21 A;  2E6V A;  1NXD 1;  2HWF 1;  3AVS A;  3HQR A;  2YFZ A;  1DQ2 A;  4UXA A;  3DUI A;  1RB8 G;  1QGL A;  2QTW B;  4QX3 A;  2WNV B;  4TN7 A;  4BWO A;  1FNZ A;  3CIH A;  2FZ1 A;  1CX1 A;  2YBP A;  3IN9 A;  1BVP 1;  4LKE A;  4IEV A;  5EP9 A;  2P4E A;  3R4S A;  4OHW A;  2W1W A;  1C5I A;  5IAX A;  4L9B A;  2FDJ A;  1OMI A;  3SLI A;  1J59 A;  2OT7 A;  1AXY A;  1OQD A;  1LED A;  2H0V A;  4CCC A;  2ZHL A;  2XHN A;  1Q3E A;  5JCT A;  4MYE A;  4NIG A;  1A8D A;  4QQH A;  2IVI B;  2J42 A;  3CO2 A;  4E9K A;  5TSW A;  3OGJ A;  1G9B A;  2VCA A;  1RHI 1;  2W1Q A;  3U0Z A;  5A33 B;  2WS9 1;  4IE7 A;  1HJF A;  4EWA A;  3TNQ A;  1LOC A;  1QJU 3;  1A34 A;  1J3P A;  1SLB A;  2VL4 A;  4MLO A;  4OCT A;  3WG1 A;  4NOT A;  1PX3 A;  4UWD A;  2D6P A;  3NKT A;  3O1S A;  1GWM A;  4QHZ A;  4NHM A;  2JE9 A;  2ZHK A;  2UYB A;  4MXW A;  5FPX A;  3AP9 A;  1ULG A;  1WLT A;  1R1A 2;  4B8E A;  1QMJ A;  5KXC A;  4YFW A;  5FLJ A;  3VLB B;  4E2S A;  3K3O A;  4FPH A;  4JAA A;  1MPX A;  1ND3 B;  1V9U 1;  2DFB A;  4XJU A;  4AE2 A;  2D6O X;  3ILR A;  3MO4 A;  2BGP A;  2HWC 2;  5E89 A;  5I0T A;  2RM2 2;  5C4W A;  5C4W B;  3SC7 X;  3USU A;  3TEY A;  2ENR A;  2RDQ A;  1PIV 1;  2XBO 1;  5FZI A;  1I1E A;  3S6P A;  2OXB A;  2A3X A;  3J26 N;  4HBN A;  4LJH A;  4Q0S A;  3ZKY A;  1WWY A;  4WVW A;  2JIJ A;  2Z4F A;  3K51 A;  5FYS A;  1YJL A;  5L9B A;  5ABJ A;  2PN5 A;  2B8M A;  1YJK A;  1YRZ A;  4Q27 A;  4XYX A;  1JUH A;  4KNC A;  3BU0 A;  5DUW A;  1BK0 A;  4HMZ A;  3G6J B;  2JDH A;  4L2N A;  4S2F A;  1H8V A;  3N9P A;  4AI9 A;  3ZXK A;  3PU8 A;  1F5J A;  4CTE A;  5IVC A;  3RYK A;  1J84 A;  4XQ4 A;  3WD5 A;  1O6U A;  2ZMN A;  5E1R A;  4QXH A;  4BME A;  3FN9 A;  1ZRF A;  4FFF A;  3TOJ A;  2D6M A;  1JZ7 A;  2KD7 A;  3Q8A A;  2WQ8 A;  3A22 A;  4M4R A;  1OQ1 A;  1CZS A;  1H4H A;  2YU1 A;  4JZR A;  1LGB A;  2RJL A;  3VD3 A;  3WCS A;  4F7Z A;  5KXE A;  4NMI A;  2PQS A;  1QOO A;  1GZT A;  2E32 A;  3UV9 A;  2J1E A;  1NCQ B;  1UZV A;  4XFB A;  1UOG A;  2EIC A;  5IYY A;  2JX9 A;  2ZAA A;  2IFR A;  2OYZ A;  3RZJ A;  3ES4 A;  2V5Y A;  2E7A A;  1KIT A;  4SBV A;  4TSV A;  5GJ6 A;  4ZU7 A;  2MNG A;  1RUN A;  5DXD A;  3UGF A;  1UY2 A;  4CDQ C;  3WP5 A;  1CAX B;  4CDQ A;  4AQT A;  3N7L A;  2HWC 3;  1UOF A;  2RM2 3;  1OC1 A;  3I2K A;  1H30 A;  2Q30 A;  2WWJ A;  3K46 A;  3SMH A;  5DUX A;  3VHN A;  4A41 A;  1NKG A;  5GM0 A;  4ISR A;  3UGH A;  4MET A;  2PMW B;  1NCR C;  1W05 A;  3V64 A;  4BIO A;  4RQP A;  2R7E B;  2IXL A;  3VDC A;  4GA9 A;  1NCR A;  5J98 B;  4C1W A;  4OUM A;  2I2S A;  1ND2 C;  1AYM 1;  3LPG A;  2ZAC A;  3AB0 A;  3KGL A;  1ND2 A;  4D7T A;  1ZBA 1;  4BA6 A;  3MLJ A; 
#chains in the Genus database with same CATH homology
 3K3N A;  2OT7 A;  2Q8E A;  2Q8C A;  2GP5 A;  3PUQ A;  5FPB A;  3N9O A;  2W2I A;  4EYU A;  5FZF A;  4BXF A;  2VD7 A;  3UYJ A;  5FY1 A;  5FYM A;  4CCN A;  5F3C A;  5F37 A;  5A7W A;  3PUS A;  3AL5 A;  2YPD A;  5FUP A;  3LD8 A;  4EZ4 A;  5F2W A;  4CCM A;  5FXX A;  2XML A;  5FJH A;  4CCK A;  4EZH A;  4HON A;  5FZH A;  2YBK A;  5LW9 A;  4V2W A;  3KV9 A;  5KR7 A;  5FZA A;  2GP3 A;  5FZ8 A;  5E6H A;  5FY7 A;  4V2V A;  3K3O A;  2OX0 A;  3N9N A;  4ASK A;  3U4S A;  4QX7 A;  4DIQ A;  5F3G A;  2XXZ A;  3KVA A;  3K2O A;  4UF0 A;  4XDP A;  4D6S A;  5FZ9 A;  5CEH A;  5FZ4 A;  4IGP A;  5FZI A;  3DXT A;  4D6Q A;  5FP8 A;  5A7W B;  5IVE A;  4IGQ A;  5FYS A;  4Y3O A;  5FY8 A;  5FZL A;  5IVJ A;  5IVY A;  3PUA A;  3AL6 A;  5FYI A;  5FYZ A;  4QXC A;  4CCJ A;  4XDO A;  5FZO A;  4HOO A;  5ISL A;  5F32 A;  5FYU A;  4QU1 A;  5F5A A;  5FZK A;  5FBJ A;  5FZ7 A;  5FZM A;  5FJK A;  3NJY A;  5FZB A;  3N9P A;  4AI9 A;  3PU8 A;  5FP4 A;  5FYB A;  5F39 A;  5FYC A;  5IVC A;  5FZC A;  5FYV A;  3ZLI A;  4AAP A;  4QXH A;  3OPT A;  5FZ0 A;  2OQ7 A;  4GJZ A;  3DXU A;  2PXJ A;  5F3I A;  5A7P A;  4UF0 B;  5F5I A;  4GD4 A;  4BU2 A;  4CCO A;  4D6R A;  5FPV A;  5FY9 A;  2OQ6 A;  5LY2 A;  2YU1 A;  4Y4R A;  5FZ1 A;  5A7Q A;  3KVB A;  5IVV A;  5F2S A;  4DO0 A;  5FPU A;  5LWB A;  5FY5 A;  3N9L A;  3N9M A;  2XDV A;  5FY0 A;  4CCL A;  4LIU A;  5IVB A;  5A3W A;  5FWE A;  3KV6 A;  5FP7 A;  5IW0 A;  4CSW A;  3ZPO A;  5A1L A;  5A3N A;  4LXL A;  5LY1 A;  5A7S A;  5FZO B;  2YU2 A;  3PU3 A;  4LIT A;  5FXW A;  5A7N A;  4QX8 A;  5K4L A;  5A1F A;  3AVR A;  5FY4 A;  5FZE A;  2Q8D A;  5FZ3 A;  4LIV A;  5FP9 A;  4GJY A;  5FWJ A;  4E4H A;  5IVF A;  5FUN A;  3KV4 A;  5F3E A;  4BIS A;  4GAZ A;  5A3P A;  4Y33 A;  2OS2 A;  3OPW A;  5FZ6 A;  5ANQ A;  4CUG A;  5FZG A;  2WWJ A;  3KV5 A;  3N9Q A;  5F5C A;  5FYY A;  1VRB A;  5A80 A;  3AVS A;  3RVH A;  4URA A;  2YBS A;  5FV3 A;  5FXZ A;  3PUR A;  4TN7 A;  4QWN A;  5FPA A;  3PTR B;  5FYT A;  3LDB A;  5FZD A;  2YBP A;  2WWU A;  5IWF A;  5FYH A;  2P5B A;  3U78 A;  5FPL A;  5A7O A;  4NUB A;  5A3T A;  5FXV A;  2XUE A;  4IGO A;  4QXB A;  4C8D A;  5FP3 A;  3PDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...