4GJYA

Jmjd5 in complex with n-oxalylglycine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
228
Chain Sequence
b'STVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing protein 5
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure and Functional Analysis of JMJD5 Indicate an Alternate Specificity and Function.
pubmed doi rcsb
total genus 56
structure length 228
sequence length 235
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4gjyA00
5FZ0A 4LIUA 5FZ4A 5FZFA 3LD8A 5FZOA 5F5IA 4Y3OA 4Y4RA 5FJKA 2XMLA 4IGOA 4CUGA 4D6SA 2YPDA 5F39A 5F5CA 5F3EA 5FYTA 5IVYA 4CSWA 5FXXA 3N9QA 2P5BA 2XDVA 5FZCA 3AL6A 5IVVA 5FYMA 3K3OA 5FPBA 5FY4A 3OPWA 5FWEA 2YBPA 3KV9A 3U78A 3N9PA 4GD4A 2GP5A 4GAZA 5FZOB 5LY1A 2XXZA 3PU8A 5IVFA 2WWUA 3N9LA 2WWJA 5IVEA 3N9NA 5FZ6A 5A1FA 3PUAA 3PURA 4EZHA 5A7WA 2PXJA 5F37A 5E6HA 5A7NA 5FYIA 5IVJA 4C8DA 2Q8CA 5KR7A 5FZKA 4CCNA 4QXBA 3KV4A 3LDBA 5FP8A 5FBJA 3DXUA 5K4LA 2XUEA 4HONA 4V2VA 2W2IA 5FZEA 5FV3A 4UF0A 1VRBA 3PTRB 4QXCA 5FY0A 3OPTA 2Q8EA 4IGPA 4GJZA 4AI9A 4HOOA 5FPAA 3AVSA 4TN7A 5FZGA 5F2WA 4LXLA 5A3NA 5FYHA 4CCOA 4BXFA 4AAPA 4V2WA 4BU2A 4LIVA 5FPUA 5CEHA 3ZLIA 5FZBA 5FZ8A 5IVCA 5LY2A 5FXWA 3K2OA 4DIQA 5LW9A 4BISA 2GP3A 4URAA 2Q8DA 3ZPOA 5FY9A 5FYSA 4QU1A 2YU1A 5ANQA 4QXHA 5FPLA 5FYVA 4E4HA 5IWFA 4CCKA 5FYZA 5FY7A 4D6RA 5FYYA 4EYUA 5FUPA 3NJYA 3AL5A 2VD7A 4CCLA 5F3GA 5A7SA 5FUNA 5A1LA 2YBKA 3PU3A 5F3IA 5FP3A 5A3TA 2OS2A 5IW0A 5FYUA 5FZHA 4QX8A 3N9MA 5FZ1A 5FZDA 4EZ4A 5A7OA 5FZ3A 4GJYA 3PUSA 2OQ7A 2OQ6A 5FZ9A 5FZIA 5IVBA 5FPVA 5FXVA 5FZAA 4CCMA 5A7WB 4CCJA 4Y33A 5A80A 3PDQA 5FWJA 5FP9A 2OT7A 3K3NA 5FY5A 4IGQA 5F2SA 2YU2A 4NUBA 4QWNA 4ASKA 3DXTA 5FYCA 2OX0A 5LWBA 5FZMA 5F32A 5A7QA 4QX7A 3PUQA 4XDPA 3KVAA 5A3WA 5FXZA 5A7PA 4DO0A 5FY8A 5FY1A 4LITA 5FZ7A 5FP4A 5FZLA 5F3CA 3KV5A 4UF0B 4XDOA 3RVHA 3KV6A 3KVBA 5FJHA 4D6QA 3AVRA 3U4SA 2YBSA 5FP7A 5FYBA 5ISLA 5A3PA 3N9OA 3UYJA 5F5AA
chains in the Genus database with same CATH superfamily
1YI7A 2QQPA 3T30A 3UNPA 1JYWA 1QQP1 4HZFA 5FZFA 2GN3A 2VPVA 3CEWA 3PTYA 5F5IA 5C4WC 1SFYA 4XBNA 2P3YA 3FUOA 2QQJA 2UWCA 4ZZ8A 1JYXA 2ERFA 2VMDA 3T2QA 2A75A 4A2UA 3MLKA 1YQ8A 1CZVA 4WVWA 2X29A 2HLEA 3PIGA 3SH5A 5I0DA 5FY4A 1PGW1 4XJUA 1NLRA 4LPLA 3U75A 5BXXA 1CZSA 3T3YA 3T2OA 3U78A 3ZXAC 2PLV2 5JIAA 1BYHA 3O14A 2GH2A 1HDKA 4XDQA 2WA4A 1UYZA 3I3EA 4B29A 4B4QA 1AUYA 1Y9QA 1YC61 1F8VA 2VULA 3A22A 1IS4A 1DG6A 1RJ7A 3NWKA 3AJYA 4UFHA 4DY3A 1FMD3 3B93A 4UW4A 4CDWB 1OSGA 1RMU2 5LB6A 4R9BA 4MGSA 1GBGA 1TME1 1AL23 3AYEA 1BMV2 3VD4A 5LRRA 4FAGA 1LTEA 4S2HA 3VBOB 4NRPA 3ZFGA 1NY71 4AFAA 2K0GA 1C28A 1U5YA 1SBEA 1O3SA 3RG0A 1J3PA 4JQTA 1H2LA 3VBOA 3ZFGC 5L7OC 3O1OA 2XONA 3O1UA 2DFBA 5A3LA 1TMF3 4XXPA 4JQRA 1ALYA 2WNUC 4K40A 5AC92 1FPN2 2RM22 4OMCA 4WM8C 2W95A 2D6NA 4NMIA 1XBFA 2W87A 1DU3D 1UYXA 2JD9A 3IBMA 1GWLA 3M1HA 5KHKA 5FZBA 3VBUA 4LBQB 4NHXA 4ARYA 4NVPA 3JD73 3NNMA 2V73A 4URAA 3LCPA 2W9XA 1B35C 5JDBA 1W04A 3HD8B 2FHRA 5FY9A 1DLLA 4QU1A 3W5MA 5FYVA 3ZFFC 4OZOA 3B3QE 2X8KA 3J7HA 5HCBA 3SC7X 4NIGA 1ZBE2 3VBHB 2DU0A 2GNTA 1C8M2 2A6XA 2RR12 4CYDA 4L0PA 3AYCA 5C9AB 1UF2C 4HK9A 3USUA 3G7DA 2RS51 4ONUA 1AL0G 4W65A 3OYWB 5A3TA 2JXAA 5M0TA 2VZVA 3IB3A 4AVAA 3BGAA 3GF6A 3J7NA 1MZEA 4UWDA 5ABJA 3GCXA 3PUSA 1GZCA 2Z69A 2BERA 3JD72 1QJU1 4YFZA 1W8ZA 1YFXA 2UY8A 5FP9A 3BI3A 3KZ4C 4CDUC 4W50A 1W8OA 4LBMA 3BTZA 1AYM3 1A3KA 1COV2 2Q1ZB 4I09A 4Y5Z0 2HEWF 3SQOA 4K8FA 4K3UA 1NUKA 2Y6GA 1WMDA 1CN1A 3I2OA 4H14A 2A6YA 4MGKE 5C3QA 5LA1A 4A6OA 4Q0VA 1LHVA 4XDOA 4PI0A 1GZTA 4ATFA 2Y6FA 3S7IA 4AFMA 2WFF2 3D8CA 4QB2A 5JAXA 1LHWA 3MPBA 3D4KA 4N43B 2XKPA 5A3PA 4YNIA 5F5AA 4LBQD 1QXRA 3MDPA 3DPRA 1CAVA 2WZPP 4CDXB 1J58A 3LD8A 1QJZA 3VZLA 2CYFA 1X9PA 2XMLA 1JMUB 1PVC3 4P08A 1LHUA 2ATFA 4C0HA 2BNOA 3PHMA 2ZHKA 5EHDA 3BKZA 2Y0IA 3RZHA 1O7FA 1G6NA 1RIRA 4AGRA 1RUOA 2VMIA 2WLQA 1WCUA 3C7HA 3I2FA 4XYXA 1YFUA 3Q8FA 4CP2A 3O0VA 3TEXA 1QJX2 1TQ5A 1XE0A 5DUWA 1W8HA 3AX4A 4XJ8A 1GYKA 3PUAA 2WA3A 4XUTA 3USSA 4HBNA 1ND2C 2DCTA 3R0RA 5F5QA 5HXMA 3I49A 3INAA 2E26A 3B01A 2JDUA 2CGOA 4IDZA 2PMWB 1GU3A 1V6JA 1Q8VA 2CL2A 5DUUA 1OA4A 1PO23 4NRMA 3ZSLA 4ORFA 4C1WA 2B42B 1XU2A 5FP8A 1LAJA 4TZDA 4FVVA 1HRV2 4AG4A 3KT4A 1DBNA 2WSVA 3RYRA 4ZKTB 1GICA 4YM0A 4UF0A 1AYN2 3TN93 4A45A 3J8F1 1T6GC 3OGJA 3ROUA 1GP6A 3C7OA 1AR92 1KDMA 1XYPA 3VBUC 4PHZA 2HBUA 3NJZA 4AEDC 2FMYA 1BBT1 3ACHA 4JGYB 4PQQA 3O1TA 3AP7A 3EBRA 5A3NA 5FPZA 2ZEWA 3X29B 3POFA 3ZSEA 1VBC3 2DFCA 4V2WA 3OSDA 2W91A 5CFDA 2XQXA 4A44A 5EP9A 2QQNA 1OOPC 1ENQA 4BISA 2E9QA 1CAVB 1W3XA 3WNMA 4CDXA 1CX1A 2CHHA 4GKXA 4LOSA 1KD7A 3RZZA 4Q4W3 4QDQA 5K9YA 1A8DA 4P02B 4WVMA 2VAUA 1BKZA 2B5HA 4CCKA 3VL9A 3J7MA 4YZ4A 5FUNA 1IS3A 5JMOA 3ZFEC 1ZRIA 3WOGA 1JXNA 5A6YA 3Q8CA 5DN2A 4FQ4A 5CISA 5A7OA 5H9PA 5JXJA 2OQ7A 1U5XA 4GXLA 1NCQB 2VXRA 4QGLA 1XB9A 3LZZA 2R7EB 2WBKA 3AZVA 1AHSA 4RS5C 2EXJA 5LBBA 1ZYBA 1LOGA 5FWJA 2OT7A 4BMBA 2XB6C 1CAWB 4P5HA 4P9IA 4EN9B 2EIGA 3B9CA 1ZVFA 1TMF2 3TEZA 1URXA 1F35A 3WF0A 1XOYA 3MZHA 1ULFA 1HRV3 3IKWA 1JOPA 1SLAA 5A7PA 5GZGA 4AAXA 1REDA 4ZS2A 3H3UA 5FZ7A 3T2TA 4CCEA 3Q8AA 2EAAA 1DZQA 2XBO3 3NAPC 1KXGA 1GLHA 1OD5A 1L3JA 1TNRA 4GMP0 3O1PA 1V9U1 2GNBA 3KVBA 4D69A 2GMPA 3NKGA 5HCFA 2X5IA 2D43A 3N36A 3OBTA 4Y20A 2TUNA 3I2JA 1WW5A 1WA6X 2GNDA 2JG8C 3NJVA 1SPPA 4CUCA 3TBDA 4LO6B 4A7ZA 1C8NA 1RUJ1 4QX3A 4XAAA 4LO5B 1DHKB 4O7XA 1QJU3 2UWBA 1O5UA 4OI1A 4RGGA 2GN7A 2JE9A 2P1BA 1F31A 3EO6A 1C1LA 4IXLA 2R0HA 1S0JA 3LWCA 3PLQA 4AFDA 1SQ4A 4YG3A 3IAPA 4UXAA 2EICA 2WWUA 1RUF2 2W94A 1AR82 3ZYGA 3BIWE 2QTWB 3MUZ1 5FZ6A 3FLRA 3T0BA 1VRH2 4JKMA 4EZHA 1YQ5A 2PXJA 2QQUA 1BEV3 5E6HA 4ZY9A 3CJXA 5LEJA 1OI6A 1TME2 2LM3A 4YYOA 4BE3A 2ARBA 2R0FA 4YZ1A 3F2ZA 4FFFA 2G4IA 1CAUA 2YY1A 4Y1VA 3SCGA 2KR2A 2VXJA 3B5LB 1RUC2 3VZNA 2VGDA 4DEVA 4QT6A 5DDJ2 2VECA 1G9AA 3O0WA 3OY8A 1BVVA 2YPJA 4F8AA 3VUOA 5IK7A 1EUUA 3ZFGB 1W3VA 1WCSA 2ZX0A 1V6LA 2CWSA 5FK7A 3DN7A 1W9TA 4K1YA 4M01A 4NJ4A 4Y22A 3FX3A 1S2BA 1HXS1 4KL1A 3UGHA 5JZGA 5JZGC 1H4HA 3ZYHA 2D44A 1JH5A 3HWJA 1UKGA 4XUQA 5GLUA 3VZMA 2VUDA 4R8HA 2X53S 5IJRA 1MS9A 2DVFA 2D6PA 1Y9MA 2C9AA 4Y26A 5SV8A 4XVHA 2YU1A 3ZO0B 4BQ5A 5FMOL 2RMU2 5C3RA 3WP4A 4ZHNA 2HWC3 1R083 3ZXLA 2VMHA 4XABA 4OI0A 3I2DA 1DQ0A 4Y5TA 4YGEA 2O1QA 2DTWA 2MEV1 1UN1A 2HWD3 1ND3A 1LGBA 3ZN6A 3E5XA 5FZ1A 2AUYA 4XUNA 1VBB3 1QQP2 4INDA 1JZ4A 5IVBA 1FT9A 2P17A 4FO9A 4CCMA 4CCJA 2JWPA 1KDKA 1WMXA 3BCWA 4KG0A 3JZVA 4MGYE 1FPN3 1MS4A 2RM23 4QM9A 4YZ2A 1AR62 1CD3G 5A80A 2VQUA 3GCWA 3OGSA 2WAAA 2YB7A 1WBLA 5FRAA 5BNOB 1JU3A 2WYSA 2YGLA 4HKLA 2VNOA 4PLMA 1YJLA 3ZFEB 5LWBA 1XSQA 4LKEA 5JOYA 2BBAA 2PLV1 3WCRA 5CNAA 2ZX4A 3ZSMA 5FY1A 3P3NA 5DAXA 1W6PB 3ZPYA 5IFTA 1DIWA 1O3RA 3VDBA 1IPJA 4BQ4A 4FSJA 5ACA3 1EAH3 4ES8A 2OUHA 4QB6A 3VZJA 2DVDA 3NAPA 3VHPA 3WP3A 4IV1B 3SITA 1Q56A 5FJKA 1TEIA 3POIA 4Q26A 5FAXA 4CUGA 4JKLA 3OTFA 5EWSA 1AF9A 3OGRA 4EN7B 3THPA 2WJSA 4XFIA 1NY72 4H7LA 5IVYA 4CCDA 4CSWA 5JWPA 5IVVA 4QKNA 4HLTA 1VMHA 3KD4A 5GLTA 4E2SA 1WA4A 4URTA 5HV0A 2XJQA 2DCZA 3I2GA 3KQ4B 4RS5A 1G9CA 1WGPA 5LEKA 1K42A 4C91A 4Q8LA 1TZOA 1WUVA 2CDOA 4L2NA 2VNGA 3ACGA 4XOGA 1VB2A 2NZ9A 3RJ2X 4I0BA 4U36A 2AC1A 3T1MA 4FBFA 3I4IA 4RR3C 4AQ6A 1VP6A 1QH7A 2K2SA 3AP6A 3C8XA 4UBGA 3NSTA 2WQ8A 4XCBA 5CG9A 3M3IA 1Y43B 1PM7A 4FPEA 4YW5A 4TTGA 1R082 1SFNA 2LROA 3J9SA 1LENA 4QXBA 1AX2A 4CP0A 2O8QA 5I91A 1RUE3 4XQ4A 5D1IA 1J59A 2ZMLA 1NA1A 3HIFA 3JCIA 4FPGA 4X6RB 3THDA 4QPGC 1YRZA 5A33A 4CEWC 1I5PA 3IZOA 3OJBA 4Y1YA 2F4LA 4NN0A 2AYHA 2A5ZA 4QQLA 1YWKA 4J1XA 4KGQA 4CDXC 2QZ3A 2IZWA 5L73A 1ASJ3 1Q8QA 1S0IA 1E5RA 2VTFA 2MPFA 5L36A 2ET7A 2OUJA 4LT5A 1WLCA 4LIVA 3AMHA 4NIHA 3LAGA 2WN3A 3HNBM 5LY2A 1WLTA 2VG9A 4DFSA 5A6ZA 5LW9A 3MF9A 2JG9A 2PAMA 1W9SA 3OF1A 2NMOA 5I8TA 2ZGRA 1DYPA 2Q1FA 4KU7A 1BK1A 1LR5A 5IAXA 4CZSA 2WNVC 5IFPA 3S57A 1JOJA 2ARXA 1A8MA 4XF0A 4XF1A 1HRI3 1RUD2 2A6ZA 1SLIA 4G4FA 3LPGA 4BPZA 5J7MA 1AYM1 1GQPA 1XYNA 4Q1RA 1ZRRA 1NZIA 1D2SA 2VQ0A 5BNNC 4MH0E 2HWB1 5IW0A 1PNGA 2RE9A 3LOBA 3WY6A 3AKPA 4CEYA 5FZDA 2XH6A 3QD6A 2ZS6B 4AQSA 1UD1A 5A33B 4D7TA 1HXS3 3V0AA 5KHIA 1JYNA 1VJ2A 2IXKA 5T52A 1BXHA 3RZGA 3VBRC 3U14A 1OMIA 4IEWA 3UGGA 4N53C 5FY5A 4AOCA 4NIIA 3FL7A 1QF3A 3Q8EA 1W8WA 2A6VA 3WQ1A 2A1XA 3ZIXA 4QPIC 1VLNA 4JGYA 3HPNA 1FAYA 2JX9A 3H3ZA 3MV01 5JPMB 3I59B 2VW1A 5FY8A 1YCIA 1PGW2 2ZMKA 2JENA 1D4M2 4EN0A 4L11A 1W0OA 1STMA 1LGCA 2JG8B 3P5BA 3R05A 5ISLA 1EUTA 1S2EA 4OLLA 3WV6A 2BGOA 4F3JA 3WXPA 5FY7A 4FFGA 1MVQA 1JTZX 1LHOA 1IS5A 5J36A 1PGL2 4HVOA 2VW0A 1N1YA 3O12A 5F5CA 1DZTA 3WF2A 4MHUA 2VR4A 1VBA2 3B9IA 4L9BA 2ARAA 4KI5M 1GNZA 5FYMA 4CUAA 4A7KA 4QPIA 2CWMA 2A3YA 2QBXA 2P2KA 4AHZA 1RXGA 1NKGA 3IMNA 4QM8A 3W59A 1MEC3 3DPRB 3AJZA 4JTOA 3NNLA 5CBLA 3GZAA 3ENRA 4MOAA 1A6CA 1RXFA 3N3HA 3QOPA 2Z79A 3A23A 3JBG2 2E32A 4AR2A 2FDHA 3U11A 3AZWA 4KWJA 1XXNA 3LEIA 2C6SA 3BU7A 5FBJA 4DINB 5BYNA 3SCFA 5C8WA 1DZRA 3ME2A 3PJQA 4BCUA 2C5DA 4KG8A 1LOFC 3RFRA 2X5IB 1W6NA 1SZBA 1XNDA 4LO4B 4YM3A 4XTMA 5LBEA 1D4M3 2ZGOA 1JYVA 1ZRDA 2GH8A 4UFLA 5F2WA 3I54A 1M4WA 2WZR1 2KXLA 1FMD2 1CPNA 2MHFA 4RSUA 1AR83 3UJQA 1QOTA 3GBFA 4OQ8A 2WT0A 5FXWA 2HEVF 1OQ1A 2CY6A 3RZMA 4MO3M 1BVP1 5T5LA 4CVUA 4QPGB 2VZRA 2HEYF 2DVGA 5ANQA 1IKQA 4QXHA 5FPLA 2XJVA 4P00B 3OBRA 1J1LA 1SDWA 1TME3 1Y7BA 4HXCA 4YVWB 3UGFA 4I2OA 4QPGA 2FDGA 4BXSV 1CJDA 1W2UA 1COV1 1VRH3 3KHBA 4K21A 2QQKA 4COVA 2VUJA 4QMAA 2VU9A 5C5TA 1FOD2 1WLWA 2P3IA 2XVLA 3GXUA 3LIGA 1I9RA 4GB31 1HQWA 2XBO1 4LA2A 4FPLA 3I97A 2UYAA 4GJYA 4OULA 5FZ3A 5H9QA 1AR93 1G8WA 4AL9A 1NYWA 5A7WB 4OUSA 4Q4Y2 2Y6JA 4YM1A 2Q8OA 4NHYA 5I0SA 1HJFA 1RVF2 5KC5A 3V0BA 1KFUL 1QY4A 1VBE3 4GQ7A 3DUIA 3MPPG 2ZPXA 5IK8A 1F15A 2RG4A 2RVAA 3GZEA 3OGGA 1ZRCA 4XMAA 1W6QA 4ASKA 1T6BX 2R32A 2VZSA 5FIXA 1UZYA 2AR6A 3HT1A 3PUQA 5FOBB 2ZXQA 1PIV1 3ZFEA 4AF9A 1YYNA 5FP4A 1BBT2 1BLZA 4Q2FA 1DP0A 3D82A 5DQ0A 1LOCA 2KA3A 2R1BA 1MEC2 3GHMA 4AEJA 4AFBA 2W3JA 3C7EA 2EIBA 3AKSA 3VDDC 1IKPA 1XC6A 4RL7A 5FMOS 3TYJA 5CFCC 1H1IA 1NX9A 1YEWA 5FZ4A 2QZ2A 2Y64A 3E6DA 4N53B 4MVTA 2VMFA 4CEYB 5F1RA 4RHV1 4LBOA 1BEV1 4D6SA 3AXEA 1UW8A 4LULA 4Z82A 1Q5OA 5DDJ1 2WRAA 3SLIA 5DAQA 3VN4A 1W6MB 4Q4X2 4CDWC 1TE1B 3H8RA 3NAPB 4COWA 3K3OA 2A3XA 2D5HA 5C6CA 5FO9B 1ENRA 4IV3A 2E7AA 4YW7A 3TNQA 3BPSA 5IT6A 3LEMA 3PU8A 1UYPA 3ASIA 5HCAA 5IVFA 3H7YA 4DOUA 4B7EA 3MI8A 3J8F2 4PIZA 3ZXDA 3KB5A 4FPKA 3MFCA 1VALA 1DGLA 1SLCA 4QXKA 4IEZA 2J1EA 2IXCA 2DCJA 2WNOA 4HVQA 1X8MA 2WO2A 5FMDA 3A7QA 3W9AA 3D0SA 4Y22B 1W2AX 4DY5A 1SLTA 5FQ0B 4UW6A 4TXWA 3ZR5A 1MZFA 5JXIA 3H42B 1B35B 3H7JA 1RINA 4PIYA 4QXCA 3WNNA 1NAEA 1W39A 2P3KA 3PJYA 2Q8EA 3WP6A 2YROA 3ECQA 5F7UA 4AHWA 4YVSB 4QKDA 2YC4A 1OA2A 5FZGA 2X05A 4E2QA 2PHUA 2J1SA 5EYXA 3CDZB 4Q27A 4KQ7A 3MLLA 4I30A 1UXXX 3GZUC 5FZ8A 1VAKA 2ORXA 4XXAA 3JQWA 1PO22 5J48A 5LK7B 1SLLA 4XJWA 3UKVA 3ZPOA 5I0RA 4NIAA 3I8TA 3VDCA 2JDKA 4MUVA 1AL21 2DF7A 2YC0A 2ZA9A 5A6QA 2WFF3 1VBD3 1OPMA 1BCXA 5F3GA 5JI7A 1UIJA 3WVJA 2XJPA 5JZGB 1GZWB 2HWB2 5FOJB 3AMQA 1EY2A 4DRRA 5IATA 3E97A 3SISA 1SMVA 3B02A 2VNRA 4LE4A 3CJIB 4LMFA 3BALA 4QQPA 3VD5A 1LNSA 1UAIA 2VBPA 1PZ8A 1UZZA 2FDJA 1W6OA 3VDAA 4V1PA 5FXVA 4BB3A 1WWYA 1IQDC 1OKQA 3ZSJA 5C3OA 1OLQA 2B45X 3MIGA 2JB8A 1W06A 4BLIA 1V70A 4UYBA 4AVSA 3EHKA 4BQXA 1HQLA 3FC0A 4FFHA 5FLJA 5J98B 3DXTA 2LUWA 5E8AA 3ZKYA 1CPMA 2RS32 1Z7S3 5FXZA 3PMSA 1F5FA 3E6BA 1CZTA 2R073 1RJ8A 3RMYA 4FXKB 1H6XA 4ISRA 3T4VA 4QHZA 2I2SA 2GALA 2RS52 1JI6A 3NRUA 1WMEA 4AXOA 1NT0A 2DYCA 4GMP3 2FDKA 2WNVA 4AHXA 1UKRA 1DCSA 2VBDA 2Z4FA 2TNFA 2W46A 1PNFA 4YGCA 5D2AA 5KHJA 2JG9C 4CXYA 2ZZJA 1SEFA 2BOJA 2IC1A 2RHPA 4IGOA 3RQ0A 3WQ7A 1MS5A 4CTEA 1RL3A 1YQ2A 3CJIA 5I0TA 5C3PA 2GMMA 2C4XA 5FR3A 3K4AA 2QUOA 3C3VA 4NHMA 2CAVA 4Q4W2 4LQRA 5BNNB 1RHI1 1SCSA 2DDUA 4MXWB 5DUXA 4LHLA 4FAHA 4FPFA 5AC93 2VOWA 1SDDB 3DPRC 5JLVA 2ES3A 3HN3A 3KV9A 3SMHA 1GV9A 4BWOA 1W6QB 2ETEA 4PF1A 3T2PA 5CKNA 1DQ2A 4QHBA 5F6LB 1VBC2 4CEWA 1UYYA 1OUXA 5IVEA 5FFOC 3POSA 2ORZA 4DB5A 5KXBA 1ULOA 2FCTA 5A7WA 2DVAA 3IDEA 4N7UA 5LA9A 5FBZA 2BPA2 2HYXA 3S5AA 2NYYA 1HXS2 3MO4A 4M0NA 5F37A 1UWWA 3IIIA 4RGKA 2XLFA 2LALA 5HV4A 1H2MA 4JGYC 4Q1PA 4ASMB 1ZBE3 2G9FA 5FO7B 2IXIA 4NPLA 4RFT0 2EXKA 2ZEZA 4DNYA 4UFIA 2CU5A 4Q8KA 2D93A 1XYOA 1U5ZA 5K4LA 1BMV1 3DYOA 1XRUA 2VOTA 3GDBA 4Z1VA 2AACA 1VBE2 1Z7S2 4UFJA 5FV3A 3IDAA 2LRPA 1RUF1 2UURA 3N7LA 1Q8SA 2HKXA 2PHXA 4IGPA 4GJZA 3HT2A 5GZEA 3ZYIB 5C8CA 1S55A 5G04L 5JSPA 1FMD1 3M3QA 4EQVA 2AENA 3OB8A 2Q1MA 5BNNA 3ZR6A 1V9U2 4MX3A 2FZ1A 4FI9A 2BV4A 2Z42A 4PBOA 5CEHA 3DEMA 3VBSC 3I3QA 3TWIA 3A0NA 4H2AA 1NCRC 1HB1A 1AR61 2DVBA 2VO5A 3D0JA 5GLWA 3ZOIA 4HK8A 1NXMA 1RMU3 2DBNA 2JB4A 4DRVA 4NIDA 2BU9A 1RUH3 4EYUA 1GOGA 3NJYA 2DCKA 4CCLA 5C7GA 4XC9A 5G05L 2BQPA 4A4AA 4JHZA 1E5IA 2FCVA 3I2KA 3M3CA 3PU3A 2IXJA 4ITCA 4FOWA 1YFYA 4JX0A 1DQ4A 4CDWA 5IK5A 3TN91 1UOBA 4Y24A 2XOMA 3ZMOA 1AX0A 4I01A 3LDKA 4LORA 2Y8KA 4AGVA 5BY5A 2WQ4A 2XVGA 1J3QA 4QKFA 1ND2A 2AEYA 1CAXB 1HIXA 1CESA 2EF6A 3VZOA 4B4PA 1F9KA 4Y33A 1HKDA 1IQAA 5JIUA 4UI9L 4TYSA 1LOFA 2D6LX 1CAXA 1V6MA 4AQ2A 1S1AA 4MG2A 1H8TA 4FPJA 4ATEA 1XNKA 4D7SA 5C4WB 3FLPA 1KFXL 2NPIA 4D8MA 4QX5A 5FYCA 4PLOA 2RDQA 5E16A 1GMMA 2WO3A 5GALA 5KXDA 1LRHA 5BPXA 4XDPA 3HMYA 4WZFA 1GP4A 2P37A 3WX5A 4Q0QA 3KF5A 3KV5A 2DV9A 3MHZA 4ZS3A 5EJZB 4YW3A 2Y34A 3RVHA 1POV3 2JE7A 3B69A 1JU4A 1GFF2 4LR4A 2YUEA 4P9JA 1XQNA 5JR7B 4CU6A 2OZ6A 1HN1A 5KBFA 4CDQA 4D94A 1N1SA 3RYKA 1DQ6A 5HI0A 3WQ0A 4I3PA 3MIBA 2B7YA 1C8M3 1OVSA 1H8VA 1PM4A 2RR13 2VW2A 3PUIA 2PTMA 4GWJA 4RQPB 1NLSA 2XG3A 2GU9A 1K45A 5FXXA 3T09A 1UX7A 1O3TA 1RUD1 2IXLA 2ZGPA 2VVDA 1CAWA 1JHJA 3PVEA 1SBDA 3OOXA 3M4FA 2ZHMA 1W0NA 3WDUA 1HV0A 3MF6A 2AREA 4H55A 5CKQA 1Q3EA 3V56A 2J1TA 1GWKA 2D7FA 4MGIE 1I3HA 1O8PA 1MZ6A 1QXJA 1H6YA 2I74A 3WG3A 4AVBA 5ACA1 1YHFA 3I2HA 5T3NA 4Z07A 5TSWA 1AJKA 1EV11 2YGMA 3ILRA 5FKBA 4NWVA 3HR9A 2GC1A 2Q8CA 1UMZA 3RRDA 1H1MA 2W68A 3HBZA 4EWDA 4A3ZA 4GIQA 4AGGA 3DXUA 4HONA 5DG1A 2YMZA 2VTXA 5C33A 4D7YA 1V6IA 1WCQA 2KD7A 3ZFFA 3MEPA 2WFPA 4ZZ5A 1VBB2 2LTNA 4IE4A 4OHWA 1B35A 3DKWA 3FFZA 2XL7A 3D6EA 4WM7C 4COYA 1ND3C 3O7OA 4CEYC 1XNBA 3ATGA 1SHWB 2J7MA 3USUB 4HETA 2WO7A 4Q4Y1 1DQ5A 1UNBA 5BNOA 1DQ1A 1MVEA 2Y6KA 1ZM1A 1BHGA 1KJRA 2ZGTA 2VZOA 4NPMA 1OH4A 3RPQA 1BK0A 2IXHA 2WNUA 4JRAA 3WNOA 4AYUA 1G9BA 2JG8A 5DXDA 2SBAA 1DLCA 3ZYJB 2Q8DA 2R063 2X5IC 3MBWA 5JPNB 4DZGA 1UY0A 4HKWA 3ES1A 5FYYA 4M4PA 3ILFA 2JKXA 3FLTA 4G9SB 2D5FA 4HT1T 4XBQA 3MIEA 1BQPA 2FBEA 4H3WA 1RGSA 3AP4A 3WUDA 5L9VA 4PF5A 5L9RA 4KMQA 2GZWA 1QJY1 2RJLA 2BW8A 4IERA 2XUMA 1SLBA 5DZEA 4LO8A 3WZ1A 1UOJA 2D3RA 1RC6A 5FLHA 5J3UA 5GKAC 3MLJA 4YSFA 5K0UA 4N8MA 5C8CB 1AXKA 1BEV2 2PQQA 3M3EA 2WZ8A 2DURA 2PHTA 3K4ZA 5A32B 4BK4A 1AR71 2HWF2 4I0AA 1OURA 1UXZA 1OQDA 3CMGA 3ST7A 3O1SA 5CAZA 1VE0A 3H1YA 3K51A 4JKKA 4NROA 5CU1A 5JOZA 2EALA 3LEGA 4FPHA 4NUBA 4QWNA 4IV1C 4RS5B 4BMEA 5FZMA 3GJBA 4YWAA 4KWKA 1IS6A 1ZZ6A 2HWC1 4PDWC 4X8PA 4JV4A 2VMCA 5AFEA 5CB7A 4GH4B 4Y4YA 3I3MA 1H8TC 5EIYB 3T08A 2CGPA 2YBSA 5FP7A 5BNPB 2V5YA 4O9GA 4BQ1A 1NLQA 2HWB3 2YV8A 3ZXJA 4Q0PA 2W47A 2BGPA 1GZ9A 1V00A 2VZTA 3P3PA 4LA3A 1YLLA 1NA1B 4CU7A 2P6HA 1E57A 1VBD2 2QFEA 4YGDA 2AZ5A 2QDRA 4E4DX 1SFPA 2P5BA 3GJAA 1X50A 3FBMA 1XNCA 4FOYA 3IPVA 3TB0A 5FPBA 4AI2A 1C5HA 3KQRA 4R9AA 4OUEA 5GJ6A 4I3GA 4LBJA 4DQAA 2GAUA 3SEEA 1V9U3 4JHTA 2VJXA 5EJ1B 4AVCA 1LU1A 4NHKA 2XXZA 4XUPA 1AYM2 4QDSA 3ITQA 4BQWA 2WDBA 4E9KA 3RNSA 5KXEA 4PI2A 2YZ4A 4Q4V1 3DCQA 2H0BA 2UWAA 4XW3A 5DZGA 5EV7A 3GBWA 2R6QA 3OUIA 5FUIA 5FYIA 1RUI1 1QNYA 5LRSA 1JZ8A 2JDNA 5I8YA 3C2UA 2BWCA 3B00A 2VCBA 1E5SA 3KCYA 4OI2A 4WBBA 3C7GA 2QQLA 3VHOA 4C0BA 1OFSA 2W2IA 2D6OX 1XE8A 1X82A 1ZBA2 2AH2A 3QH6A 1IZ3A 2A71A 4GKYA 4BH9A 4A41A 1FV3A 5JSRA 4LBQA 4HOOA 3SCHA 3H50A 4YARA 3BPZA 4UOJA 4ZU7A 5CIRA 2CAUA 4IE6A 3UESA 4B7KA 3SKVA 5HPOA 3FHQA 3H1WA 4IV1A 4RGAA 1PO11 4ZU5A 3WW1A 4BXFA 4GWNA 1GR3A 1DGRA 3FBYA 4YVWA 3W58A 1ZREA 1LEMA 1W99A 3K2OA 4RFRB 2D3SA 2NLRA 4Q4X1 1Z0HA 1NCQA 3AMNA 3M8LA 1US2A 3QCWA 2Y6LA 1S0EA 3NKTA 2ZEYA 2R1DA 1LCLA 5CVRA 3NQHA 1AYN3 2ZJCA 5A7SA 4YM2A 4QX1A 3G6JB 3PNAA 4J25A 1D4VB 1OXCA 2OS2A 2ZGNA 3OBZA 4M3CB 3OEAA 4MGTA 2HBTA 3TNPB 3RGBA 1YFWA 3UT0A 5GZDA 2VL4A 4GMP1 2K9ZA 3VL8A 3JU9A 2RJ2A 1OH3A 4CE8A 1J1TA 1GANA 1LEDA 2V4VA 2C24A 3PDQA 1QDCA 4LKDA 1YQ6A 1S4CA 4O9EA 1U0AA 2UU8A 4IGQA 5F8PA 1RHI2 4JCKA 1I1EA 2OKXA 4P9XA 2O8OA 4W6YA 4XZPA 5BNOC 1JHNA 1VMFA 3CQOA 4QX7A 4DEQA 1IG3A 1L7QA 3ZYPA 2B46X 2CGNA 4HSLA 2WT2A 5F3CA 3ON7A 1KJLA 1O4ZA 1GKBA 4JDOA 4HANA 5GZFA 3WD5A 4KU8A 5ANNA 3ZSKA 3AVRA 4MV2A 2BWAA 1R1A2 2ENRA 1NCRB 3CU7A 1X33A 3IWZA 3WDTA 2JDHA 4GB33 4GZ9A 1PO21 2E33A 2WKKA 1WD3A 3H1MA 1EYBA 2PELA 4CP9A 1EP0A 2JIJA 5FYTA 3IDBB 3E6CC 4GWIA 1N1TA 1J84A 3MIFA 5BV6A 1NOVA 1OPOA 3AM2A 4WM8A 3VD7A 4Y5SA 4M3CA 2Y0OA 3VV1A 1LU2A 1RUE1 1W9YA 1QXPA 2WZEA 4YRDA 3T1LA 1AZDA 1W0PA 2YBPA 4RQPA 5DPNA 2VTXJ 4GAZA 5LA0A 4BA6A 5LY1A 3R4UA 3S6PA 1LULA 4XETA 2WAOA 1RUH2 4FOVA 5T54A 2B39A 3N9NA 1A34A 2WWSA 3DYMA 2BVBA 4IW3A 3PURA 2VNVA 3A21A 3ABZA 4QGMA 4GB32 1ZZ7A 2XBO2 3LQCA 3RJRA 3OCPA 1QH6A 1H9WA 1VMJA 1UO9A 4DUXA 1EAH2 2XWBB 1N3OA 1W2TA 2VM9A 3IN9A 1RVF1 3VHNA 2VVFA 1PGL1 1W8FA 2Q5TA 4ES9A 4IEVA 4WVZA 1U5IA 4XMIA 1WW6A 1CQ9A 4ASLA 1PZ7A 4PBPA 1P8JA 3WP5A 4E4SA 1JBCA 1G7YA 4GULA 4HPKA 4N7IA 4YVWC 3LA7A 4QPIB 5FPAA 3ZYFA 3O1RA 2RS12 2WS91 3DECA 4LXLA 1LOBA 3CIHA 2J1VA 3BU0A 4FPYA 4AZZA 1MEC1 3U10A 1L7RA 2Q0AA 4OZXA 3AKTA 5B2GB 2VMGA 1Z78A 1JZ2A 3H9AA 4ISQA 4DIQA 1HB3A 3VBRA 3MYXA 5DMYA 2PHLA 1N47A 2JEMA 1JOBA 3JBG1 1O6UA 1UOGA 4AI0A 1PGSA 3WG2A 4IEPA 2ZTNA 4IE5A 1HB2A 2A6WA 3W5NA 5IWFA 2YHJA 3DF0A 3DV8A 4K7JA 3ZM8A 1JZ6A 4IV3C 1MS0A 1JYCA 5FK8A 4GWMA 2YBKA 2W1WA 4QKBA 5F3IA 1VBA3 5AVPA 3H8OA 1A78A 2BOIA 1OLME 2PYTA 5FZHA 2XKOA 3CZUA 5FPXA 2R30A 1BZWA 1QKQA 1VR3A 4L99A 4PIXA 1T2XA 1ENXA 1PVC2 1TNFA 2DCYA 3N4MA 2BDRA 1RUJ3 5I0UA 4E8CA 3KF3A 1CIWA 3OD0A 2W0XA 3AYAA 2X09A 4FXGB 3VDDA 3IMMA 5EZWA 1GUIA 3URFA 1PX3A 2E31A 4XFCA 3ZFFB 5F9TA 1UPIA 2JECA 2ZHLA 2DWRA 1AL22 1MS8A 5F2SA 3WDYA 1N3QA 2YU2A 5CFCB 3GM8A 4CP9B 1JZ7A 2OPWA 4QDRA 2VCAA 2HWE1 5A7QA 4LK6A 1ND3B 1PMIA 4Q4W1 1WCKA 3NO8A 3UL2A 2W08A 1DGWX 4Y1ZA 1J3RA 2H6CA 1UQXA 1NE6A 1K5MC 4NO4A 4CP1A 1HQNA 3GHNA 2DTYA 3RDIA 3PIJA 1UX6A 1FOD1 4I02A 1K3IA 1NA1C 2BNMA 3UYJA 1TG7A 2R062 1K5JA 1EV12 4QU2A 3RWKX 2J1RA 3A4UA 3RMXA 2YC2A 3UK9A 2DU1A 3BYWA 2R16A 4Y4RA 2Y38A 2DUOA 3A0KA 5F39A 3AC0A 4PQ9A 5F3EA 3NV4A 1Q8OA 4LO7A 4MXWA 4RR3A 5DABA 4R4XA 4CXXA 3AYDA 4BQ2A 4XURA 2WYFA 1UY3A 2NP0A 1SPPB 4HVRA 1AVBA 2ZKNA 3FFQA 1M06G 5FWEA 5DAWA 4D3WA 2QE3A 3E1F1 4KWUA 5AFBA 5FZOB 1LECA 1F2NA 2GC0A 3BOWA 3WNKA 2WWJA 5C3SA 4Z8BA 5ERLA 2WSUA 3ETPA 1H2NA 3V0AB 3RZKA 5K0UC 3V65A 1QQP3 2W52A 1ZZBA 4RQPC 1REEA 2PHRA 1PZ9A 3M70A 5CFDC 2XGXA 2VOKA 1SBFA 2BUKA 3FUQA 3MICA 1ASJ1 2ZAAA 2QQVA 3VKNA 5FO8B 1X8EA 1ZRFA 4A3XA 3BODA 1XE7A 4XF9A 5EYYA 3KV4A 1C4RA 4BQ3A 4SLIA 2FD8A 2FCUA 2BGCA 3QH7A 4IETA 1GZWA 3N7JA 1DYKA 2E63A 3WEZA 1RUG3 2BZDA 2NMNA 1Q43A 2HWD1 2RDSA 1W2OA 2RS31 2WNUB 4OQ9A 3WQBA 1RHI3 4WM8B 2R49A 5BNPC 3QBQA 4L92A 1EPZA 3IDCB 4IE0A 2E6VA 5A3UA 3QACA 1COV3 3VKMA 5JUVA 4JGZA 3S5QA 1LGNA 4LTAA 1HX6A 1PK6A 4UT5A 5FYHA 2IUWA 3H0OA 2W92A 4O65A 2XJSA 4XPVA 2WL1A 3SNMA 4AAPA 4F7ZA 4FTEA 5B4NA 2WZR2 4A7YA 4ET7A 2H0VA 2V72A 3KMHA 3H3LA 3SHRA 4W8JA 2YYOA 1UZWA 3VD9A 2EAKA 2B8MA 4PT6A 1ZBE1 2EIDA 4SBVA 1VBE1 4XJZA 5FYZA 3J8F3 2Y60A 3LFMA 4YW4A 4XF4A 4AEDB 2AGSA 1LOEA 4S2FA 1RYYA 1XSRA 4META 2PHFA 4BIOA 2GC3A 4P9YA 1MACA 3RYPA 2RDRA 3LFIA 1KGYA 1VBC1 4EV0A 2JIGA 3O5SA 2F17A 5ACA2 4HPKB 2ZOEB 2ZCWA 3JD71 2OQ6A 1MQTC 2ILMA 2WS93 4H7MA 2O14A 3H8UA 1US3A 2CSGA 4WVMB 2ID4A 5CKMA 3VBOC 4AFCA 5FQ0A 4FTSA 1J83A 3IT8A 1ONAA 2WIIB 1W9FA 3UKTA 1OKOA 1D2QA 4M00A 3CNAA 1C3HA 2OX0A 4F83A 5JVVA 4KBBA 3BN6A 4L97A 1IGOA 3KVAA 2ZMNA 4LUKA 4JVAA 4M4RA 1G86A 1V6OA 3TN92 4O61A 1ZZCA 4ZU4A 2W1SA 3I3BA 1PIV2 1XJAA 1IOAA 4YZ3A 2OPKA 2IVJA 4CDUA 1WCDJ 1R1ZA 2E7QA 3WT3A 5JMCA 2ZGKA 1VAVA 1WKYA 2A7AA 5JXHA 2MEV3 3T4HB 1SCRA 3DGTA 5I8SA 2BTVC 3EJKA 2ZEXA 4B8EA 4FPCA 1K5MA 5HBAA 2FMDA 3I59A 4CUBA 3C7FA 4LK7A 3LB9A 3JB4C 4XF3A 4UW5A 4R4ZA 2P34A 1C5IA 4YVSA 4IUGA 4XQWA 3SH3A 3U37A 3N7KA 4LHKA 1RUE2 4TWTA 4NAMA 3UETA 3AFGA 1HRI2 1L7LA 2QQOA 3OPWA 2BJSA 3J26N 5A3MA 1OLRA 1RUG2 3V64A 5H9RA 3N9PA 1QJX1 2GP5A 1KEXA 3KSCA 3VGIA 3WDVA 3BTYA 2N7GA 2XJRA 4RYDA 1SG3A 1UMIA 1X36A 3MW2A 5DG2A 1W6OB 4OHYA 4AVTA 5B4XA 4B3NA 3BIEA 3IM0A 2HYKA 3KS7A 3LA3A 1XPWA 4W6XA 3CBNA 2W39A 4BOWA 4IL7A 3O1VA 5A7NA 2YFZA 1QOSA 1NQDA 3OG2A 3ZKUA 5IVJA 1FNZA 2V5DA 4YLZA 3ZDVA 5FZKA 1QNWA 5JOXA 3EQEA 2OZJA 3B94A 1NXD1 3WHUA 3WHTA 1C8M1 2RR11 3ZYRA 1O3QA 2RS53 4ZONA 5IAVA 1LHNA 5FZEA 2G1MA 5E1RA 1POV0 3T0DA 2D3PA 1I6XA 1NCRA 1VRBA 2EIEA 3PTRB 4N43C 3RZLA 1W2NA 5ABJB 2RS11 2WS92 2Z5WA 4QPWA 5EQUA 4HMZA 3TEWA 3H8XA 1F5JA 4LHNA 5F6KA 1QDOA 3WG4A 3WNPA 5KHGA 2VZ1A 4YVSC 1OOPB 1K12A 5BNQA 4BU2A 2XR4A 2VZPA 3GNEA 1ZA4A 5IVCA 2VCCA 5C71A 4K6BA 1RB8G 3LKJA 3ZIWA 3MFAA 1OLMA 2JDYA 3OY8B 2D97A 2YG0A 5FYSA 3FMGA 3T0AA 4X6QB 5AVAA 1ZBA3 3UV9A 4QB1A 2PAKA 4XE9A 1LB2A 1Z7S1 2SLIA 4W6WA 2WO1A 3ZDSA 1ZNPA 4DXTA 2WC2A 5FMCA 4BHPA 4N9HA 4S2DA 5IHRA 2R071 1QIQA 5KWRA 2VUCA 2VQAA 3E5UA 1F4AA 1POQA 3VBHA 2CNAA 5E88A 5FPVA 4FQZA 3FWEA 1O4TA 4OMDA 1S0CA 3HOBA 1S0BA 2XWJB 1B09A 2OYZA 3K3NA 1OT5A 2GMEA 4P9WA 1IPKA 2ZGLA 1VBD1 1CGPA 4P9LA 2WR9A 1QEXA 4JAAA 5GM0A 5J09A 3VBFA 2RJKA 1C57A 2XLGA 1DFQA 3U4XA 5CZKA 1CX4A 3CO2A 4LITA 5T5JA 5J1XA 3MW3A 5AC91 2QDNA 4IEYA 1VBB1 3ACFA 4UF0B 3ZN5A 2D40A 2ZBJA 3MGUA 4WZCA 5FJHA 4D6QA 3GALA 1UPSA 4MGZE 4NE9A 1QHDA 2VBBA 5FYBA 2OA2A 3PUHA 1E5HA 2PAEA 4B4RA 2FZ2A 2VZ3A 1AR72 2DBIA 2VUAA 3IPVB 1GSLA 2RMU3 1JYIA 4Y3OA 3CL1A 2JKBA 2QQIA 2HH9A 2A3WA 3TRSB 1RUI2 1D0GA 2A73B 3M3OA 5T55A 1UU6A 1YI9A 3DYPA 1PK6C 3N9QA 4FP2A 5DAPA 5EJ3A 4CXWA 4IE7A 2XJUA 3AZXA 3HNMA 5FZCA 4JGZC 1V6KA 1RVF3 2QQWA 3VBFC 3IAQA 4EN6B 2HWC2 4LEJA 4YGBA 5FREA 2VVEA 1MS3A 1UZ0A 3K48A 1N1VA 4GD4A 4MXVA 3PMEA 2GC2A 2QKDA 3ALQA 3N9LA 5D8AA 2WZR3 3ILNA 1R092 2JE8A 1QJY2 3LE0A 3AZYA 1R1A3 1GNHA 4JRLA 3WG1A 5A1FA 4IEOA 4E27A 1WW4A 1V6NA 3NV3A 4DXSA 3DKQA 3PVBB 4XHBA 5D21A 1MR5A 3AB0A 2ZGUA 4NWWA 2OXBA 2VQTA 3VKLA 4PLNA 4KNCA 4OI4A 4Q29A 1W90A 2W1QA 3RS6A 4Y1UA 2P6CA 4YPJA 3HQUA 3VLBB 3BTAA 1AR63 1PHMA 1AX1A 3ZN4A 3TAYA 4CDQC 3O1MA 4XEZA 3KWVA 2Q30A 2PFWA 1ACCA 3NV2A 5FY0A 2GNMA 3OPTA 4XHXA 4ZXEA 3WNLA 2Z2SB 1YJKA 2WFF1 5FLIA 2UYBA 3OPZA 4HN0A 2ZX3A 1JODA 4TN7A 4P14A 5FCCA 4K8RB 4MYEA 4P5YA 4Q0UA 3MIDA 3PL0A 5CYYA 4TSVA 3WSOA 3HQXA 1FX5A 3QLQA 1BJQA 2IVIB 4MSVA 4MZUA 1YIFA 4M3CF 2GSYA 2GP3A 2WABA 4LUMA 3RSJA 1QJU2 2ADEA 2V09A 4G3YC 4EWAA 1W8UA 2ZZQA 1RUI3 5LK5A 1EV13 4LNVA 4B1LA 2QJVA 4CEWB 1XNAA 4M0HA 3WW3A 4XFBA 3VBUB 5ABJC 5K8SA 3VB9A 1OOPA 1OBNA 2VD7A 4XAEA 4NPRA 1ULCA 2EXHA 5L9BA 3LF7A 1F4HA 2MEV2 5CFDB 1OF4A 3LPFA 1ODMA 1TVGA 1UMHA 3POYA 5FYUA 1MQTB 4R9CA 1HN0A 3WR0A 3KT1A 2XVKA 2VE1A 4LHSA 1O5LA 5J96B 1FV2A 2OVUA 4AEDA 4WVVA 4GALA 4N90A 4HFSA 4AVVA 1POV1 4CPBA 3GZTB 3N7MA 5FZIA 4GH4C 3ZYBA 1EAH1 4NAOA 1APNA 4AI3A 1RITA 4MLOA 4XFHA 1FI2A 1PO13 1VAMA 2LS6A 2WNVB 5DDJ3 4D0QA 3KT7A 4QPYA 3WDXA 2G9ZA 3MV11 4LBLA 2XPJA 1FNYA 3SKJE 2BFUL 3K75B 3VBSA 5DUVA 1W28A 4FTBA 2MNGA 5JR2A 1R093 4UFKA 1Y9GA 1ENSA 3MW4A 4CRQA 5A3WA 3HQRA 3W21A 1JZ3A 3BOPA 4FCAA 3SXWA 1UZVA 4LLFA 3AK0A 4XCAA 3S0MA 1IG0A 3N35A 4BLJA 3HBKA 3PVNA 2WQZC 1LKNA 4YW2A 4Z2AA 2H6BA 5LASA 4J6GA 4XJAA 1IPSA 3NVCA 2P4EA 4TLGA 1NZCA 1PO12 4WM7B 1ULDA 2QCSB 3NW4A 4XIOA 3KHCA 1DGRN 1ODNA 2EA7A 2O0OA 4AEKA 2R042 2YPDA 4IQPA 4DPNA 3BTXA 3SEPA 5LCWL 4JC1A 4PDWA 3VZKA 3J4UH 2HWF1 3ZXKA 2RV9A 3U0ZA 3TEYA 2XDVA 5FMBA 1K5MB 3AL6A 4LBNA 2HWD2 1ULEA 2D6KA 3P1IA 3UJOA 3HNYM 3CHXA 1BBT3 4UAPA 1PVXA 1WZXA 3W20A 3L2HA 1GP5A 5KHHA 3VKFC 2KM2A 1W8TA 2RS33 2J42A 3NNJA 4LBKA 2ADDA 1HJGA 1OHFA 3NL1A 1MQTA 3GBGA 2IWGB 2YDEA 5FDBA 3KLSA 3U1XA 5LBFA 1UU4A 3R4SA 1W6PA 4XFFA 1PK6B 4OYUA 3RWNA 3BVCA 3MIHA 5KR7A 2FQPA 4UBHA 1KS4A 4JGZB 3ZXFA 4HG6B 1JUIA 2B9VA 3EXUA 3LDBA 1G9FA 4IEXA 3VBFB 3VKOA 3WINE 1HLCA 3GGLA 3LEKA 1YO8A 4BJ0A 1OD3A 2AEZA 4OVEA 4Z2WA 4PCRA 3HVDA 4AI8A 4BYYA 3E5QA 4IESA 3FHIB 5K0UB 5D8AC 4GH4A 3NNGA 1W03A 4XUOA 3LA2A 3B7MA 1O4YA 1RUH1 5KC6A 4OHZA 1DGWA 4FFIA 4AI9A 2YFUA 3P6BA 3EYPA 4XJ9A 3AVSA 1CAUB 1GNYA 1QU0A 5SV5A 4OHVA 4ZXKA 3CLPA 4FOQA 4PDWB 2Y33A 4KH9A 4Q4V2 1OF3A 1H9PA 2CDPA 2VC9A 1JS9A 2ZAHA 4OFGA 1HW5A 1PMHX 3OD4A 1WLDA 4XILA 2C0ZA 4OCTA 1KQRA 3WNXA 1RUC3 2PQSA 1HRV1 4L8QA 2WT1A 3LGRA 3S7EA 3VD3A 3WW4A 3WF1A 4RA0A 3AL5A 2VY0A 1TMF1 5C70A 4XQDA 4CU9A 5FP3A 4RR3B 5DZFA 1U12A 1UIKA 1NG0A 1OUSA 2JDPA 4XFGA 1W05A 2QVSB 4BM8A 4C90A 3JQXA 1QJFA 1PX4A 4U2AA 3M2MA 2TBVA 4K20A 5FZAA 3CKHA 4QX0A 3D5OA 4DUWA 4BDVB 4BQYA 4C1XA 3GYDA 5APAA 4KBZA 3ZX7A 4HN1A 4COZA 1HRI1 3AP5A 1W9WA 4A42A 2CTVA 2ZHNA 4MADA 3LDRA 1QWRA 4Q4X3 3ZMNA 2W5FA 4PJYA 2F4PA 1QMJA 3RZJA 3POEA 3IIAA 5BUVA 5EFUA 1H1AA 2JICA 1W6MA 1OC1A 3J7LA 4HL0A 5T5PA 2D6MA 3OBAA 1YUDA 5FKCA 4LJHA 1QJX3 5DAVA 1H4GA 4COUA 4NHLA 4XIKA 2JDMA 1GQGA 4A6SA 1JN2P 3V0BB 5EPAA 2FDFA 1UY2A 1H8TB 2JD4A 3AKQA 3HEIA 4Q4V3 4YG0A 3K46A 1HB4A 1HV1A 2K46A 5A3OA 2ZGSA 1JW6A 1UU5A 4QHOA 1ND2B 4CPBD 1CWPA 2Q4SA 2HWE2 5J37A 4CU8A 2E7TA 4LLOA 3K4DA 2E51A 4NOTA 4JDNA 4AK3A 5A70A 2L9LA 1KRIA 1W8NA 4QQHA 2ZX1A 4CCCA 2V4AA 1VPHA 3EB7A 5A32A 3R6SA 4N43A 1R091 1PMJX 1ZZ9A 1WMFA 5JOWA 4DUVA 4EROA 4JTNA 2RS13 2PHWA 1IHMA 3ACIA 4FPOB 3VBRB 4RHV3 1H0BA 1MZ5A 4KWLA 4YW6A 2PN5A 2BFUS 1JYTA 3CZJA 1FOD3 3D3AA 5GLVA 4E2GA 4Q4Y3 2EXIA 3LSDA 4RN5A 1RMU1 3FZ3A 3U07A 3FHAA 1VB4A 2Y26A 5EXOA 4CDQB 4KGGA 3THCA 1CONA 4BIFA 1VIWB 1ZX5A 2BVVA 2XUEA 4V2VA 2JJ6A 4P9GA 1W6NB 2XHKA 5HCHA 2C26A 5CFCA 2HWF3 4R52A 4EN8B 1X9TA 3AMMA 5A6XA 3LSEA 1ZBA1 2J1AA 3L9JT 4LKSA 1VRH1 2UY9A 4B1MA 3BUCA 3BB6A 1OFNA 5L7OB 2R043 4CCNA 1ULPA 3AMPA 4LOTA 1FPN1 2RM21 3WF4A 4BZ4A 4OUMA 4QX2A 4IEQA 3ZLIA 5FPUA 1G9DA 2WN2A 3I7DA 5LBCA 1H30A 2NQYA 4QQ2A 5C8CC 3ETQA 4MGQA 1D7PM 1NCQC 3APBA 2PLV3 5D8AB 3NNFA 5LZ6A 4AI1A 3L2YA 2WNEA 3WCSA 1CJPA 2NN8A 3SH4A 5IYYA 4YZ5A 2BP6A 4YG6A 3ZXEA 5GZCA 3WDWA 1D4M1 1KITA 2G19A 5A1LA 2ET1A 4XZUG 1UL9A 2LW8A 1C1FA 1FXZA 2X10A 5T50A 2BYVE 1RUF3 2DUQA 3CF6E 3RI9A 3I3DA 4N9IA 1AR81 4OHXA 4XTPA 1MS1A 4S2GA 4XBLA 4UW3A 3AFKA 5C9AA 2XQRA 2Y6HA 5C4WA 1D0HA 2P3JA 1LODA 1Y3TA 3Q9OA 1UCXA 4TLFA 4QAWA 1DYOA 1GOHA 4W4ZA 4AEMA 1ASJ2 2E53A 5JSOA 2QQMA 1YIPA 3VHRA 1LJ7A 2A70A 5K7PA 2RMU1 5HXVA 3ACLA 2BNNA 4XFAA 4AQTA 3KGLA 4J1WA 1O59A 3AZZA 5F32A 1RUC1 2YXSA 3POBA 1LOAA 1XNTA 3WF3A 3KGZA 3CJIC 4Y1XA 1O91A 4DO0A 4K9SA 3WLUA 5FZLA 2BEOA 2XJTA 5T5OA 1DDLA 2WUHA 1UY4A 3ELNA 2C1FA 2F6BA 1I5ZA 1FATA 2BRTA 1AXZA 4QQOA 4DMIA 1ULGA 1EPWA 5FZ0A 1YQCA 4LIUA 5C5UA 4RHV2 1OA3A 1R1A1 1SACA 2OIIA 1AJOA 2PA7A 4E4ZA 5FZOA 2GDFA 1S2KA 3NJXA 4DXZA 1ST8A 4AWDA 4DXRA 1ZA7A 1R64A 2XL9A 3M7AA 3R4DB 4XACA 3WW2A 3ZXGA 4WM7A 1OVPA 2TEPA 2ZGQA 1GQHA 4AHYA 3LOIA 2B4KA 2OW4A 1OQEA 3MUY1 4AE2A 5BNPA 4ZPIA 2ARCA 4LE3A 1UY1A 1LESA 4JDMA 3JUUA 4HKOA 5LA2A 4EJRA 2W1UA 4DS0A 3KCXA 2I07B 3ZVXA 2J1UA 2ZX2A 4M3CE 3POJA 2QNKA 1CR7A 4ARXA 3JB8A 1GWMA 3I2IA 4R9DA 2C9KA 2R061 4EWEA 2EVXA 5I93A 4C8DA 1QOOA 4FP3A 5LATA 1S0DA 3POGA 1O8SA 2G9GA 3OUHA 1RUJ2 3FE5A 4IEUA 2VZUA 1WW7A 3HJRA 2IFWA 2XHNA 3F95A 4UFMA 2ZABA 2VOVA 3DL3A 3ES4A 1RUD3 1QGLA 3FN9A 3VDDB 1V0AA 3VBHC 1AYN1 4YW1A 4RD7A 2VH9A 2HJIA 4FT8A 5C9AC 2FDIA 1GOFA 3S30A 1AR91 2VZQA 3O0XA 4QGNA 4E8DA 1S0GA 2IFRA 2VMEA 2B9UA 5GLZA 4CA9A 4CCOA 5CG8A 1UOFA 1N3PA 2R072 5E89A 1AR73 1XU1A 4AW7A 3Q8BA 3WUCA 3OYWA 1S0FA 3POWA 4NR1A 4Q0SA 2ZGMA 4N53A 1QJEA 2CV6A 4GA9A 4Y20B 3HN1A 3OGVA 4E4HA 5CA6A 1PIV3 3HAGA 4D6RA 3NV1A 1H2KA 4QD2A 5FUPA 4CDUB 1MPXA 2JDAA 1AXYA 1NE4A 3EMRA 2HWE3 2I45A 1RUG1 3AXDA 4IV3B 2PHDA 2J22A 4WV8A 3UKNA 2XLAA 5JXGA 1KS5A 4QX8A 4Z92B 1RTVA 3N9MA 3VBSB 4EZ4A 5JI9A 1DF0A 4K1ZA 5IK4A 1WD4A 4HSJA 2WINB 1X7NA 3JBG3 5FZ9A 4YFWA 1PVC1 1Q8PA 2R041 3RI8A 2NM1A 3PVOA 3KM5A 1WBFA 3THTA 4LKFA 4I0WB 1JUHA 1FYUA 1R081 5H9SA 3JXSA 2WLPA 2RDNA 3OUJA 4BK5A 2JDZA 5FTTC 5CADA 5KXCA 2ZKLA 3OEBA 1RUNA 3AKRA 1JZ5A 1CIYA 3KCCA 3NMBA 1VBA1 4NRQA 5IUQA 3ZN6B 2VCMA 3K77A 5JCTA 5L19A 4Q5OA 2BBVA 3LIHA 2D98A 1YXWA 4X8NA 3ORJA 4MHRA 4EE2A 4JZRA 5L7OA 2ZACA 1ZZ8A 1YNAA 3KV6A 3TOJA 1CVNA 2JG9B 3AP9A 3U4SA 1NQJA 1QJY3 1REFA 1Y4WA 2DUPA 2VOXA 3N9OA 3FJSA 5A1AA
chains in the Genus database with same CATH topology
5FZ0A 4LIUA 5FZ4A 5FZFA 3LD8A 5FZOA 5F5IA 4Y3OA 4Y4RA 5FJKA 2XMLA 4IGOA 4CUGA 4D6SA 2YPDA 5F39A 5F5CA 5F3EA 5FYTA 5IVYA 4CSWA 5FXXA 3N9QA 2P5BA 2XDVA 5FZCA 3AL6A 5IVVA 5FYMA 3K3OA 5FPBA 5FY4A 3OPWA 5FWEA 2YBPA 3KV9A 3U78A 3N9PA 4GD4A 2GP5A 4GAZA 5FZOB 5LY1A 2XXZA 3PU8A 5IVFA 2WWUA 3N9LA 2WWJA 5IVEA 3N9NA 5FZ6A 5A1FA 3PUAA 3PURA 4EZHA 5A7WA 2PXJA 5F37A 5E6HA 5A7NA 5FYIA 5IVJA 4C8DA 2Q8CA 5KR7A 5FZKA 4CCNA 4QXBA 3KV4A 3LDBA 5FP8A 5FBJA 3DXUA 5K4LA 2XUEA 4HONA 4V2VA 2W2IA 5FZEA 5FV3A 4UF0A 1VRBA 3PTRB 4QXCA 5FY0A 3OPTA 2Q8EA 4IGPA 4GJZA 4AI9A 4HOOA 5FPAA 3AVSA 4TN7A 5FZGA 5F2WA 4LXLA 5A3NA 5FYHA 4CCOA 4BXFA 4AAPA 4V2WA 4BU2A 4LIVA 5FPUA 5CEHA 3ZLIA 5FZBA 5FZ8A 5IVCA 5LY2A 5FXWA 3K2OA 4DIQA 5LW9A 4BISA 2GP3A 4URAA 2Q8DA 3ZPOA 5FY9A 5FYSA 4QU1A 2YU1A 5ANQA 4QXHA 5FPLA 5FYVA 4E4HA 5IWFA 4CCKA 5FYZA 5FY7A 4D6RA 5FYYA 4EYUA 5FUPA 3NJYA 3AL5A 2VD7A 4CCLA 5F3GA 5A7SA 5FUNA 5A1LA 2YBKA 3PU3A 5F3IA 5FP3A 5A3TA 2OS2A 5IW0A 5FYUA 5FZHA 4QX8A 3N9MA 5FZ1A 5FZDA 4EZ4A 5A7OA 5FZ3A 4GJYA 3PUSA 2OQ7A 2OQ6A 5FZ9A 5FZIA 5IVBA 5FPVA 5FXVA 5FZAA 4CCMA 5A7WB 4CCJA 4Y33A 5A80A 3PDQA 5FWJA 5FP9A 2OT7A 3K3NA 5FY5A 4IGQA 5F2SA 2YU2A 4NUBA 4QWNA 4ASKA 3DXTA 5FYCA 2OX0A 5LWBA 5FZMA 5F32A 5A7QA 4QX7A 3PUQA 4XDPA 3KVAA 5A3WA 5FXZA 5A7PA 4DO0A 5FY8A 5FY1A 4LITA 5FZ7A 5FP4A 5FZLA 5F3CA 3KV5A 4UF0B 4XDOA 3RVHA 3KV6A 3KVBA 5FJHA 4D6QA 3AVRA 3U4SA 2YBSA 5FP7A 5FYBA 5ISLA 5A3PA 3N9OA 3UYJA 5F5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZ0 A;  4LIU A;  5FZ4 A;  5FZF A;  3LD8 A;  5FZO A;  5F5I A;  4Y3O A;  4Y4R A;  5FJK A;  2XML A;  4IGO A;  4CUG A;  4D6S A;  2YPD A;  5F39 A;  5F5C A;  5F3E A;  5FYT A;  5IVY A;  4CSW A;  5FXX A;  3N9Q A;  2P5B A;  2XDV A;  5FZC A;  3AL6 A;  5IVV A;  5FYM A;  3K3O A;  5FPB A;  5FY4 A;  3OPW A;  5FWE A;  2YBP A;  3KV9 A;  3U78 A;  3N9P A;  4GD4 A;  2GP5 A;  4GAZ A;  5FZO B;  5LY1 A;  2XXZ A;  3PU8 A;  5IVF A;  2WWU A;  3N9L A;  2WWJ A;  5IVE A;  3N9N A;  5FZ6 A;  5A1F A;  3PUA A;  3PUR A;  4EZH A;  5A7W A;  2PXJ A;  5F37 A;  5E6H A;  5A7N A;  5FYI A;  5IVJ A;  4C8D A;  2Q8C A;  5KR7 A;  5FZK A;  4CCN A;  4QXB A;  3KV4 A;  3LDB A;  5FP8 A;  5FBJ A;  3DXU A;  5K4L A;  2XUE A;  4HON A;  4V2V A;  2W2I A;  5FZE A;  5FV3 A;  4UF0 A;  1VRB A;  3PTR B;  4QXC A;  5FY0 A;  3OPT A;  2Q8E A;  4IGP A;  4GJZ A;  4AI9 A;  4HOO A;  5FPA A;  3AVS A;  4TN7 A;  5FZG A;  5F2W A;  4LXL A;  5A3N A;  5FYH A;  4CCO A;  4BXF A;  4AAP A;  4V2W A;  4BU2 A;  4LIV A;  5FPU A;  5CEH A;  3ZLI A;  5FZB A;  5FZ8 A;  5IVC A;  5LY2 A;  5FXW A;  3K2O A;  4DIQ A;  5LW9 A;  4BIS A;  2GP3 A;  4URA A;  2Q8D A;  3ZPO A;  5FY9 A;  5FYS A;  4QU1 A;  2YU1 A;  5ANQ A;  4QXH A;  5FPL A;  5FYV A;  4E4H A;  5IWF A;  4CCK A;  5FYZ A;  5FY7 A;  4D6R A;  5FYY A;  4EYU A;  5FUP A;  3NJY A;  3AL5 A;  2VD7 A;  4CCL A;  5F3G A;  5A7S A;  5FUN A;  5A1L A;  2YBK A;  3PU3 A;  5F3I A;  5FP3 A;  5A3T A;  2OS2 A;  5IW0 A;  5FYU A;  5FZH A;  4QX8 A;  3N9M A;  5FZ1 A;  5FZD A;  4EZ4 A;  5A7O A;  5FZ3 A;  4GJY A;  3PUS A;  2OQ7 A;  2OQ6 A;  5FZ9 A;  5FZI A;  5IVB A;  5FPV A;  5FXV A;  5FZA A;  4CCM A;  5A7W B;  4CCJ A;  4Y33 A;  5A80 A;  3PDQ A;  5FWJ A;  5FP9 A;  2OT7 A;  3K3N A;  5FY5 A;  4IGQ A;  5F2S A;  2YU2 A;  4NUB A;  4QWN A;  4ASK A;  3DXT A;  5FYC A;  2OX0 A;  5LWB A;  5FZM A;  5F32 A;  5A7Q A;  4QX7 A;  3PUQ A;  4XDP A;  3KVA A;  5A3W A;  5FXZ A;  5A7P A;  4DO0 A;  5FY8 A;  5FY1 A;  4LIT A;  5FZ7 A;  5FP4 A;  5FZL A;  5F3C A;  3KV5 A;  4UF0 B;  4XDO A;  3RVH A;  3KV6 A;  3KVB A;  5FJH A;  4D6Q A;  3AVR A;  3U4S A;  2YBS A;  5FP7 A;  5FYB A;  5ISL A;  5A3P A;  3N9O A;  3UYJ A;  5F5A A; 
#chains in the Genus database with same CATH topology
 1YI7 A;  2QQP A;  3T30 A;  3UNP A;  1JYW A;  1QQP 1;  4HZF A;  5FZF A;  2GN3 A;  2VPV A;  3CEW A;  3PTY A;  5F5I A;  5C4W C;  1SFY A;  4XBN A;  2P3Y A;  3FUO A;  2QQJ A;  2UWC A;  4ZZ8 A;  1JYX A;  2ERF A;  2VMD A;  3T2Q A;  2A75 A;  4A2U A;  3MLK A;  1YQ8 A;  1CZV A;  4WVW A;  2X29 A;  2HLE A;  3PIG A;  3SH5 A;  5I0D A;  5FY4 A;  1PGW 1;  4XJU A;  1NLR A;  4LPL A;  3U75 A;  5BXX A;  1CZS A;  3T3Y A;  3T2O A;  3U78 A;  3ZXA C;  2PLV 2;  5JIA A;  1BYH A;  3O14 A;  2GH2 A;  1HDK A;  4XDQ A;  2WA4 A;  1UYZ A;  3I3E A;  4B29 A;  4B4Q A;  1AUY A;  1Y9Q A;  1YC6 1;  1F8V A;  2VUL A;  3A22 A;  1IS4 A;  1DG6 A;  1RJ7 A;  3NWK A;  3AJY A;  4UFH A;  4DY3 A;  1FMD 3;  3B93 A;  4UW4 A;  4CDW B;  1OSG A;  1RMU 2;  5LB6 A;  4R9B A;  4MGS A;  1GBG A;  1TME 1;  1AL2 3;  3AYE A;  1BMV 2;  3VD4 A;  5LRR A;  4FAG A;  1LTE A;  4S2H A;  3VBO B;  4NRP A;  3ZFG A;  1NY7 1;  4AFA A;  2K0G A;  1C28 A;  1U5Y A;  1SBE A;  1O3S A;  3RG0 A;  1J3P A;  4JQT A;  1H2L A;  3VBO A;  3ZFG C;  5L7O C;  3O1O A;  2XON A;  3O1U A;  2DFB A;  5A3L A;  1TMF 3;  4XXP A;  4JQR A;  1ALY A;  2WNU C;  4K40 A;  5AC9 2;  1FPN 2;  2RM2 2;  4OMC A;  4WM8 C;  2W95 A;  2D6N A;  4NMI A;  1XBF A;  2W87 A;  1DU3 D;  1UYX A;  2JD9 A;  3IBM A;  1GWL A;  3M1H A;  5KHK A;  5FZB A;  3VBU A;  4LBQ B;  4NHX A;  4ARY A;  4NVP A;  3JD7 3;  3NNM A;  2V73 A;  4URA A;  3LCP A;  2W9X A;  1B35 C;  5JDB A;  1W04 A;  3HD8 B;  2FHR A;  5FY9 A;  1DLL A;  4QU1 A;  3W5M A;  5FYV A;  3ZFF C;  4OZO A;  3B3Q E;  2X8K A;  3J7H A;  5HCB A;  3SC7 X;  4NIG A;  1ZBE 2;  3VBH B;  2DU0 A;  2GNT A;  1C8M 2;  2A6X A;  2RR1 2;  4CYD A;  4L0P A;  3AYC A;  5C9A B;  1UF2 C;  4HK9 A;  3USU A;  3G7D A;  2RS5 1;  4ONU A;  1AL0 G;  4W65 A;  3OYW B;  5A3T A;  2JXA A;  5M0T A;  2VZV A;  3IB3 A;  4AVA A;  3BGA A;  3GF6 A;  3J7N A;  1MZE A;  4UWD A;  5ABJ A;  3GCX A;  3PUS A;  1GZC A;  2Z69 A;  2BER A;  3JD7 2;  1QJU 1;  4YFZ A;  1W8Z A;  1YFX A;  2UY8 A;  5FP9 A;  3BI3 A;  3KZ4 C;  4CDU C;  4W50 A;  1W8O A;  4LBM A;  3BTZ A;  1AYM 3;  1A3K A;  1COV 2;  2Q1Z B;  4I09 A;  4Y5Z 0;  2HEW F;  3SQO A;  4K8F A;  4K3U A;  1NUK A;  2Y6G A;  1WMD A;  1CN1 A;  3I2O A;  4H14 A;  2A6Y A;  4MGK E;  5C3Q A;  5LA1 A;  4A6O A;  4Q0V A;  1LHV A;  4XDO A;  4PI0 A;  1GZT A;  4ATF A;  2Y6F A;  3S7I A;  4AFM A;  2WFF 2;  3D8C A;  4QB2 A;  5JAX A;  1LHW A;  3MPB A;  3D4K A;  4N43 B;  2XKP A;  5A3P A;  4YNI A;  5F5A A;  4LBQ D;  1QXR A;  3MDP A;  3DPR A;  1CAV A;  2WZP P;  4CDX B;  1J58 A;  3LD8 A;  1QJZ A;  3VZL A;  2CYF A;  1X9P A;  2XML A;  1JMU B;  1PVC 3;  4P08 A;  1LHU A;  2ATF A;  4C0H A;  2BNO A;  3PHM A;  2ZHK A;  5EHD A;  3BKZ A;  2Y0I A;  3RZH A;  1O7F A;  1G6N A;  1RIR A;  4AGR A;  1RUO A;  2VMI A;  2WLQ A;  1WCU A;  3C7H A;  3I2F A;  4XYX A;  1YFU A;  3Q8F A;  4CP2 A;  3O0V A;  3TEX A;  1QJX 2;  1TQ5 A;  1XE0 A;  5DUW A;  1W8H A;  3AX4 A;  4XJ8 A;  1GYK A;  3PUA A;  2WA3 A;  4XUT A;  3USS A;  4HBN A;  1ND2 C;  2DCT A;  3R0R A;  5F5Q A;  5HXM A;  3I49 A;  3INA A;  2E26 A;  3B01 A;  2JDU A;  2CGO A;  4IDZ A;  2PMW B;  1GU3 A;  1V6J A;  1Q8V A;  2CL2 A;  5DUU A;  1OA4 A;  1PO2 3;  4NRM A;  3ZSL A;  4ORF A;  4C1W A;  2B42 B;  1XU2 A;  5FP8 A;  1LAJ A;  4TZD A;  4FVV A;  1HRV 2;  4AG4 A;  3KT4 A;  1DBN A;  2WSV A;  3RYR A;  4ZKT B;  1GIC A;  4YM0 A;  4UF0 A;  1AYN 2;  3TN9 3;  4A45 A;  3J8F 1;  1T6G C;  3OGJ A;  3ROU A;  1GP6 A;  3C7O A;  1AR9 2;  1KDM A;  1XYP A;  3VBU C;  4PHZ A;  2HBU A;  3NJZ A;  4AED C;  2FMY A;  1BBT 1;  3ACH A;  4JGY B;  4PQQ A;  3O1T A;  3AP7 A;  3EBR A;  5A3N A;  5FPZ A;  2ZEW A;  3X29 B;  3POF A;  3ZSE A;  1VBC 3;  2DFC A;  4V2W A;  3OSD A;  2W91 A;  5CFD A;  2XQX A;  4A44 A;  5EP9 A;  2QQN A;  1OOP C;  1ENQ A;  4BIS A;  2E9Q A;  1CAV B;  1W3X A;  3WNM A;  4CDX A;  1CX1 A;  2CHH A;  4GKX A;  4LOS A;  1KD7 A;  3RZZ A;  4Q4W 3;  4QDQ A;  5K9Y A;  1A8D A;  4P02 B;  4WVM A;  2VAU A;  1BKZ A;  2B5H A;  4CCK A;  3VL9 A;  3J7M A;  4YZ4 A;  5FUN A;  1IS3 A;  5JMO A;  3ZFE C;  1ZRI A;  3WOG A;  1JXN A;  5A6Y A;  3Q8C A;  5DN2 A;  4FQ4 A;  5CIS A;  5A7O A;  5H9P A;  5JXJ A;  2OQ7 A;  1U5X A;  4GXL A;  1NCQ B;  2VXR A;  4QGL A;  1XB9 A;  3LZZ A;  2R7E B;  2WBK A;  3AZV A;  1AHS A;  4RS5 C;  2EXJ A;  5LBB A;  1ZYB A;  1LOG A;  5FWJ A;  2OT7 A;  4BMB A;  2XB6 C;  1CAW B;  4P5H A;  4P9I A;  4EN9 B;  2EIG A;  3B9C A;  1ZVF A;  1TMF 2;  3TEZ A;  1URX A;  1F35 A;  3WF0 A;  1XOY A;  3MZH A;  1ULF A;  1HRV 3;  3IKW A;  1JOP A;  1SLA A;  5A7P A;  5GZG A;  4AAX A;  1RED A;  4ZS2 A;  3H3U A;  5FZ7 A;  3T2T A;  4CCE A;  3Q8A A;  2EAA A;  1DZQ A;  2XBO 3;  3NAP C;  1KXG A;  1GLH A;  1OD5 A;  1L3J A;  1TNR A;  4GMP 0;  3O1P A;  1V9U 1;  2GNB A;  3KVB A;  4D69 A;  2GMP A;  3NKG A;  5HCF A;  2X5I A;  2D43 A;  3N36 A;  3OBT A;  4Y20 A;  2TUN A;  3I2J A;  1WW5 A;  1WA6 X;  2GND A;  2JG8 C;  3NJV A;  1SPP A;  4CUC A;  3TBD A;  4LO6 B;  4A7Z A;  1C8N A;  1RUJ 1;  4QX3 A;  4XAA A;  4LO5 B;  1DHK B;  4O7X A;  1QJU 3;  2UWB A;  1O5U A;  4OI1 A;  4RGG A;  2GN7 A;  2JE9 A;  2P1B A;  1F31 A;  3EO6 A;  1C1L A;  4IXL A;  2R0H A;  1S0J A;  3LWC A;  3PLQ A;  4AFD A;  1SQ4 A;  4YG3 A;  3IAP A;  4UXA A;  2EIC A;  2WWU A;  1RUF 2;  2W94 A;  1AR8 2;  3ZYG A;  3BIW E;  2QTW B;  3MUZ 1;  5FZ6 A;  3FLR A;  3T0B A;  1VRH 2;  4JKM A;  4EZH A;  1YQ5 A;  2PXJ A;  2QQU A;  1BEV 3;  5E6H A;  4ZY9 A;  3CJX A;  5LEJ A;  1OI6 A;  1TME 2;  2LM3 A;  4YYO A;  4BE3 A;  2ARB A;  2R0F A;  4YZ1 A;  3F2Z A;  4FFF A;  2G4I A;  1CAU A;  2YY1 A;  4Y1V A;  3SCG A;  2KR2 A;  2VXJ A;  3B5L B;  1RUC 2;  3VZN A;  2VGD A;  4DEV A;  4QT6 A;  5DDJ 2;  2VEC A;  1G9A A;  3O0W A;  3OY8 A;  1BVV A;  2YPJ A;  4F8A A;  3VUO A;  5IK7 A;  1EUU A;  3ZFG B;  1W3V A;  1WCS A;  2ZX0 A;  1V6L A;  2CWS A;  5FK7 A;  3DN7 A;  1W9T A;  4K1Y A;  4M01 A;  4NJ4 A;  4Y22 A;  3FX3 A;  1S2B A;  1HXS 1;  4KL1 A;  3UGH A;  5JZG A;  5JZG C;  1H4H A;  3ZYH A;  2D44 A;  1JH5 A;  3HWJ A;  1UKG A;  4XUQ A;  5GLU A;  3VZM A;  2VUD A;  4R8H A;  2X53 S;  5IJR A;  1MS9 A;  2DVF A;  2D6P A;  1Y9M A;  2C9A A;  4Y26 A;  5SV8 A;  4XVH A;  2YU1 A;  3ZO0 B;  4BQ5 A;  5FMO L;  2RMU 2;  5C3R A;  3WP4 A;  4ZHN A;  2HWC 3;  1R08 3;  3ZXL A;  2VMH A;  4XAB A;  4OI0 A;  3I2D A;  1DQ0 A;  4Y5T A;  4YGE A;  2O1Q A;  2DTW A;  2MEV 1;  1UN1 A;  2HWD 3;  1ND3 A;  1LGB A;  3ZN6 A;  3E5X A;  5FZ1 A;  2AUY A;  4XUN A;  1VBB 3;  1QQP 2;  4IND A;  1JZ4 A;  5IVB A;  1FT9 A;  2P17 A;  4FO9 A;  4CCM A;  4CCJ A;  2JWP A;  1KDK A;  1WMX A;  3BCW A;  4KG0 A;  3JZV A;  4MGY E;  1FPN 3;  1MS4 A;  2RM2 3;  4QM9 A;  4YZ2 A;  1AR6 2;  1CD3 G;  5A80 A;  2VQU A;  3GCW A;  3OGS A;  2WAA A;  2YB7 A;  1WBL A;  5FRA A;  5BNO B;  1JU3 A;  2WYS A;  2YGL A;  4HKL A;  2VNO A;  4PLM A;  1YJL A;  3ZFE B;  5LWB A;  1XSQ A;  4LKE A;  5JOY A;  2BBA A;  2PLV 1;  3WCR A;  5CNA A;  2ZX4 A;  3ZSM A;  5FY1 A;  3P3N A;  5DAX A;  1W6P B;  3ZPY A;  5IFT A;  1DIW A;  1O3R A;  3VDB A;  1IPJ A;  4BQ4 A;  4FSJ A;  5ACA 3;  1EAH 3;  4ES8 A;  2OUH A;  4QB6 A;  3VZJ A;  2DVD A;  3NAP A;  3VHP A;  3WP3 A;  4IV1 B;  3SIT A;  1Q56 A;  5FJK A;  1TEI A;  3POI A;  4Q26 A;  5FAX A;  4CUG A;  4JKL A;  3OTF A;  5EWS A;  1AF9 A;  3OGR A;  4EN7 B;  3THP A;  2WJS A;  4XFI A;  1NY7 2;  4H7L A;  5IVY A;  4CCD A;  4CSW A;  5JWP A;  5IVV A;  4QKN A;  4HLT A;  1VMH A;  3KD4 A;  5GLT A;  4E2S A;  1WA4 A;  4URT A;  5HV0 A;  2XJQ A;  2DCZ A;  3I2G A;  3KQ4 B;  4RS5 A;  1G9C A;  1WGP A;  5LEK A;  1K42 A;  4C91 A;  4Q8L A;  1TZO A;  1WUV A;  2CDO A;  4L2N A;  2VNG A;  3ACG A;  4XOG A;  1VB2 A;  2NZ9 A;  3RJ2 X;  4I0B A;  4U36 A;  2AC1 A;  3T1M A;  4FBF A;  3I4I A;  4RR3 C;  4AQ6 A;  1VP6 A;  1QH7 A;  2K2S A;  3AP6 A;  3C8X A;  4UBG A;  3NST A;  2WQ8 A;  4XCB A;  5CG9 A;  3M3I A;  1Y43 B;  1PM7 A;  4FPE A;  4YW5 A;  4TTG A;  1R08 2;  1SFN A;  2LRO A;  3J9S A;  1LEN A;  4QXB A;  1AX2 A;  4CP0 A;  2O8Q A;  5I91 A;  1RUE 3;  4XQ4 A;  5D1I A;  1J59 A;  2ZML A;  1NA1 A;  3HIF A;  3JCI A;  4FPG A;  4X6R B;  3THD A;  4QPG C;  1YRZ A;  5A33 A;  4CEW C;  1I5P A;  3IZO A;  3OJB A;  4Y1Y A;  2F4L A;  4NN0 A;  2AYH A;  2A5Z A;  4QQL A;  1YWK A;  4J1X A;  4KGQ A;  4CDX C;  2QZ3 A;  2IZW A;  5L73 A;  1ASJ 3;  1Q8Q A;  1S0I A;  1E5R A;  2VTF A;  2MPF A;  5L36 A;  2ET7 A;  2OUJ A;  4LT5 A;  1WLC A;  4LIV A;  3AMH A;  4NIH A;  3LAG A;  2WN3 A;  3HNB M;  5LY2 A;  1WLT A;  2VG9 A;  4DFS A;  5A6Z A;  5LW9 A;  3MF9 A;  2JG9 A;  2PAM A;  1W9S A;  3OF1 A;  2NMO A;  5I8T A;  2ZGR A;  1DYP A;  2Q1F A;  4KU7 A;  1BK1 A;  1LR5 A;  5IAX A;  4CZS A;  2WNV C;  5IFP A;  3S57 A;  1JOJ A;  2ARX A;  1A8M A;  4XF0 A;  4XF1 A;  1HRI 3;  1RUD 2;  2A6Z A;  1SLI A;  4G4F A;  3LPG A;  4BPZ A;  5J7M A;  1AYM 1;  1GQP A;  1XYN A;  4Q1R A;  1ZRR A;  1NZI A;  1D2S A;  2VQ0 A;  5BNN C;  4MH0 E;  2HWB 1;  5IW0 A;  1PNG A;  2RE9 A;  3LOB A;  3WY6 A;  3AKP A;  4CEY A;  5FZD A;  2XH6 A;  3QD6 A;  2ZS6 B;  4AQS A;  1UD1 A;  5A33 B;  4D7T A;  1HXS 3;  3V0A A;  5KHI A;  1JYN A;  1VJ2 A;  2IXK A;  5T52 A;  1BXH A;  3RZG A;  3VBR C;  3U14 A;  1OMI A;  4IEW A;  3UGG A;  4N53 C;  5FY5 A;  4AOC A;  4NII A;  3FL7 A;  1QF3 A;  3Q8E A;  1W8W A;  2A6V A;  3WQ1 A;  2A1X A;  3ZIX A;  4QPI C;  1VLN A;  4JGY A;  3HPN A;  1FAY A;  2JX9 A;  3H3Z A;  3MV0 1;  5JPM B;  3I59 B;  2VW1 A;  5FY8 A;  1YCI A;  1PGW 2;  2ZMK A;  2JEN A;  1D4M 2;  4EN0 A;  4L11 A;  1W0O A;  1STM A;  1LGC A;  2JG8 B;  3P5B A;  3R05 A;  5ISL A;  1EUT A;  1S2E A;  4OLL A;  3WV6 A;  2BGO A;  4F3J A;  3WXP A;  5FY7 A;  4FFG A;  1MVQ A;  1JTZ X;  1LHO A;  1IS5 A;  5J36 A;  1PGL 2;  4HVO A;  2VW0 A;  1N1Y A;  3O12 A;  5F5C A;  1DZT A;  3WF2 A;  4MHU A;  2VR4 A;  1VBA 2;  3B9I A;  4L9B A;  2ARA A;  4KI5 M;  1GNZ A;  5FYM A;  4CUA A;  4A7K A;  4QPI A;  2CWM A;  2A3Y A;  2QBX A;  2P2K A;  4AHZ A;  1RXG A;  1NKG A;  3IMN A;  4QM8 A;  3W59 A;  1MEC 3;  3DPR B;  3AJZ A;  4JTO A;  3NNL A;  5CBL A;  3GZA A;  3ENR A;  4MOA A;  1A6C A;  1RXF A;  3N3H A;  3QOP A;  2Z79 A;  3A23 A;  3JBG 2;  2E32 A;  4AR2 A;  2FDH A;  3U11 A;  3AZW A;  4KWJ A;  1XXN A;  3LEI A;  2C6S A;  3BU7 A;  5FBJ A;  4DIN B;  5BYN A;  3SCF A;  5C8W A;  1DZR A;  3ME2 A;  3PJQ A;  4BCU A;  2C5D A;  4KG8 A;  1LOF C;  3RFR A;  2X5I B;  1W6N A;  1SZB A;  1XND A;  4LO4 B;  4YM3 A;  4XTM A;  5LBE A;  1D4M 3;  2ZGO A;  1JYV A;  1ZRD A;  2GH8 A;  4UFL A;  5F2W A;  3I54 A;  1M4W A;  2WZR 1;  2KXL A;  1FMD 2;  1CPN A;  2MHF A;  4RSU A;  1AR8 3;  3UJQ A;  1QOT A;  3GBF A;  4OQ8 A;  2WT0 A;  5FXW A;  2HEV F;  1OQ1 A;  2CY6 A;  3RZM A;  4MO3 M;  1BVP 1;  5T5L A;  4CVU A;  4QPG B;  2VZR A;  2HEY F;  2DVG A;  5ANQ A;  1IKQ A;  4QXH A;  5FPL A;  2XJV A;  4P00 B;  3OBR A;  1J1L A;  1SDW A;  1TME 3;  1Y7B A;  4HXC A;  4YVW B;  3UGF A;  4I2O A;  4QPG A;  2FDG A;  4BXS V;  1CJD A;  1W2U A;  1COV 1;  1VRH 3;  3KHB A;  4K21 A;  2QQK A;  4COV A;  2VUJ A;  4QMA A;  2VU9 A;  5C5T A;  1FOD 2;  1WLW A;  2P3I A;  2XVL A;  3GXU A;  3LIG A;  1I9R A;  4GB3 1;  1HQW A;  2XBO 1;  4LA2 A;  4FPL A;  3I97 A;  2UYA A;  4GJY A;  4OUL A;  5FZ3 A;  5H9Q A;  1AR9 3;  1G8W A;  4AL9 A;  1NYW A;  5A7W B;  4OUS A;  4Q4Y 2;  2Y6J A;  4YM1 A;  2Q8O A;  4NHY A;  5I0S A;  1HJF A;  1RVF 2;  5KC5 A;  3V0B A;  1KFU L;  1QY4 A;  1VBE 3;  4GQ7 A;  3DUI A;  3MPP G;  2ZPX A;  5IK8 A;  1F15 A;  2RG4 A;  2RVA A;  3GZE A;  3OGG A;  1ZRC A;  4XMA A;  1W6Q A;  4ASK A;  1T6B X;  2R32 A;  2VZS A;  5FIX A;  1UZY A;  2AR6 A;  3HT1 A;  3PUQ A;  5FOB B;  2ZXQ A;  1PIV 1;  3ZFE A;  4AF9 A;  1YYN A;  5FP4 A;  1BBT 2;  1BLZ A;  4Q2F A;  1DP0 A;  3D82 A;  5DQ0 A;  1LOC A;  2KA3 A;  2R1B A;  1MEC 2;  3GHM A;  4AEJ A;  4AFB A;  2W3J A;  3C7E A;  2EIB A;  3AKS A;  3VDD C;  1IKP A;  1XC6 A;  4RL7 A;  5FMO S;  3TYJ A;  5CFC C;  1H1I A;  1NX9 A;  1YEW A;  5FZ4 A;  2QZ2 A;  2Y64 A;  3E6D A;  4N53 B;  4MVT A;  2VMF A;  4CEY B;  5F1R A;  4RHV 1;  4LBO A;  1BEV 1;  4D6S A;  3AXE A;  1UW8 A;  4LUL A;  4Z82 A;  1Q5O A;  5DDJ 1;  2WRA A;  3SLI A;  5DAQ A;  3VN4 A;  1W6M B;  4Q4X 2;  4CDW C;  1TE1 B;  3H8R A;  3NAP B;  4COW A;  3K3O A;  2A3X A;  2D5H A;  5C6C A;  5FO9 B;  1ENR A;  4IV3 A;  2E7A A;  4YW7 A;  3TNQ A;  3BPS A;  5IT6 A;  3LEM A;  3PU8 A;  1UYP A;  3ASI A;  5HCA A;  5IVF A;  3H7Y A;  4DOU A;  4B7E A;  3MI8 A;  3J8F 2;  4PIZ A;  3ZXD A;  3KB5 A;  4FPK A;  3MFC A;  1VAL A;  1DGL A;  1SLC A;  4QXK A;  4IEZ A;  2J1E A;  2IXC A;  2DCJ A;  2WNO A;  4HVQ A;  1X8M A;  2WO2 A;  5FMD A;  3A7Q A;  3W9A A;  3D0S A;  4Y22 B;  1W2A X;  4DY5 A;  1SLT A;  5FQ0 B;  4UW6 A;  4TXW A;  3ZR5 A;  1MZF A;  5JXI A;  3H42 B;  1B35 B;  3H7J A;  1RIN A;  4PIY A;  4QXC A;  3WNN A;  1NAE A;  1W39 A;  2P3K A;  3PJY A;  2Q8E A;  3WP6 A;  2YRO A;  3ECQ A;  5F7U A;  4AHW A;  4YVS B;  4QKD A;  2YC4 A;  1OA2 A;  5FZG A;  2X05 A;  4E2Q A;  2PHU A;  2J1S A;  5EYX A;  3CDZ B;  4Q27 A;  4KQ7 A;  3MLL A;  4I30 A;  1UXX X;  3GZU C;  5FZ8 A;  1VAK A;  2ORX A;  4XXA A;  3JQW A;  1PO2 2;  5J48 A;  5LK7 B;  1SLL A;  4XJW A;  3UKV A;  3ZPO A;  5I0R A;  4NIA A;  3I8T A;  3VDC A;  2JDK A;  4MUV A;  1AL2 1;  2DF7 A;  2YC0 A;  2ZA9 A;  5A6Q A;  2WFF 3;  1VBD 3;  1OPM A;  1BCX A;  5F3G A;  5JI7 A;  1UIJ A;  3WVJ A;  2XJP A;  5JZG B;  1GZW B;  2HWB 2;  5FOJ B;  3AMQ A;  1EY2 A;  4DRR A;  5IAT A;  3E97 A;  3SIS A;  1SMV A;  3B02 A;  2VNR A;  4LE4 A;  3CJI B;  4LMF A;  3BAL A;  4QQP A;  3VD5 A;  1LNS A;  1UAI A;  2VBP A;  1PZ8 A;  1UZZ A;  2FDJ A;  1W6O A;  3VDA A;  4V1P A;  5FXV A;  4BB3 A;  1WWY A;  1IQD C;  1OKQ A;  3ZSJ A;  5C3O A;  1OLQ A;  2B45 X;  3MIG A;  2JB8 A;  1W06 A;  4BLI A;  1V70 A;  4UYB A;  4AVS A;  3EHK A;  4BQX A;  1HQL A;  3FC0 A;  4FFH A;  5FLJ A;  5J98 B;  3DXT A;  2LUW A;  5E8A A;  3ZKY A;  1CPM A;  2RS3 2;  1Z7S 3;  5FXZ A;  3PMS A;  1F5F A;  3E6B A;  1CZT A;  2R07 3;  1RJ8 A;  3RMY A;  4FXK B;  1H6X A;  4ISR A;  3T4V A;  4QHZ A;  2I2S A;  2GAL A;  2RS5 2;  1JI6 A;  3NRU A;  1WME A;  4AXO A;  1NT0 A;  2DYC A;  4GMP 3;  2FDK A;  2WNV A;  4AHX A;  1UKR A;  1DCS A;  2VBD A;  2Z4F A;  2TNF A;  2W46 A;  1PNF A;  4YGC A;  5D2A A;  5KHJ A;  2JG9 C;  4CXY A;  2ZZJ A;  1SEF A;  2BOJ A;  2IC1 A;  2RHP A;  4IGO A;  3RQ0 A;  3WQ7 A;  1MS5 A;  4CTE A;  1RL3 A;  1YQ2 A;  3CJI A;  5I0T A;  5C3P A;  2GMM A;  2C4X A;  5FR3 A;  3K4A A;  2QUO A;  3C3V A;  4NHM A;  2CAV A;  4Q4W 2;  4LQR A;  5BNN B;  1RHI 1;  1SCS A;  2DDU A;  4MXW B;  5DUX A;  4LHL A;  4FAH A;  4FPF A;  5AC9 3;  2VOW A;  1SDD B;  3DPR C;  5JLV A;  2ES3 A;  3HN3 A;  3KV9 A;  3SMH A;  1GV9 A;  4BWO A;  1W6Q B;  2ETE A;  4PF1 A;  3T2P A;  5CKN A;  1DQ2 A;  4QHB A;  5F6L B;  1VBC 2;  4CEW A;  1UYY A;  1OUX A;  5IVE A;  5FFO C;  3POS A;  2ORZ A;  4DB5 A;  5KXB A;  1ULO A;  2FCT A;  5A7W A;  2DVA A;  3IDE A;  4N7U A;  5LA9 A;  5FBZ A;  2BPA 2;  2HYX A;  3S5A A;  2NYY A;  1HXS 2;  3MO4 A;  4M0N A;  5F37 A;  1UWW A;  3III A;  4RGK A;  2XLF A;  2LAL A;  5HV4 A;  1H2M A;  4JGY C;  4Q1P A;  4ASM B;  1ZBE 3;  2G9F A;  5FO7 B;  2IXI A;  4NPL A;  4RFT 0;  2EXK A;  2ZEZ A;  4DNY A;  4UFI A;  2CU5 A;  4Q8K A;  2D93 A;  1XYO A;  1U5Z A;  5K4L A;  1BMV 1;  3DYO A;  1XRU A;  2VOT A;  3GDB A;  4Z1V A;  2AAC A;  1VBE 2;  1Z7S 2;  4UFJ A;  5FV3 A;  3IDA A;  2LRP A;  1RUF 1;  2UUR A;  3N7L A;  1Q8S A;  2HKX A;  2PHX A;  4IGP A;  4GJZ A;  3HT2 A;  5GZE A;  3ZYI B;  5C8C A;  1S55 A;  5G04 L;  5JSP A;  1FMD 1;  3M3Q A;  4EQV A;  2AEN A;  3OB8 A;  2Q1M A;  5BNN A;  3ZR6 A;  1V9U 2;  4MX3 A;  2FZ1 A;  4FI9 A;  2BV4 A;  2Z42 A;  4PBO A;  5CEH A;  3DEM A;  3VBS C;  3I3Q A;  3TWI A;  3A0N A;  4H2A A;  1NCR C;  1HB1 A;  1AR6 1;  2DVB A;  2VO5 A;  3D0J A;  5GLW A;  3ZOI A;  4HK8 A;  1NXM A;  1RMU 3;  2DBN A;  2JB4 A;  4DRV A;  4NID A;  2BU9 A;  1RUH 3;  4EYU A;  1GOG A;  3NJY A;  2DCK A;  4CCL A;  5C7G A;  4XC9 A;  5G05 L;  2BQP A;  4A4A A;  4JHZ A;  1E5I A;  2FCV A;  3I2K A;  3M3C A;  3PU3 A;  2IXJ A;  4ITC A;  4FOW A;  1YFY A;  4JX0 A;  1DQ4 A;  4CDW A;  5IK5 A;  3TN9 1;  1UOB A;  4Y24 A;  2XOM A;  3ZMO A;  1AX0 A;  4I01 A;  3LDK A;  4LOR A;  2Y8K A;  4AGV A;  5BY5 A;  2WQ4 A;  2XVG A;  1J3Q A;  4QKF A;  1ND2 A;  2AEY A;  1CAX B;  1HIX A;  1CES A;  2EF6 A;  3VZO A;  4B4P A;  1F9K A;  4Y33 A;  1HKD A;  1IQA A;  5JIU A;  4UI9 L;  4TYS A;  1LOF A;  2D6L X;  1CAX A;  1V6M A;  4AQ2 A;  1S1A A;  4MG2 A;  1H8T A;  4FPJ A;  4ATE A;  1XNK A;  4D7S A;  5C4W B;  3FLP A;  1KFX L;  2NPI A;  4D8M A;  4QX5 A;  5FYC A;  4PLO A;  2RDQ A;  5E16 A;  1GMM A;  2WO3 A;  5GAL A;  5KXD A;  1LRH A;  5BPX A;  4XDP A;  3HMY A;  4WZF A;  1GP4 A;  2P37 A;  3WX5 A;  4Q0Q A;  3KF5 A;  3KV5 A;  2DV9 A;  3MHZ A;  4ZS3 A;  5EJZ B;  4YW3 A;  2Y34 A;  3RVH A;  1POV 3;  2JE7 A;  3B69 A;  1JU4 A;  1GFF 2;  4LR4 A;  2YUE A;  4P9J A;  1XQN A;  5JR7 B;  4CU6 A;  2OZ6 A;  1HN1 A;  5KBF A;  4CDQ A;  4D94 A;  1N1S A;  3RYK A;  1DQ6 A;  5HI0 A;  3WQ0 A;  4I3P A;  3MIB A;  2B7Y A;  1C8M 3;  1OVS A;  1H8V A;  1PM4 A;  2RR1 3;  2VW2 A;  3PUI A;  2PTM A;  4GWJ A;  4RQP B;  1NLS A;  2XG3 A;  2GU9 A;  1K45 A;  5FXX A;  3T09 A;  1UX7 A;  1O3T A;  1RUD 1;  2IXL A;  2ZGP A;  2VVD A;  1CAW A;  1JHJ A;  3PVE A;  1SBD A;  3OOX A;  3M4F A;  2ZHM A;  1W0N A;  3WDU A;  1HV0 A;  3MF6 A;  2ARE A;  4H55 A;  5CKQ A;  1Q3E A;  3V56 A;  2J1T A;  1GWK A;  2D7F A;  4MGI E;  1I3H A;  1O8P A;  1MZ6 A;  1QXJ A;  1H6Y A;  2I74 A;  3WG3 A;  4AVB A;  5ACA 1;  1YHF A;  3I2H A;  5T3N A;  4Z07 A;  5TSW A;  1AJK A;  1EV1 1;  2YGM A;  3ILR A;  5FKB A;  4NWV A;  3HR9 A;  2GC1 A;  2Q8C A;  1UMZ A;  3RRD A;  1H1M A;  2W68 A;  3HBZ A;  4EWD A;  4A3Z A;  4GIQ A;  4AGG A;  3DXU A;  4HON A;  5DG1 A;  2YMZ A;  2VTX A;  5C33 A;  4D7Y A;  1V6I A;  1WCQ A;  2KD7 A;  3ZFF A;  3MEP A;  2WFP A;  4ZZ5 A;  1VBB 2;  2LTN A;  4IE4 A;  4OHW A;  1B35 A;  3DKW A;  3FFZ A;  2XL7 A;  3D6E A;  4WM7 C;  4COY A;  1ND3 C;  3O7O A;  4CEY C;  1XNB A;  3ATG A;  1SHW B;  2J7M A;  3USU B;  4HET A;  2WO7 A;  4Q4Y 1;  1DQ5 A;  1UNB A;  5BNO A;  1DQ1 A;  1MVE A;  2Y6K A;  1ZM1 A;  1BHG A;  1KJR A;  2ZGT A;  2VZO A;  4NPM A;  1OH4 A;  3RPQ A;  1BK0 A;  2IXH A;  2WNU A;  4JRA A;  3WNO A;  4AYU A;  1G9B A;  2JG8 A;  5DXD A;  2SBA A;  1DLC A;  3ZYJ B;  2Q8D A;  2R06 3;  2X5I C;  3MBW A;  5JPN B;  4DZG A;  1UY0 A;  4HKW A;  3ES1 A;  5FYY A;  4M4P A;  3ILF A;  2JKX A;  3FLT A;  4G9S B;  2D5F A;  4HT1 T;  4XBQ A;  3MIE A;  1BQP A;  2FBE A;  4H3W A;  1RGS A;  3AP4 A;  3WUD A;  5L9V A;  4PF5 A;  5L9R A;  4KMQ A;  2GZW A;  1QJY 1;  2RJL A;  2BW8 A;  4IER A;  2XUM A;  1SLB A;  5DZE A;  4LO8 A;  3WZ1 A;  1UOJ A;  2D3R A;  1RC6 A;  5FLH A;  5J3U A;  5GKA C;  3MLJ A;  4YSF A;  5K0U A;  4N8M A;  5C8C B;  1AXK A;  1BEV 2;  2PQQ A;  3M3E A;  2WZ8 A;  2DUR A;  2PHT A;  3K4Z A;  5A32 B;  4BK4 A;  1AR7 1;  2HWF 2;  4I0A A;  1OUR A;  1UXZ A;  1OQD A;  3CMG A;  3ST7 A;  3O1S A;  5CAZ A;  1VE0 A;  3H1Y A;  3K51 A;  4JKK A;  4NRO A;  5CU1 A;  5JOZ A;  2EAL A;  3LEG A;  4FPH A;  4NUB A;  4QWN A;  4IV1 C;  4RS5 B;  4BME A;  5FZM A;  3GJB A;  4YWA A;  4KWK A;  1IS6 A;  1ZZ6 A;  2HWC 1;  4PDW C;  4X8P A;  4JV4 A;  2VMC A;  5AFE A;  5CB7 A;  4GH4 B;  4Y4Y A;  3I3M A;  1H8T C;  5EIY B;  3T08 A;  2CGP A;  2YBS A;  5FP7 A;  5BNP B;  2V5Y A;  4O9G A;  4BQ1 A;  1NLQ A;  2HWB 3;  2YV8 A;  3ZXJ A;  4Q0P A;  2W47 A;  2BGP A;  1GZ9 A;  1V00 A;  2VZT A;  3P3P A;  4LA3 A;  1YLL A;  1NA1 B;  4CU7 A;  2P6H A;  1E57 A;  1VBD 2;  2QFE A;  4YGD A;  2AZ5 A;  2QDR A;  4E4D X;  1SFP A;  2P5B A;  3GJA A;  1X50 A;  3FBM A;  1XNC A;  4FOY A;  3IPV A;  3TB0 A;  5FPB A;  4AI2 A;  1C5H A;  3KQR A;  4R9A A;  4OUE A;  5GJ6 A;  4I3G A;  4LBJ A;  4DQA A;  2GAU A;  3SEE A;  1V9U 3;  4JHT A;  2VJX A;  5EJ1 B;  4AVC A;  1LU1 A;  4NHK A;  2XXZ A;  4XUP A;  1AYM 2;  4QDS A;  3ITQ A;  4BQW A;  2WDB A;  4E9K A;  3RNS A;  5KXE A;  4PI2 A;  2YZ4 A;  4Q4V 1;  3DCQ A;  2H0B A;  2UWA A;  4XW3 A;  5DZG A;  5EV7 A;  3GBW A;  2R6Q A;  3OUI A;  5FUI A;  5FYI A;  1RUI 1;  1QNY A;  5LRS A;  1JZ8 A;  2JDN A;  5I8Y A;  3C2U A;  2BWC A;  3B00 A;  2VCB A;  1E5S A;  3KCY A;  4OI2 A;  4WBB A;  3C7G A;  2QQL A;  3VHO A;  4C0B A;  1OFS A;  2W2I A;  2D6O X;  1XE8 A;  1X82 A;  1ZBA 2;  2AH2 A;  3QH6 A;  1IZ3 A;  2A71 A;  4GKY A;  4BH9 A;  4A41 A;  1FV3 A;  5JSR A;  4LBQ A;  4HOO A;  3SCH A;  3H50 A;  4YAR A;  3BPZ A;  4UOJ A;  4ZU7 A;  5CIR A;  2CAU A;  4IE6 A;  3UES A;  4B7K A;  3SKV A;  5HPO A;  3FHQ A;  3H1W A;  4IV1 A;  4RGA A;  1PO1 1;  4ZU5 A;  3WW1 A;  4BXF A;  4GWN A;  1GR3 A;  1DGR A;  3FBY A;  4YVW A;  3W58 A;  1ZRE A;  1LEM A;  1W99 A;  3K2O A;  4RFR B;  2D3S A;  2NLR A;  4Q4X 1;  1Z0H A;  1NCQ A;  3AMN A;  3M8L A;  1US2 A;  3QCW A;  2Y6L A;  1S0E A;  3NKT A;  2ZEY A;  2R1D A;  1LCL A;  5CVR A;  3NQH A;  1AYN 3;  2ZJC A;  5A7S A;  4YM2 A;  4QX1 A;  3G6J B;  3PNA A;  4J25 A;  1D4V B;  1OXC A;  2OS2 A;  2ZGN A;  3OBZ A;  4M3C B;  3OEA A;  4MGT A;  2HBT A;  3TNP B;  3RGB A;  1YFW A;  3UT0 A;  5GZD A;  2VL4 A;  4GMP 1;  2K9Z A;  3VL8 A;  3JU9 A;  2RJ2 A;  1OH3 A;  4CE8 A;  1J1T A;  1GAN A;  1LED A;  2V4V A;  2C24 A;  3PDQ A;  1QDC A;  4LKD A;  1YQ6 A;  1S4C A;  4O9E A;  1U0A A;  2UU8 A;  4IGQ A;  5F8P A;  1RHI 2;  4JCK A;  1I1E A;  2OKX A;  4P9X A;  2O8O A;  4W6Y A;  4XZP A;  5BNO C;  1JHN A;  1VMF A;  3CQO A;  4QX7 A;  4DEQ A;  1IG3 A;  1L7Q A;  3ZYP A;  2B46 X;  2CGN A;  4HSL A;  2WT2 A;  5F3C A;  3ON7 A;  1KJL A;  1O4Z A;  1GKB A;  4JDO A;  4HAN A;  5GZF A;  3WD5 A;  4KU8 A;  5ANN A;  3ZSK A;  3AVR A;  4MV2 A;  2BWA A;  1R1A 2;  2ENR A;  1NCR B;  3CU7 A;  1X33 A;  3IWZ A;  3WDT A;  2JDH A;  4GB3 3;  4GZ9 A;  1PO2 1;  2E33 A;  2WKK A;  1WD3 A;  3H1M A;  1EYB A;  2PEL A;  4CP9 A;  1EP0 A;  2JIJ A;  5FYT A;  3IDB B;  3E6C C;  4GWI A;  1N1T A;  1J84 A;  3MIF A;  5BV6 A;  1NOV A;  1OPO A;  3AM2 A;  4WM8 A;  3VD7 A;  4Y5S A;  4M3C A;  2Y0O A;  3VV1 A;  1LU2 A;  1RUE 1;  1W9Y A;  1QXP A;  2WZE A;  4YRD A;  3T1L A;  1AZD A;  1W0P A;  2YBP A;  4RQP A;  5DPN A;  2VTX J;  4GAZ A;  5LA0 A;  4BA6 A;  5LY1 A;  3R4U A;  3S6P A;  1LUL A;  4XET A;  2WAO A;  1RUH 2;  4FOV A;  5T54 A;  2B39 A;  3N9N A;  1A34 A;  2WWS A;  3DYM A;  2BVB A;  4IW3 A;  3PUR A;  2VNV A;  3A21 A;  3ABZ A;  4QGM A;  4GB3 2;  1ZZ7 A;  2XBO 2;  3LQC A;  3RJR A;  3OCP A;  1QH6 A;  1H9W A;  1VMJ A;  1UO9 A;  4DUX A;  1EAH 2;  2XWB B;  1N3O A;  1W2T A;  2VM9 A;  3IN9 A;  1RVF 1;  3VHN A;  2VVF A;  1PGL 1;  1W8F A;  2Q5T A;  4ES9 A;  4IEV A;  4WVZ A;  1U5I A;  4XMI A;  1WW6 A;  1CQ9 A;  4ASL A;  1PZ7 A;  4PBP A;  1P8J A;  3WP5 A;  4E4S A;  1JBC A;  1G7Y A;  4GUL A;  4HPK A;  4N7I A;  4YVW C;  3LA7 A;  4QPI B;  5FPA A;  3ZYF A;  3O1R A;  2RS1 2;  2WS9 1;  3DEC A;  4LXL A;  1LOB A;  3CIH A;  2J1V A;  3BU0 A;  4FPY A;  4AZZ A;  1MEC 1;  3U10 A;  1L7R A;  2Q0A A;  4OZX A;  3AKT A;  5B2G B;  2VMG A;  1Z78 A;  1JZ2 A;  3H9A A;  4ISQ A;  4DIQ A;  1HB3 A;  3VBR A;  3MYX A;  5DMY A;  2PHL A;  1N47 A;  2JEM A;  1JOB A;  3JBG 1;  1O6U A;  1UOG A;  4AI0 A;  1PGS A;  3WG2 A;  4IEP A;  2ZTN A;  4IE5 A;  1HB2 A;  2A6W A;  3W5N A;  5IWF A;  2YHJ A;  3DF0 A;  3DV8 A;  4K7J A;  3ZM8 A;  1JZ6 A;  4IV3 C;  1MS0 A;  1JYC A;  5FK8 A;  4GWM A;  2YBK A;  2W1W A;  4QKB A;  5F3I A;  1VBA 3;  5AVP A;  3H8O A;  1A78 A;  2BOI A;  1OLM E;  2PYT A;  5FZH A;  2XKO A;  3CZU A;  5FPX A;  2R30 A;  1BZW A;  1QKQ A;  1VR3 A;  4L99 A;  4PIX A;  1T2X A;  1ENX A;  1PVC 2;  1TNF A;  2DCY A;  3N4M A;  2BDR A;  1RUJ 3;  5I0U A;  4E8C A;  3KF3 A;  1CIW A;  3OD0 A;  2W0X A;  3AYA A;  2X09 A;  4FXG B;  3VDD A;  3IMM A;  5EZW A;  1GUI A;  3URF A;  1PX3 A;  2E31 A;  4XFC A;  3ZFF B;  5F9T A;  1UPI A;  2JEC A;  2ZHL A;  2DWR A;  1AL2 2;  1MS8 A;  5F2S A;  3WDY A;  1N3Q A;  2YU2 A;  5CFC B;  3GM8 A;  4CP9 B;  1JZ7 A;  2OPW A;  4QDR A;  2VCA A;  2HWE 1;  5A7Q A;  4LK6 A;  1ND3 B;  1PMI A;  4Q4W 1;  1WCK A;  3NO8 A;  3UL2 A;  2W08 A;  1DGW X;  4Y1Z A;  1J3R A;  2H6C A;  1UQX A;  1NE6 A;  1K5M C;  4NO4 A;  4CP1 A;  1HQN A;  3GHN A;  2DTY A;  3RDI A;  3PIJ A;  1UX6 A;  1FOD 1;  4I02 A;  1K3I A;  1NA1 C;  2BNM A;  3UYJ A;  1TG7 A;  2R06 2;  1K5J A;  1EV1 2;  4QU2 A;  3RWK X;  2J1R A;  3A4U A;  3RMX A;  2YC2 A;  3UK9 A;  2DU1 A;  3BYW A;  2R16 A;  4Y4R A;  2Y38 A;  2DUO A;  3A0K A;  5F39 A;  3AC0 A;  4PQ9 A;  5F3E A;  3NV4 A;  1Q8O A;  4LO7 A;  4MXW A;  4RR3 A;  5DAB A;  4R4X A;  4CXX A;  3AYD A;  4BQ2 A;  4XUR A;  2WYF A;  1UY3 A;  2NP0 A;  1SPP B;  4HVR A;  1AVB A;  2ZKN A;  3FFQ A;  1M06 G;  5FWE A;  5DAW A;  4D3W A;  2QE3 A;  3E1F 1;  4KWU A;  5AFB A;  5FZO B;  1LEC A;  1F2N A;  2GC0 A;  3BOW A;  3WNK A;  2WWJ A;  5C3S A;  4Z8B A;  5ERL A;  2WSU A;  3ETP A;  1H2N A;  3V0A B;  3RZK A;  5K0U C;  3V65 A;  1QQP 3;  2W52 A;  1ZZB A;  4RQP C;  1REE A;  2PHR A;  1PZ9 A;  3M70 A;  5CFD C;  2XGX A;  2VOK A;  1SBF A;  2BUK A;  3FUQ A;  3MIC A;  1ASJ 1;  2ZAA A;  2QQV A;  3VKN A;  5FO8 B;  1X8E A;  1ZRF A;  4A3X A;  3BOD A;  1XE7 A;  4XF9 A;  5EYY A;  3KV4 A;  1C4R A;  4BQ3 A;  4SLI A;  2FD8 A;  2FCU A;  2BGC A;  3QH7 A;  4IET A;  1GZW A;  3N7J A;  1DYK A;  2E63 A;  3WEZ A;  1RUG 3;  2BZD A;  2NMN A;  1Q43 A;  2HWD 1;  2RDS A;  1W2O A;  2RS3 1;  2WNU B;  4OQ9 A;  3WQB A;  1RHI 3;  4WM8 B;  2R49 A;  5BNP C;  3QBQ A;  4L92 A;  1EPZ A;  3IDC B;  4IE0 A;  2E6V A;  5A3U A;  3QAC A;  1COV 3;  3VKM A;  5JUV A;  4JGZ A;  3S5Q A;  1LGN A;  4LTA A;  1HX6 A;  1PK6 A;  4UT5 A;  5FYH A;  2IUW A;  3H0O A;  2W92 A;  4O65 A;  2XJS A;  4XPV A;  2WL1 A;  3SNM A;  4AAP A;  4F7Z A;  4FTE A;  5B4N A;  2WZR 2;  4A7Y A;  4ET7 A;  2H0V A;  2V72 A;  3KMH A;  3H3L A;  3SHR A;  4W8J A;  2YYO A;  1UZW A;  3VD9 A;  2EAK A;  2B8M A;  4PT6 A;  1ZBE 1;  2EID A;  4SBV A;  1VBE 1;  4XJZ A;  5FYZ A;  3J8F 3;  2Y60 A;  3LFM A;  4YW4 A;  4XF4 A;  4AED B;  2AGS A;  1LOE A;  4S2F A;  1RYY A;  1XSR A;  4MET A;  2PHF A;  4BIO A;  2GC3 A;  4P9Y A;  1MAC A;  3RYP A;  2RDR A;  3LFI A;  1KGY A;  1VBC 1;  4EV0 A;  2JIG A;  3O5S A;  2F17 A;  5ACA 2;  4HPK B;  2ZOE B;  2ZCW A;  3JD7 1;  2OQ6 A;  1MQT C;  2ILM A;  2WS9 3;  4H7M A;  2O14 A;  3H8U A;  1US3 A;  2CSG A;  4WVM B;  2ID4 A;  5CKM A;  3VBO C;  4AFC A;  5FQ0 A;  4FTS A;  1J83 A;  3IT8 A;  1ONA A;  2WII B;  1W9F A;  3UKT A;  1OKO A;  1D2Q A;  4M00 A;  3CNA A;  1C3H A;  2OX0 A;  4F83 A;  5JVV A;  4KBB A;  3BN6 A;  4L97 A;  1IGO A;  3KVA A;  2ZMN A;  4LUK A;  4JVA A;  4M4R A;  1G86 A;  1V6O A;  3TN9 2;  4O61 A;  1ZZC A;  4ZU4 A;  2W1S A;  3I3B A;  1PIV 2;  1XJA A;  1IOA A;  4YZ3 A;  2OPK A;  2IVJ A;  4CDU A;  1WCD J;  1R1Z A;  2E7Q A;  3WT3 A;  5JMC A;  2ZGK A;  1VAV A;  1WKY A;  2A7A A;  5JXH A;  2MEV 3;  3T4H B;  1SCR A;  3DGT A;  5I8S A;  2BTV C;  3EJK A;  2ZEX A;  4B8E A;  4FPC A;  1K5M A;  5HBA A;  2FMD A;  3I59 A;  4CUB A;  3C7F A;  4LK7 A;  3LB9 A;  3JB4 C;  4XF3 A;  4UW5 A;  4R4Z A;  2P34 A;  1C5I A;  4YVS A;  4IUG A;  4XQW A;  3SH3 A;  3U37 A;  3N7K A;  4LHK A;  1RUE 2;  4TWT A;  4NAM A;  3UET A;  3AFG A;  1HRI 2;  1L7L A;  2QQO A;  3OPW A;  2BJS A;  3J26 N;  5A3M A;  1OLR A;  1RUG 2;  3V64 A;  5H9R A;  3N9P A;  1QJX 1;  2GP5 A;  1KEX A;  3KSC A;  3VGI A;  3WDV A;  3BTY A;  2N7G A;  2XJR A;  4RYD A;  1SG3 A;  1UMI A;  1X36 A;  3MW2 A;  5DG2 A;  1W6O B;  4OHY A;  4AVT A;  5B4X A;  4B3N A;  3BIE A;  3IM0 A;  2HYK A;  3KS7 A;  3LA3 A;  1XPW A;  4W6X A;  3CBN A;  2W39 A;  4BOW A;  4IL7 A;  3O1V A;  5A7N A;  2YFZ A;  1QOS A;  1NQD A;  3OG2 A;  3ZKU A;  5IVJ A;  1FNZ A;  2V5D A;  4YLZ A;  3ZDV A;  5FZK A;  1QNW A;  5JOX A;  3EQE A;  2OZJ A;  3B94 A;  1NXD 1;  3WHU A;  3WHT A;  1C8M 1;  2RR1 1;  3ZYR A;  1O3Q A;  2RS5 3;  4ZON A;  5IAV A;  1LHN A;  5FZE A;  2G1M A;  5E1R A;  1POV 0;  3T0D A;  2D3P A;  1I6X A;  1NCR A;  1VRB A;  2EIE A;  3PTR B;  4N43 C;  3RZL A;  1W2N A;  5ABJ B;  2RS1 1;  2WS9 2;  2Z5W A;  4QPW A;  5EQU A;  4HMZ A;  3TEW A;  3H8X A;  1F5J A;  4LHN A;  5F6K A;  1QDO A;  3WG4 A;  3WNP A;  5KHG A;  2VZ1 A;  4YVS C;  1OOP B;  1K12 A;  5BNQ A;  4BU2 A;  2XR4 A;  2VZP A;  3GNE A;  1ZA4 A;  5IVC A;  2VCC A;  5C71 A;  4K6B A;  1RB8 G;  3LKJ A;  3ZIW A;  3MFA A;  1OLM A;  2JDY A;  3OY8 B;  2D97 A;  2YG0 A;  5FYS A;  3FMG A;  3T0A A;  4X6Q B;  5AVA A;  1ZBA 3;  3UV9 A;  4QB1 A;  2PAK A;  4XE9 A;  1LB2 A;  1Z7S 1;  2SLI A;  4W6W A;  2WO1 A;  3ZDS A;  1ZNP A;  4DXT A;  2WC2 A;  5FMC A;  4BHP A;  4N9H A;  4S2D A;  5IHR A;  2R07 1;  1QIQ A;  5KWR A;  2VUC A;  2VQA A;  3E5U A;  1F4A A;  1POQ A;  3VBH A;  2CNA A;  5E88 A;  5FPV A;  4FQZ A;  3FWE A;  1O4T A;  4OMD A;  1S0C A;  3HOB A;  1S0B A;  2XWJ B;  1B09 A;  2OYZ A;  3K3N A;  1OT5 A;  2GME A;  4P9W A;  1IPK A;  2ZGL A;  1VBD 1;  1CGP A;  4P9L A;  2WR9 A;  1QEX A;  4JAA A;  5GM0 A;  5J09 A;  3VBF A;  2RJK A;  1C57 A;  2XLG A;  1DFQ A;  3U4X A;  5CZK A;  1CX4 A;  3CO2 A;  4LIT A;  5T5J A;  5J1X A;  3MW3 A;  5AC9 1;  2QDN A;  4IEY A;  1VBB 1;  3ACF A;  4UF0 B;  3ZN5 A;  2D40 A;  2ZBJ A;  3MGU A;  4WZC A;  5FJH A;  4D6Q A;  3GAL A;  1UPS A;  4MGZ E;  4NE9 A;  1QHD A;  2VBB A;  5FYB A;  2OA2 A;  3PUH A;  1E5H A;  2PAE A;  4B4R A;  2FZ2 A;  2VZ3 A;  1AR7 2;  2DBI A;  2VUA A;  3IPV B;  1GSL A;  2RMU 3;  1JYI A;  4Y3O A;  3CL1 A;  2JKB A;  2QQI A;  2HH9 A;  2A3W A;  3TRS B;  1RUI 2;  1D0G A;  2A73 B;  3M3O A;  5T55 A;  1UU6 A;  1YI9 A;  3DYP A;  1PK6 C;  3N9Q A;  4FP2 A;  5DAP A;  5EJ3 A;  4CXW A;  4IE7 A;  2XJU A;  3AZX A;  3HNM A;  5FZC A;  4JGZ C;  1V6K A;  1RVF 3;  2QQW A;  3VBF C;  3IAQ A;  4EN6 B;  2HWC 2;  4LEJ A;  4YGB A;  5FRE A;  2VVE A;  1MS3 A;  1UZ0 A;  3K48 A;  1N1V A;  4GD4 A;  4MXV A;  3PME A;  2GC2 A;  2QKD A;  3ALQ A;  3N9L A;  5D8A A;  2WZR 3;  3ILN A;  1R09 2;  2JE8 A;  1QJY 2;  3LE0 A;  3AZY A;  1R1A 3;  1GNH A;  4JRL A;  3WG1 A;  5A1F A;  4IEO A;  4E27 A;  1WW4 A;  1V6N A;  3NV3 A;  4DXS A;  3DKQ A;  3PVB B;  4XHB A;  5D21 A;  1MR5 A;  3AB0 A;  2ZGU A;  4NWW A;  2OXB A;  2VQT A;  3VKL A;  4PLN A;  4KNC A;  4OI4 A;  4Q29 A;  1W90 A;  2W1Q A;  3RS6 A;  4Y1U A;  2P6C A;  4YPJ A;  3HQU A;  3VLB B;  3BTA A;  1AR6 3;  1PHM A;  1AX1 A;  3ZN4 A;  3TAY A;  4CDQ C;  3O1M A;  4XEZ A;  3KWV A;  2Q30 A;  2PFW A;  1ACC A;  3NV2 A;  5FY0 A;  2GNM A;  3OPT A;  4XHX A;  4ZXE A;  3WNL A;  2Z2S B;  1YJK A;  2WFF 1;  5FLI A;  2UYB A;  3OPZ A;  4HN0 A;  2ZX3 A;  1JOD A;  4TN7 A;  4P14 A;  5FCC A;  4K8R B;  4MYE A;  4P5Y A;  4Q0U A;  3MID A;  3PL0 A;  5CYY A;  4TSV A;  3WSO A;  3HQX A;  1FX5 A;  3QLQ A;  1BJQ A;  2IVI B;  4MSV A;  4MZU A;  1YIF A;  4M3C F;  2GSY A;  2GP3 A;  2WAB A;  4LUM A;  3RSJ A;  1QJU 2;  2ADE A;  2V09 A;  4G3Y C;  4EWA A;  1W8U A;  2ZZQ A;  1RUI 3;  5LK5 A;  1EV1 3;  4LNV A;  4B1L A;  2QJV A;  4CEW B;  1XNA A;  4M0H A;  3WW3 A;  4XFB A;  3VBU B;  5ABJ C;  5K8S A;  3VB9 A;  1OOP A;  1OBN A;  2VD7 A;  4XAE A;  4NPR A;  1ULC A;  2EXH A;  5L9B A;  3LF7 A;  1F4H A;  2MEV 2;  5CFD B;  1OF4 A;  3LPF A;  1ODM A;  1TVG A;  1UMH A;  3POY A;  5FYU A;  1MQT B;  4R9C A;  1HN0 A;  3WR0 A;  3KT1 A;  2XVK A;  2VE1 A;  4LHS A;  1O5L A;  5J96 B;  1FV2 A;  2OVU A;  4AED A;  4WVV A;  4GAL A;  4N90 A;  4HFS A;  4AVV A;  1POV 1;  4CPB A;  3GZT B;  3N7M A;  5FZI A;  4GH4 C;  3ZYB A;  1EAH 1;  4NAO A;  1APN A;  4AI3 A;  1RIT A;  4MLO A;  4XFH A;  1FI2 A;  1PO1 3;  1VAM A;  2LS6 A;  2WNV B;  5DDJ 3;  4D0Q A;  3KT7 A;  4QPY A;  3WDX A;  2G9Z A;  3MV1 1;  4LBL A;  2XPJ A;  1FNY A;  3SKJ E;  2BFU L;  3K75 B;  3VBS A;  5DUV A;  1W28 A;  4FTB A;  2MNG A;  5JR2 A;  1R09 3;  4UFK A;  1Y9G A;  1ENS A;  3MW4 A;  4CRQ A;  5A3W A;  3HQR A;  3W21 A;  1JZ3 A;  3BOP A;  4FCA A;  3SXW A;  1UZV A;  4LLF A;  3AK0 A;  4XCA A;  3S0M A;  1IG0 A;  3N35 A;  4BLJ A;  3HBK A;  3PVN A;  2WQZ C;  1LKN A;  4YW2 A;  4Z2A A;  2H6B A;  5LAS A;  4J6G A;  4XJA A;  1IPS A;  3NVC A;  2P4E A;  4TLG A;  1NZC A;  1PO1 2;  4WM7 B;  1ULD A;  2QCS B;  3NW4 A;  4XIO A;  3KHC A;  1DGR N;  1ODN A;  2EA7 A;  2O0O A;  4AEK A;  2R04 2;  2YPD A;  4IQP A;  4DPN A;  3BTX A;  3SEP A;  5LCW L;  4JC1 A;  4PDW A;  3VZK A;  3J4U H;  2HWF 1;  3ZXK A;  2RV9 A;  3U0Z A;  3TEY A;  2XDV A;  5FMB A;  1K5M B;  3AL6 A;  4LBN A;  2HWD 2;  1ULE A;  2D6K A;  3P1I A;  3UJO A;  3HNY M;  3CHX A;  1BBT 3;  4UAP A;  1PVX A;  1WZX A;  3W20 A;  3L2H A;  1GP5 A;  5KHH A;  3VKF C;  2KM2 A;  1W8T A;  2RS3 3;  2J42 A;  3NNJ A;  4LBK A;  2ADD A;  1HJG A;  1OHF A;  3NL1 A;  1MQT A;  3GBG A;  2IWG B;  2YDE A;  5FDB A;  3KLS A;  3U1X A;  5LBF A;  1UU4 A;  3R4S A;  1W6P A;  4XFF A;  1PK6 B;  4OYU A;  3RWN A;  3BVC A;  3MIH A;  5KR7 A;  2FQP A;  4UBH A;  1KS4 A;  4JGZ B;  3ZXF A;  4HG6 B;  1JUI A;  2B9V A;  3EXU A;  3LDB A;  1G9F A;  4IEX A;  3VBF B;  3VKO A;  3WIN E;  1HLC A;  3GGL A;  3LEK A;  1YO8 A;  4BJ0 A;  1OD3 A;  2AEZ A;  4OVE A;  4Z2W A;  4PCR A;  3HVD A;  4AI8 A;  4BYY A;  3E5Q A;  4IES A;  3FHI B;  5K0U B;  5D8A C;  4GH4 A;  3NNG A;  1W03 A;  4XUO A;  3LA2 A;  3B7M A;  1O4Y A;  1RUH 1;  5KC6 A;  4OHZ A;  1DGW A;  4FFI A;  4AI9 A;  2YFU A;  3P6B A;  3EYP A;  4XJ9 A;  3AVS A;  1CAU B;  1GNY A;  1QU0 A;  5SV5 A;  4OHV A;  4ZXK A;  3CLP A;  4FOQ A;  4PDW B;  2Y33 A;  4KH9 A;  4Q4V 2;  1OF3 A;  1H9P A;  2CDP A;  2VC9 A;  1JS9 A;  2ZAH A;  4OFG A;  1HW5 A;  1PMH X;  3OD4 A;  1WLD A;  4XIL A;  2C0Z A;  4OCT A;  1KQR A;  3WNX A;  1RUC 3;  2PQS A;  1HRV 1;  4L8Q A;  2WT1 A;  3LGR A;  3S7E A;  3VD3 A;  3WW4 A;  3WF1 A;  4RA0 A;  3AL5 A;  2VY0 A;  1TMF 1;  5C70 A;  4XQD A;  4CU9 A;  5FP3 A;  4RR3 B;  5DZF A;  1U12 A;  1UIK A;  1NG0 A;  1OUS A;  2JDP A;  4XFG A;  1W05 A;  2QVS B;  4BM8 A;  4C90 A;  3JQX A;  1QJF A;  1PX4 A;  4U2A A;  3M2M A;  2TBV A;  4K20 A;  5FZA A;  3CKH A;  4QX0 A;  3D5O A;  4DUW A;  4BDV B;  4BQY A;  4C1X A;  3GYD A;  5APA A;  4KBZ A;  3ZX7 A;  4HN1 A;  4COZ A;  1HRI 1;  3AP5 A;  1W9W A;  4A42 A;  2CTV A;  2ZHN A;  4MAD A;  3LDR A;  1QWR A;  4Q4X 3;  3ZMN A;  2W5F A;  4PJY A;  2F4P A;  1QMJ A;  3RZJ A;  3POE A;  3IIA A;  5BUV A;  5EFU A;  1H1A A;  2JIC A;  1W6M A;  1OC1 A;  3J7L A;  4HL0 A;  5T5P A;  2D6M A;  3OBA A;  1YUD A;  5FKC A;  4LJH A;  1QJX 3;  5DAV A;  1H4G A;  4COU A;  4NHL A;  4XIK A;  2JDM A;  1GQG A;  4A6S A;  1JN2 P;  3V0B B;  5EPA A;  2FDF A;  1UY2 A;  1H8T B;  2JD4 A;  3AKQ A;  3HEI A;  4Q4V 3;  4YG0 A;  3K46 A;  1HB4 A;  1HV1 A;  2K46 A;  5A3O A;  2ZGS A;  1JW6 A;  1UU5 A;  4QHO A;  1ND2 B;  4CPB D;  1CWP A;  2Q4S A;  2HWE 2;  5J37 A;  4CU8 A;  2E7T A;  4LLO A;  3K4D A;  2E51 A;  4NOT A;  4JDN A;  4AK3 A;  5A70 A;  2L9L A;  1KRI A;  1W8N A;  4QQH A;  2ZX1 A;  4CCC A;  2V4A A;  1VPH A;  3EB7 A;  5A32 A;  3R6S A;  4N43 A;  1R09 1;  1PMJ X;  1ZZ9 A;  1WMF A;  5JOW A;  4DUV A;  4ERO A;  4JTN A;  2RS1 3;  2PHW A;  1IHM A;  3ACI A;  4FPO B;  3VBR B;  4RHV 3;  1H0B A;  1MZ5 A;  4KWL A;  4YW6 A;  2PN5 A;  2BFU S;  1JYT A;  3CZJ A;  1FOD 3;  3D3A A;  5GLV A;  4E2G A;  4Q4Y 3;  2EXI A;  3LSD A;  4RN5 A;  1RMU 1;  3FZ3 A;  3U07 A;  3FHA A;  1VB4 A;  2Y26 A;  5EXO A;  4CDQ B;  4KGG A;  3THC A;  1CON A;  4BIF A;  1VIW B;  1ZX5 A;  2BVV A;  2XUE A;  4V2V A;  2JJ6 A;  4P9G A;  1W6N B;  2XHK A;  5HCH A;  2C26 A;  5CFC A;  2HWF 3;  4R52 A;  4EN8 B;  1X9T A;  3AMM A;  5A6X A;  3LSE A;  1ZBA 1;  2J1A A;  3L9J T;  4LKS A;  1VRH 1;  2UY9 A;  4B1M A;  3BUC A;  3BB6 A;  1OFN A;  5L7O B;  2R04 3;  4CCN A;  1ULP A;  3AMP A;  4LOT A;  1FPN 1;  2RM2 1;  3WF4 A;  4BZ4 A;  4OUM A;  4QX2 A;  4IEQ A;  3ZLI A;  5FPU A;  1G9D A;  2WN2 A;  3I7D A;  5LBC A;  1H30 A;  2NQY A;  4QQ2 A;  5C8C C;  3ETQ A;  4MGQ A;  1D7P M;  1NCQ C;  3APB A;  2PLV 3;  5D8A B;  3NNF A;  5LZ6 A;  4AI1 A;  3L2Y A;  2WNE A;  3WCS A;  1CJP A;  2NN8 A;  3SH4 A;  5IYY A;  4YZ5 A;  2BP6 A;  4YG6 A;  3ZXE A;  5GZC A;  3WDW A;  1D4M 1;  1KIT A;  2G19 A;  5A1L A;  2ET1 A;  4XZU G;  1UL9 A;  2LW8 A;  1C1F A;  1FXZ A;  2X10 A;  5T50 A;  2BYV E;  1RUF 3;  2DUQ A;  3CF6 E;  3RI9 A;  3I3D A;  4N9I A;  1AR8 1;  4OHX A;  4XTP A;  1MS1 A;  4S2G A;  4XBL A;  4UW3 A;  3AFK A;  5C9A A;  2XQR A;  2Y6H A;  5C4W A;  1D0H A;  2P3J A;  1LOD A;  1Y3T A;  3Q9O A;  1UCX A;  4TLF A;  4QAW A;  1DYO A;  1GOH A;  4W4Z A;  4AEM A;  1ASJ 2;  2E53 A;  5JSO A;  2QQM A;  1YIP A;  3VHR A;  1LJ7 A;  2A70 A;  5K7P A;  2RMU 1;  5HXV A;  3ACL A;  2BNN A;  4XFA A;  4AQT A;  3KGL A;  4J1W A;  1O59 A;  3AZZ A;  5F32 A;  1RUC 1;  2YXS A;  3POB A;  1LOA A;  1XNT A;  3WF3 A;  3KGZ A;  3CJI C;  4Y1X A;  1O91 A;  4DO0 A;  4K9S A;  3WLU A;  5FZL A;  2BEO A;  2XJT A;  5T5O A;  1DDL A;  2WUH A;  1UY4 A;  3ELN A;  2C1F A;  2F6B A;  1I5Z A;  1FAT A;  2BRT A;  1AXZ A;  4QQO A;  4DMI A;  1ULG A;  1EPW A;  5FZ0 A;  1YQC A;  4LIU A;  5C5U A;  4RHV 2;  1OA3 A;  1R1A 1;  1SAC A;  2OII A;  1AJO A;  2PA7 A;  4E4Z A;  5FZO A;  2GDF A;  1S2K A;  3NJX A;  4DXZ A;  1ST8 A;  4AWD A;  4DXR A;  1ZA7 A;  1R64 A;  2XL9 A;  3M7A A;  3R4D B;  4XAC A;  3WW2 A;  3ZXG A;  4WM7 A;  1OVP A;  2TEP A;  2ZGQ A;  1GQH A;  4AHY A;  3LOI A;  2B4K A;  2OW4 A;  1OQE A;  3MUY 1;  4AE2 A;  5BNP A;  4ZPI A;  2ARC A;  4LE3 A;  1UY1 A;  1LES A;  4JDM A;  3JUU A;  4HKO A;  5LA2 A;  4EJR A;  2W1U A;  4DS0 A;  3KCX A;  2I07 B;  3ZVX A;  2J1U A;  2ZX2 A;  4M3C E;  3POJ A;  2QNK A;  1CR7 A;  4ARX A;  3JB8 A;  1GWM A;  3I2I A;  4R9D A;  2C9K A;  2R06 1;  4EWE A;  2EVX A;  5I93 A;  4C8D A;  1QOO A;  4FP3 A;  5LAT A;  1S0D A;  3POG A;  1O8S A;  2G9G A;  3OUH A;  1RUJ 2;  3FE5 A;  4IEU A;  2VZU A;  1WW7 A;  3HJR A;  2IFW A;  2XHN A;  3F95 A;  4UFM A;  2ZAB A;  2VOV A;  3DL3 A;  3ES4 A;  1RUD 3;  1QGL A;  3FN9 A;  3VDD B;  1V0A A;  3VBH C;  1AYN 1;  4YW1 A;  4RD7 A;  2VH9 A;  2HJI A;  4FT8 A;  5C9A C;  2FDI A;  1GOF A;  3S30 A;  1AR9 1;  2VZQ A;  3O0X A;  4QGN A;  4E8D A;  1S0G A;  2IFR A;  2VME A;  2B9U A;  5GLZ A;  4CA9 A;  4CCO A;  5CG8 A;  1UOF A;  1N3P A;  2R07 2;  5E89 A;  1AR7 3;  1XU1 A;  4AW7 A;  3Q8B A;  3WUC A;  3OYW A;  1S0F A;  3POW A;  4NR1 A;  4Q0S A;  2ZGM A;  4N53 A;  1QJE A;  2CV6 A;  4GA9 A;  4Y20 B;  3HN1 A;  3OGV A;  4E4H A;  5CA6 A;  1PIV 3;  3HAG A;  4D6R A;  3NV1 A;  1H2K A;  4QD2 A;  5FUP A;  4CDU B;  1MPX A;  2JDA A;  1AXY A;  1NE4 A;  3EMR A;  2HWE 3;  2I45 A;  1RUG 1;  3AXD A;  4IV3 B;  2PHD A;  2J22 A;  4WV8 A;  3UKN A;  2XLA A;  5JXG A;  1KS5 A;  4QX8 A;  4Z92 B;  1RTV A;  3N9M A;  3VBS B;  4EZ4 A;  5JI9 A;  1DF0 A;  4K1Z A;  5IK4 A;  1WD4 A;  4HSJ A;  2WIN B;  1X7N A;  3JBG 3;  5FZ9 A;  4YFW A;  1PVC 1;  1Q8P A;  2R04 1;  3RI8 A;  2NM1 A;  3PVO A;  3KM5 A;  1WBF A;  3THT A;  4LKF A;  4I0W B;  1JUH A;  1FYU A;  1R08 1;  5H9S A;  3JXS A;  2WLP A;  2RDN A;  3OUJ A;  4BK5 A;  2JDZ A;  5FTT C;  5CAD A;  5KXC A;  2ZKL A;  3OEB A;  1RUN A;  3AKR A;  1JZ5 A;  1CIY A;  3KCC A;  3NMB A;  1VBA 1;  4NRQ A;  5IUQ A;  3ZN6 B;  2VCM A;  3K77 A;  5JCT A;  5L19 A;  4Q5O A;  2BBV A;  3LIH A;  2D98 A;  1YXW A;  4X8N A;  3ORJ A;  4MHR A;  4EE2 A;  4JZR A;  5L7O A;  2ZAC A;  1ZZ8 A;  1YNA A;  3KV6 A;  3TOJ A;  1CVN A;  2JG9 B;  3AP9 A;  3U4S A;  1NQJ A;  1QJY 3;  1REF A;  1Y4W A;  2DUP A;  2VOX A;  3N9O A;  3FJS A;  5A1A A; 
#chains in the Genus database with same CATH homology
 5FZ0 A;  4LIU A;  5FZ4 A;  5FZF A;  3LD8 A;  5FZO A;  5F5I A;  4Y3O A;  4Y4R A;  5FJK A;  2XML A;  4IGO A;  4CUG A;  4D6S A;  2YPD A;  5F39 A;  5F5C A;  5F3E A;  5FYT A;  5IVY A;  4CSW A;  5FXX A;  3N9Q A;  2P5B A;  2XDV A;  5FZC A;  3AL6 A;  5IVV A;  5FYM A;  3K3O A;  5FPB A;  5FY4 A;  3OPW A;  5FWE A;  2YBP A;  3KV9 A;  3U78 A;  3N9P A;  4GD4 A;  2GP5 A;  4GAZ A;  5FZO B;  5LY1 A;  2XXZ A;  3PU8 A;  5IVF A;  2WWU A;  3N9L A;  2WWJ A;  5IVE A;  3N9N A;  5FZ6 A;  5A1F A;  3PUA A;  3PUR A;  4EZH A;  5A7W A;  2PXJ A;  5F37 A;  5E6H A;  5A7N A;  5FYI A;  5IVJ A;  4C8D A;  2Q8C A;  5KR7 A;  5FZK A;  4CCN A;  4QXB A;  3KV4 A;  3LDB A;  5FP8 A;  5FBJ A;  3DXU A;  5K4L A;  2XUE A;  4HON A;  4V2V A;  2W2I A;  5FZE A;  5FV3 A;  4UF0 A;  1VRB A;  3PTR B;  4QXC A;  5FY0 A;  3OPT A;  2Q8E A;  4IGP A;  4GJZ A;  4AI9 A;  4HOO A;  5FPA A;  3AVS A;  4TN7 A;  5FZG A;  5F2W A;  4LXL A;  5A3N A;  5FYH A;  4CCO A;  4BXF A;  4AAP A;  4V2W A;  4BU2 A;  4LIV A;  5FPU A;  5CEH A;  3ZLI A;  5FZB A;  5FZ8 A;  5IVC A;  5LY2 A;  5FXW A;  3K2O A;  4DIQ A;  5LW9 A;  4BIS A;  2GP3 A;  4URA A;  2Q8D A;  3ZPO A;  5FY9 A;  5FYS A;  4QU1 A;  2YU1 A;  5ANQ A;  4QXH A;  5FPL A;  5FYV A;  4E4H A;  5IWF A;  4CCK A;  5FYZ A;  5FY7 A;  4D6R A;  5FYY A;  4EYU A;  5FUP A;  3NJY A;  3AL5 A;  2VD7 A;  4CCL A;  5F3G A;  5A7S A;  5FUN A;  5A1L A;  2YBK A;  3PU3 A;  5F3I A;  5FP3 A;  5A3T A;  2OS2 A;  5IW0 A;  5FYU A;  5FZH A;  4QX8 A;  3N9M A;  5FZ1 A;  5FZD A;  4EZ4 A;  5A7O A;  5FZ3 A;  4GJY A;  3PUS A;  2OQ7 A;  2OQ6 A;  5FZ9 A;  5FZI A;  5IVB A;  5FPV A;  5FXV A;  5FZA A;  4CCM A;  5A7W B;  4CCJ A;  4Y33 A;  5A80 A;  3PDQ A;  5FWJ A;  5FP9 A;  2OT7 A;  3K3N A;  5FY5 A;  4IGQ A;  5F2S A;  2YU2 A;  4NUB A;  4QWN A;  4ASK A;  3DXT A;  5FYC A;  2OX0 A;  5LWB A;  5FZM A;  5F32 A;  5A7Q A;  4QX7 A;  3PUQ A;  4XDP A;  3KVA A;  5A3W A;  5FXZ A;  5A7P A;  4DO0 A;  5FY8 A;  5FY1 A;  4LIT A;  5FZ7 A;  5FP4 A;  5FZL A;  5F3C A;  3KV5 A;  4UF0 B;  4XDO A;  3RVH A;  3KV6 A;  3KVB A;  5FJH A;  4D6Q A;  3AVR A;  3U4S A;  2YBS A;  5FP7 A;  5FYB A;  5ISL A;  5A3P A;  3N9O A;  3UYJ A;  5F5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...